Complet list of 1xka hssp fileClick here to see the 3D structure Complete list of 1xka.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      1XKA
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2013-09-04
HEADER     BLOOD COAGULATION FACTOR, SERINE PROTEI 1999-03-23 1XKA
COMPND     BLOOD COAGULATION FACTOR XA; BLOOD COAGULATION FACTOR XA
SOURCE     Homo sapiens; Homo sapiens
AUTHOR     Kamata, K.; Kim, S.H.
SEQLENGTH   326
NCHAIN        2 chain(s) in 1XKA data set
NALIGN      924
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : FA10_HUMAN  1Z6E    1.00  1.00   93  327  235  469  235    0    0  488  P00742     Coagulation factor X OS=Homo sapiens GN=F10 PE=1 SV=2
    2 : H2Q7T9_PANTR        1.00  1.00   93  327  235  469  235    0    0  488  H2Q7T9     Coagulation factor X OS=Pan troglodytes GN=F10 PE=2 SV=1
    3 : Q5JVE7_HUMAN        1.00  1.00   93  327  235  469  235    0    0  488  Q5JVE7     Coagulation factor X OS=Homo sapiens GN=F10 PE=2 SV=1
    4 : B7ZBK1_HUMAN        0.99  0.99    1   91   89  179   91    0    0  334  B7ZBK1     Factor X light chain OS=Homo sapiens GN=F10 PE=2 SV=1
    5 : FA10_HUMAN  1Z6E    0.99  0.99    1   91   89  179   91    0    0  488  P00742     Coagulation factor X OS=Homo sapiens GN=F10 PE=1 SV=2
    6 : G3RDY3_GORGO        0.99  0.99    1   91  101  191   91    0    0  500  G3RDY3     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=F10 PE=3 SV=1
    7 : G3RDY3_GORGO        0.99  1.00   93  327  247  481  235    0    0  500  G3RDY3     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=F10 PE=3 SV=1
    8 : H2Q7T9_PANTR        0.99  0.99    1   91   89  179   91    0    0  488  H2Q7T9     Coagulation factor X OS=Pan troglodytes GN=F10 PE=2 SV=1
    9 : Q5JVE7_HUMAN        0.99  0.99    1   91   89  179   91    0    0  488  Q5JVE7     Coagulation factor X OS=Homo sapiens GN=F10 PE=2 SV=1
   10 : Q5JVE8_HUMAN        0.99  0.99    1   91   89  179   91    0    0  332  Q5JVE8     Factor X light chain OS=Homo sapiens GN=F10 PE=2 SV=1
   11 : G1QI58_NOMLE        0.98  0.99    1   91   89  179   91    0    0  488  G1QI58     Uncharacterized protein OS=Nomascus leucogenys GN=F10 PE=3 SV=1
   12 : G1QI58_NOMLE        0.98  1.00   93  327  235  469  235    0    0  488  G1QI58     Uncharacterized protein OS=Nomascus leucogenys GN=F10 PE=3 SV=1
   13 : H2NKD5_PONAB        0.98  0.99    1   91   89  179   91    0    0  488  H2NKD5     Uncharacterized protein OS=Pongo abelii GN=F10 PE=3 SV=1
   14 : H2NKD5_PONAB        0.98  1.00   93  327  235  469  235    0    0  488  H2NKD5     Uncharacterized protein OS=Pongo abelii GN=F10 PE=3 SV=1
   15 : A9X172_PAPAN        0.97  0.99    1   91   89  179   91    0    0  488  A9X172     Coagulation factor X (Predicted) OS=Papio anubis GN=F10 PE=3 SV=1
   16 : G7PVR7_MACFA        0.97  0.99    1   91   89  179   91    0    0  488  G7PVR7     Coagulation factor X OS=Macaca fascicularis GN=EGM_08638 PE=3 SV=1
   17 : A0N065_MACMU        0.96  0.99   93  327  235  469  235    0    0  488  A0N065     Coagulation factor X protein OS=Macaca mulatta PE=2 SV=1
   18 : A0N065_MACMU        0.96  0.99    1   91   89  179   91    0    0  488  A0N065     Coagulation factor X protein OS=Macaca mulatta PE=2 SV=1
   19 : A9X172_PAPAN        0.96  0.99   93  327  235  469  235    0    0  488  A9X172     Coagulation factor X (Predicted) OS=Papio anubis GN=F10 PE=3 SV=1
   20 : F6SHG6_MACMU        0.96  0.99    1   91   89  179   91    0    0  487  F6SHG6     Uncharacterized protein OS=Macaca mulatta GN=F10 PE=2 SV=1
   21 : F6SHG6_MACMU        0.96  0.99   93  327  235  468  235    1    1  487  F6SHG6     Uncharacterized protein OS=Macaca mulatta GN=F10 PE=2 SV=1
   22 : F7HM21_MACMU        0.96  0.99   93  307  235  449  215    0    0  474  F7HM21     Uncharacterized protein OS=Macaca mulatta GN=F10 PE=2 SV=1
   23 : F7HM21_MACMU        0.96  0.99    1   91   89  179   91    0    0  474  F7HM21     Uncharacterized protein OS=Macaca mulatta GN=F10 PE=2 SV=1
   24 : G7NJN2_MACMU        0.96  0.99   93  327  235  469  235    0    0  488  G7NJN2     Coagulation factor X OS=Macaca mulatta GN=EGK_09476 PE=3 SV=1
   25 : G7NJN2_MACMU        0.96  0.99    1   91   89  179   91    0    0  488  G7NJN2     Coagulation factor X OS=Macaca mulatta GN=EGK_09476 PE=3 SV=1
   26 : G7PVR7_MACFA        0.96  0.99   93  327  235  469  235    0    0  488  G7PVR7     Coagulation factor X OS=Macaca fascicularis GN=EGM_08638 PE=3 SV=1
   27 : I2CVN8_MACMU        0.96  0.99   93  327  235  469  235    0    0  488  I2CVN8     Coagulation factor X preproprotein OS=Macaca mulatta GN=F10 PE=2 SV=1
   28 : I2CVN8_MACMU        0.96  0.99    1   91   89  179   91    0    0  488  I2CVN8     Coagulation factor X preproprotein OS=Macaca mulatta GN=F10 PE=2 SV=1
   29 : B0KW84_CALJA        0.91  0.98   93  327  235  469  235    0    0  488  B0KW84     Coagulation factor X (Predicted) OS=Callithrix jacchus GN=F10 PE=3 SV=1
   30 : B0KW84_CALJA        0.91  0.96    1   91   89  179   91    0    0  488  B0KW84     Coagulation factor X (Predicted) OS=Callithrix jacchus GN=F10 PE=3 SV=1
   31 : B1MTD3_CALMO        0.91  0.95    1   91   89  179   91    0    0  488  B1MTD3     Coagulation factor X preproprotein (Predicted) OS=Callicebus moloch GN=F10 PE=3 SV=1
   32 : B1MTD3_CALMO        0.91  0.97   93  327  235  469  235    0    0  488  B1MTD3     Coagulation factor X preproprotein (Predicted) OS=Callicebus moloch GN=F10 PE=3 SV=1
   33 : B5SNI2_OTOGA        0.88  0.95   93  327  234  468  235    0    0  487  B5SNI2     Coagulation factor X preproprotein (Predicted) OS=Otolemur garnettii GN=F10 PE=3 SV=1
   34 : FA10_MOUSE          0.88  0.97   93  327  232  466  235    0    0  481  O88947     Coagulation factor X OS=Mus musculus GN=F10 PE=1 SV=1
   35 : Q3TBR2_MOUSE        0.88  0.97   93  327  232  466  235    0    0  481  Q3TBR2     Coagulation factor X OS=Mus musculus GN=F10 PE=2 SV=1
   36 : Q3TDB9_MOUSE        0.88  0.97   93  327  244  478  235    0    0  492  Q3TDB9     Putative uncharacterized protein (Fragment) OS=Mus musculus GN=F10 PE=2 SV=1
   37 : Q3U3V1_MOUSE        0.88  0.97   93  327  244  478  235    0    0  493  Q3U3V1     Coagulation factor X OS=Mus musculus GN=F10 PE=2 SV=1
   38 : Q4FJS7_MOUSE        0.88  0.97   93  327  232  466  235    0    0  481  Q4FJS7     F10 protein OS=Mus musculus GN=F10 PE=2 SV=1
   39 : G3TXA1_LOXAF        0.87  0.96   93  327  235  469  235    0    0  477  G3TXA1     Uncharacterized protein OS=Loxodonta africana GN=LOC100656027 PE=3 SV=1
   40 : F1Q4A3_CANFA        0.86  0.95   93  327  252  486  235    0    0  497  F1Q4A3     Uncharacterized protein (Fragment) OS=Canis familiaris GN=F10 PE=3 SV=2
   41 : F6TDH5_HORSE        0.86  0.97   93  327  241  475  235    0    0  481  F6TDH5     Uncharacterized protein (Fragment) OS=Equus caballus GN=F10 PE=3 SV=1
   42 : FA10_RAT            0.86  0.95   93  327  232  467  236    1    1  482  Q63207     Coagulation factor X OS=Rattus norvegicus GN=F10 PE=2 SV=1
   43 : G1U6I7_RABIT        0.86  0.94   93  327  245  479  235    0    0  494  G1U6I7     Coagulation factor X (Fragment) OS=Oryctolagus cuniculus GN=F10 PE=3 SV=1
   44 : I3N821_SPETR        0.86  0.95   93  327  234  468  235    0    0  483  I3N821     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=F10 PE=3 SV=1
   45 : L5KUM3_PTEAL        0.86  0.94   93  327   39  273  235    0    0  288  L5KUM3     Coagulation factor X OS=Pteropus alecto GN=PAL_GLEAN10013698 PE=3 SV=1
   46 : FA10_RABIT          0.85  0.94   93  327  233  467  235    0    0  490  O19045     Coagulation factor X OS=Oryctolagus cuniculus GN=F10 PE=2 SV=1
   47 : M3WKC7_FELCA        0.85  0.94   93  327  247  481  235    0    0  483  M3WKC7     Uncharacterized protein (Fragment) OS=Felis catus GN=F10 PE=3 SV=1
   48 : FA10_BOVIN  1WHE    0.84  0.93   93  327  234  468  235    0    0  492  P00743     Coagulation factor X OS=Bos taurus GN=F10 PE=1 SV=1
   49 : Q3MHW2_BOVIN        0.84  0.93   93  327  225  459  235    0    0  483  Q3MHW2     F10 protein (Fragment) OS=Bos taurus GN=F10 PE=2 SV=1
   50 : D2I5N8_AILME        0.83  0.93   93  327  215  449  235    0    0  450  D2I5N8     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_021023 PE=3 SV=1
   51 : F1RN41_PIG          0.83  0.94   93  327  235  469  235    0    0  479  F1RN41     Uncharacterized protein OS=Sus scrofa GN=LOC733662 PE=3 SV=1
   52 : G1LUQ6_AILME        0.83  0.93   93  327  250  484  235    0    0  499  G1LUQ6     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=F10 PE=3 SV=1
   53 : B5SNI2_OTOGA        0.82  0.91    1   91   89  179   91    0    0  487  B5SNI2     Coagulation factor X preproprotein (Predicted) OS=Otolemur garnettii GN=F10 PE=3 SV=1
   54 : F1RN41_PIG          0.82  0.92    1   91   89  179   91    0    0  479  F1RN41     Uncharacterized protein OS=Sus scrofa GN=LOC733662 PE=3 SV=1
   55 : Q19AZ6_PIG          0.82  0.94   93  327  235  469  235    0    0  479  Q19AZ6     Coagulation factor X protein OS=Sus scrofa PE=2 SV=1
   56 : Q19AZ6_PIG          0.82  0.92    1   91   89  179   91    0    0  479  Q19AZ6     Coagulation factor X protein OS=Sus scrofa PE=2 SV=1
   57 : G3TXA1_LOXAF        0.80  0.91    1   91   89  179   91    0    0  477  G3TXA1     Uncharacterized protein OS=Loxodonta africana GN=LOC100656027 PE=3 SV=1
   58 : H0V549_CAVPO        0.80  0.92   93  327  239  473  235    0    0  488  H0V549     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=F10 PE=3 SV=1
   59 : G1Q5N3_MYOLU        0.78  0.88    1   91   83  173   91    0    0  378  G1Q5N3     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
   60 : I3N821_SPETR        0.78  0.93    1   91   89  179   91    0    0  483  I3N821     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=F10 PE=3 SV=1
   61 : D2I5N8_AILME        0.77  0.92    1   91   66  156   91    0    0  450  D2I5N8     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_021023 PE=3 SV=1
   62 : F6TDH5_HORSE        0.77  0.89    1   91   94  184   91    0    0  481  F6TDH5     Uncharacterized protein (Fragment) OS=Equus caballus GN=F10 PE=3 SV=1
   63 : L7N1Q3_MYOLU        0.77  0.89   96  325  238  467  230    0    0  487  L7N1Q3     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
   64 : D3Z215_MOUSE        0.76  0.88    1   91   89  179   91    0    0  321  D3Z215     Coagulation factor X OS=Mus musculus GN=F10 PE=2 SV=1
   65 : D3Z521_MOUSE        0.76  0.88    1   91   89  179   91    0    0  319  D3Z521     Coagulation factor X OS=Mus musculus GN=F10 PE=2 SV=1
   66 : G1QAT0_MYOLU        0.76  0.87    1   89   89  177   89    0    0  286  G1QAT0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
   67 : Q80Y26_MOUSE        0.76  0.88    1   91  101  191   91    0    0  340  Q80Y26     F10 protein OS=Mus musculus GN=F10 PE=2 SV=1
   68 : F7FYL8_ORNAN        0.73  0.89   93  327  231  466  236    1    1  492  F7FYL8     Uncharacterized protein OS=Ornithorhynchus anatinus GN=F10 PE=3 SV=1
   69 : Q9GMD9_ORNAN        0.73  0.89   93  327  231  466  236    1    1  469  Q9GMD9     Coagulation factor X OS=Ornithorhynchus anatinus PE=2 SV=1
   70 : G3WXN7_SARHA        0.71  0.87   93  327  237  471  235    0    0  474  G3WXN7     Uncharacterized protein OS=Sarcophilus harrisii GN=F10 PE=3 SV=1
   71 : G3WXN7_SARHA        0.70  0.84    1   91   89  179   94    2    6  474  G3WXN7     Uncharacterized protein OS=Sarcophilus harrisii GN=F10 PE=3 SV=1
   72 : L5LII3_MYODS        0.70  0.80   93  325  151  349  233    1   34  369  L5LII3     Coagulation factor X OS=Myotis davidii GN=MDA_GLEAN10006801 PE=3 SV=1
   73 : F7DSP2_MONDO        0.67  0.83    1   91  130  220   95    2    8  515  F7DSP2     Uncharacterized protein OS=Monodelphis domestica GN=F10 PE=3 SV=2
   74 : L5LKW8_MYODS        0.67  0.76   93  325   97  291  233    1   38  303  L5LKW8     Coagulation factor X OS=Myotis davidii GN=MDA_GLEAN10006803 PE=3 SV=1
   75 : G1NPS1_MELGA        0.65  0.82   93  327  218  452  235    0    0  452  G1NPS1     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100549606 PE=3 SV=1
   76 : F7FYL8_ORNAN        0.63  0.77    1   91   89  179   94    2    6  492  F7FYL8     Uncharacterized protein OS=Ornithorhynchus anatinus GN=F10 PE=3 SV=1
   77 : H0ZFN5_TAEGU        0.63  0.79   93  324  217  448  233    2    2  448  H0ZFN5     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
   78 : H0ZFN9_TAEGU        0.62  0.81  107  320    1  214  214    0    0  214  H0ZFN9     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=F10 PE=3 SV=1
   79 : Q9GMD9_ORNAN        0.62  0.77    1   91   89  179   94    2    6  469  Q9GMD9     Coagulation factor X OS=Ornithorhynchus anatinus PE=2 SV=1
   80 : G5E3K0_9PIPI        0.61  0.80   93  325   94  322  233    2    4  325  G5E3K0     Putative coagulation factor 10 (Fragment) OS=Pipa carvalhoi PE=2 SV=1
   81 : Q6PAG2_XENLA        0.56  0.72    1   91   88  178   94    2    6  462  Q6PAG2     MGC68454 protein OS=Xenopus laevis GN=f10 PE=2 SV=1
   82 : FAXD1_DEMVE         0.53  0.70    1   91   89  179   93    2    4  473  A6MFK7     Venom prothrombin activator vestarin-D1 OS=Demansia vestigiata PE=1 SV=1
   83 : Q5FW21_XENTR        0.53  0.72    1   91   88  178   94    2    6  464  Q5FW21     MGC107878 protein OS=Xenopus tropicalis GN=f10 PE=2 SV=1
   84 : H0ZFN5_TAEGU        0.52  0.76    1   91   67  160   95    4    5  448  H0ZFN5     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
   85 : FA10_CHICK          0.51  0.71    1   91   89  182   94    2    3  475  P25155     Coagulation factor X OS=Gallus gallus GN=F10 PE=1 SV=1
   86 : M3ZVN6_XIPMA        0.51  0.75   94  325  113  343  233    2    3  367  M3ZVN6     Uncharacterized protein OS=Xiphophorus maculatus GN=F10 (2 of 2) PE=3 SV=1
   87 : FA101_PSETE         0.49  0.72    1   91   89  179   93    2    4  483  Q1L659     Coagulation factor X isoform 1 OS=Pseudonaja textilis GN=F10 PE=2 SV=1
   88 : FA102_PSETE         0.49  0.73    1   91   89  179   93    2    4  463  Q1L658     Coagulation factor X isoform 2 OS=Pseudonaja textilis GN=F10 PE=2 SV=1
   89 : FAXC_OXYMI          0.49  0.72    1   91   89  179   93    2    4  467  Q58L95     Omicarin-C catalytic subunit OS=Oxyuranus microlepidotus PE=2 SV=1
   90 : FAXC_OXYSU          0.49  0.72    1   91   89  179   93    2    4  467  Q58L96     Oscutarin-C catalytic subunit OS=Oxyuranus scutellatus PE=1 SV=1
   91 : FAXC_PSETE          0.49  0.72    1   91   89  179   93    2    4  467  Q56VR3     Venom prothrombin activator pseutarin-C catalytic subunit OS=Pseudonaja textilis PE=1 SV=2
   92 : G1NPS1_MELGA        0.49  0.71    1   91   66  159   95    4    5  452  G1NPS1     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100549606 PE=3 SV=1
   93 : K7RW47_OXYMI        0.49  0.72    1   91   65  155   93    2    4  443  K7RW47     Prothrombin activator (Fragment) OS=Oxyuranus microlepidotus PE=3 SV=1
   94 : Q6IT10_PSETT4BXS    0.49  0.73    1   91   89  179   93    2    4  463  Q6IT10     Factor X-like protease OS=Pseudonaja textilis textilis PE=2 SV=1
   95 : FAXD_PSEPO          0.48  0.68    1   91   89  179   93    2    4  454  Q58L93     Venom prothrombin activator porpharin-D OS=Pseudechis porphyriacus PE=2 SV=1
   96 : G3PS22_GASAC        0.48  0.65   93  322   19  249  232    2    3  264  G3PS22     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
   97 : FA10_TROCA          0.47  0.71    1   91   89  179   93    2    4  483  Q4QXT9     Coagulation factor X OS=Tropidechis carinatus GN=F10 PE=2 SV=1
   98 : FAXD_RHING          0.47  0.69    1   91   89  179   93    2    4  455  B5G6G5     Venom prothrombin activator nigrarin-D OS=Rhinoplocephalus nigrescens PE=2 SV=1
   99 : G3TV86_LOXAF        0.47  0.62    1   90   91  184   96    3    8  445  G3TV86     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=F9 PE=3 SV=1
  100 : L9JAY1_TUPCH        0.47  0.58    1   91  151  263  113    6   22 1731  L9JAY1     Cullin-4A OS=Tupaia chinensis GN=TREES_T100021092 PE=3 SV=1
  101 : R4G7L4_9SAUR        0.47  0.71    1   91   89  179   93    2    4  244  R4G7L4     FX-Sut-7 (Fragment) OS=Suta fasciata PE=2 SV=1
  102 : A8KC28_DANRE        0.46  0.65    1   91   88  180   94    4    4  434  A8KC28     Proc protein OS=Danio rerio GN=proc PE=2 SV=1
  103 : B8JLG2_DANRE        0.46  0.66    1   91   88  180   94    4    4  427  B8JLG2     Uncharacterized protein OS=Danio rerio GN=LOC798775 PE=4 SV=1
  104 : F1R2A5_DANRE        0.46  0.65    1   91   88  180   94    4    4  434  F1R2A5     Uncharacterized protein OS=Danio rerio GN=proc PE=2 SV=1
  105 : F7ABW7_HORSE        0.46  0.58    1   89   89  180   96    3   11  446  F7ABW7     Uncharacterized protein OS=Equus caballus GN=F7 PE=3 SV=1
  106 : FAXD2_NOTSC         0.46  0.67    1   91   89  179   93    2    4  453  Q58L94     Venom prothrombin activator notecarin-D2 OS=Notechis scutatus scutatus PE=1 SV=1
  107 : FAXD_HOPST          0.46  0.67    1   91   89  179   93    2    4  455  P83370     Venom prothrombin activator hopsarin-D OS=Hoplocephalus stephensii PE=1 SV=2
  108 : G1NPS2_MELGA        0.46  0.61    1   89   89  180   96    3   11  425  G1NPS2     Uncharacterized protein OS=Meleagris gallopavo GN=LOC100549606 PE=3 SV=1
  109 : K4FTA3_CALMI        0.46  0.61    1   90   87  179   94    4    5  422  K4FTA3     Vitamin K-dependent protein C-like protein OS=Callorhynchus milii PE=2 SV=1
  110 : K4GAZ1_CALMI        0.46  0.61    1   90   87  179   94    4    5  422  K4GAZ1     Vitamin K-dependent protein C-like protein OS=Callorhynchus milii PE=2 SV=1
  111 : K4GDU4_CALMI        0.46  0.61    1   90   68  160   94    4    5  403  K4GDU4     Vitamin K-dependent protein C-like protein OS=Callorhynchus milii PE=2 SV=1
  112 : K4GHX9_CALMI        0.46  0.61    1   90   87  179   94    4    5  422  K4GHX9     Vitamin K-dependent protein C-like protein OS=Callorhynchus milii PE=2 SV=1
  113 : Q7T3B6_DANRE        0.46  0.65    1   91   88  180   94    4    4  434  Q7T3B6     Protein C (Inactivator of coagulation factors Va and VIIIa) OS=Danio rerio GN=proc PE=2 SV=1
  114 : R4FK22_9SAUR        0.46  0.67    1   91   89  179   93    2    4  280  R4FK22     FX-Hop-1 (Fragment) OS=Hoplocephalus bungaroides PE=2 SV=1
  115 : F1P2T9_CHICK        0.45  0.60    1   89   89  180   96    3   11  425  F1P2T9     Uncharacterized protein OS=Gallus gallus GN=F7 PE=3 SV=1
  116 : F1QPL4_DANRE        0.45  0.62    2   91   88  179   94    5    6  443  F1QPL4     Uncharacterized protein OS=Danio rerio GN=f7i PE=3 SV=1
  117 : F1QUI0_DANRE        0.45  0.62    2   91   89  180   94    5    6  445  F1QUI0     Uncharacterized protein (Fragment) OS=Danio rerio GN=f7i PE=2 SV=1
  118 : FA9_CAVPO           0.45  0.68   93  319   59  285  229    3    4  285  P16295     Coagulation factor IX (Fragment) OS=Cavia porcellus GN=F9 PE=2 SV=1
  119 : FA9_RAT             0.45  0.69   93  319   56  282  229    3    4  282  P16296     Coagulation factor IX (Fragment) OS=Rattus norvegicus GN=F9 PE=2 SV=1
  120 : FAXD1_NOTSC         0.45  0.69    1   91   89  179   93    2    4  455  P82807     Venom prothrombin activator notecarin-D1 OS=Notechis scutatus scutatus PE=1 SV=2
  121 : FAXD_TROCA          0.45  0.69    1   91   89  179   93    2    4  455  P81428     Venom prothrombin activator trocarin-D OS=Tropidechis carinatus PE=1 SV=2
  122 : G1PP05_MYOLU        0.45  0.58    1   89  115  206   96    3   11  472  G1PP05     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
  123 : Q804X7_CHICK        0.45  0.60    1   89   89  180   96    3   11  425  Q804X7     Coagulation factor VII OS=Gallus gallus GN=F7 PE=2 SV=1
  124 : Q8JHC9_DANRE        0.45  0.62    2   91   88  179   94    5    6  443  Q8JHC9     Coagulation factor VIIi OS=Danio rerio GN=f7i PE=2 SV=1
  125 : A4FUL1_DANRE        0.44  0.62    2   91   88  179   94    5    6  444  A4FUL1     F7i protein OS=Danio rerio GN=f7i PE=2 SV=1
  126 : B4DPM2_HUMAN        0.44  0.58    1   89   40  131   96    3   11  397  B4DPM2     cDNA FLJ55738, highly similar to Coagulation factor VII (EC 3.4.21.21) OS=Homo sapiens PE=2 SV=1
  127 : E3TDE7_9TELE        0.44  0.58    2   90   87  177   97    6   14  456  E3TDE7     Coagulation factor VII OS=Ictalurus furcatus GN=FA7 PE=2 SV=1
  128 : E3TF85_ICTPU        0.44  0.59    2   90   87  177   97    6   14  456  E3TF85     Coagulation factor VII OS=Ictalurus punctatus GN=FA7 PE=2 SV=1
  129 : F5H8B0_HUMAN        0.44  0.58    1   89   40  131   96    3   11  397  F5H8B0     Factor VII heavy chain OS=Homo sapiens GN=F7 PE=2 SV=1
  130 : FA7_BOVIN           0.44  0.58    1   89   89  180   96    3   11  447  P22457     Coagulation factor VII OS=Bos taurus GN=F7 PE=1 SV=2
  131 : FA7_HUMAN   2ZZU    0.44  0.58    1   89  109  200   96    3   11  466  P08709     Coagulation factor VII OS=Homo sapiens GN=F7 PE=1 SV=1
  132 : FA7_PANPA           0.44  0.58    1   89  109  200   96    3   11  466  Q2F9P4     Coagulation factor VII OS=Pan paniscus GN=F7 PE=3 SV=1
  133 : FA7_PANTR           0.44  0.58    1   89  109  200   96    3   11  466  Q2F9P2     Coagulation factor VII OS=Pan troglodytes GN=F7 PE=3 SV=1
  134 : FA9_RABIT           0.44  0.69   93  319   49  275  229    3    4  275  P16292     Coagulation factor IX (Fragment) OS=Oryctolagus cuniculus GN=F9 PE=2 SV=1
  135 : FA9_SHEEP           0.44  0.66   93  316   49  272  226    3    4  274  P16291     Coagulation factor IX (Fragment) OS=Ovis aries GN=F9 PE=2 SV=1
  136 : G1QI28_NOMLE        0.44  0.58    1   89  110  201   96    3   11  467  G1QI28     Uncharacterized protein OS=Nomascus leucogenys GN=F7 PE=3 SV=1
  137 : G1U5G9_RABIT        0.44  0.59    1   86   12  100   93    3   11  368  G1U5G9     Coagulation factor VII (Fragment) OS=Oryctolagus cuniculus GN=F7 PE=3 SV=1
  138 : G3RDW8_GORGO        0.44  0.58    1   89  109  200   96    3   11  466  G3RDW8     Uncharacterized protein OS=Gorilla gorilla gorilla PE=3 SV=1
  139 : H2Q7T8_PANTR        0.44  0.58    1   89  109  200   96    3   11  466  H2Q7T8     Coagulation factor VII OS=Pan troglodytes GN=F7 PE=3 SV=1
  140 : L5LH02_MYODS        0.44  0.57    1   89   89  180   96    3   11  446  L5LH02     Coagulation factor VII OS=Myotis davidii GN=MDA_GLEAN10017027 PE=3 SV=1
  141 : L9JEU6_TUPCH        0.44  0.59    1   89   63  154   96    3   11  356  L9JEU6     Coagulation factor VII OS=Tupaia chinensis GN=TREES_T100021091 PE=3 SV=1
  142 : Q2F9N4_PONPY        0.44  0.58    1   89   87  178   96    3   11  444  Q2F9N4     Cogulation factor VII (Fragment) OS=Pongo pygmaeus GN=F7 PE=3 SV=1
  143 : Q2F9N5_PONPY        0.44  0.58    1   89   87  178   96    3   11  444  Q2F9N5     Cogulation factor VII (Fragment) OS=Pongo pygmaeus GN=F7 PE=3 SV=1
  144 : Q504J5_DANRE        0.44  0.62    2   91   89  180   94    5    6  445  Q504J5     F7i protein (Fragment) OS=Danio rerio GN=f7i PE=2 SV=1
  145 : A0N0C5_MACMU        0.43  0.59    1   89  115  206   96    3   11  472  A0N0C5     Coagulation factor VII protein OS=Macaca mulatta PE=2 SV=2
  146 : A9X171_PAPAN        0.43  0.59    1   89   87  178   96    3   11  444  A9X171     Coagulation factor VII (Predicted) OS=Papio anubis GN=F7 PE=3 SV=1
  147 : B5SNI1_OTOGA        0.43  0.58    1   89   87  178   96    3   11  444  B5SNI1     Coagulation factor VII isoform a (Predicted) OS=Otolemur garnettii GN=F7 PE=3 SV=1
  148 : C1FXS4_DASNO        0.43  0.58    1   88   89  179   95    3   11  448  C1FXS4     Coagulation factor VII (Predicted) OS=Dasypus novemcinctus GN=F7 PE=3 SV=1
  149 : F1RN40_PIG          0.43  0.59    1   89   87  178   96    3   11  445  F1RN40     Uncharacterized protein OS=Sus scrofa GN=F7 PE=3 SV=2
  150 : F7FNL1_CALJA        0.43  0.58    1   89   39  130   96    3   11  396  F7FNL1     Uncharacterized protein OS=Callithrix jacchus PE=3 SV=1
  151 : F7FP08_CALJA        0.43  0.58    1   89  116  207   96    3   11  473  F7FP08     Uncharacterized protein OS=Callithrix jacchus PE=3 SV=1
  152 : F7FP19_CALJA        0.43  0.58    1   89  109  200   96    3   11  466  F7FP19     Uncharacterized protein OS=Callithrix jacchus PE=3 SV=1
  153 : F7FP26_CALJA        0.43  0.58    1   89   87  178   96    3   11  444  F7FP26     Uncharacterized protein OS=Callithrix jacchus PE=3 SV=1
  154 : F7HK40_MACMU        0.43  0.59    1   89   84  175   96    3   11  441  F7HK40     Uncharacterized protein OS=Macaca mulatta GN=F7 PE=3 SV=1
  155 : FA7_RABIT           0.43  0.58    1   88   88  178   95    3   11  444  P98139     Coagulation factor VII OS=Oryctolagus cuniculus GN=F7 PE=1 SV=2
  156 : G3PYM1_GASAC        0.43  0.63    1   89   66  157   93    3    5  425  G3PYM1     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus GN=F9 (1 of 2) PE=3 SV=1
  157 : H2S877_TAKRU        0.43  0.62   93  327   33  269  239    4    6  269  H2S877     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  158 : H2S878_TAKRU        0.43  0.62   93  327   24  260  238    3    4  260  H2S878     Uncharacterized protein OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  159 : H2ZX40_LATCH        0.43  0.62    1   89   98  189   96    3   11  439  H2ZX40     Uncharacterized protein OS=Latimeria chalumnae PE=3 SV=2
  160 : Q19AZ7_PIG          0.43  0.59    1   89   87  178   96    3   11  445  Q19AZ7     Coagulation factor VII isoform b protein OS=Sus scrofa PE=2 SV=1
  161 : Q4SB50_TETNG        0.43  0.64  115  324    1  209  210    1    1  211  Q4SB50     Chromosome undetermined SCAF14677, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00021131001 PE=3 SV=1
  162 : Q5FVZ2_XENTR        0.43  0.65    1   89   97  187   93    4    6  456  Q5FVZ2     MGC107972 protein OS=Xenopus tropicalis GN=proc PE=2 SV=1
  163 : B3XZY7_LAMJA        0.42  0.69    1   90   93  181   93    2    7  478  B3XZY7     Coagulation factor X-1 (Fragment) OS=Lampetra japonica GN=Factor X-1 PE=2 SV=1
  164 : D2I5N9_AILME        0.42  0.63    1   89   81  172   95    3    9  438  D2I5N9     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_021024 PE=3 SV=1
  165 : F6T4X3_XENTR        0.42  0.60    1   91  107  200   97    3    9  448  F6T4X3     Uncharacterized protein OS=Xenopus tropicalis GN=f7 PE=3 SV=1
  166 : FA7_MOUSE           0.42  0.59    1   89   90  181   96    3   11  446  P70375     Coagulation factor VII OS=Mus musculus GN=F7 PE=1 SV=1
  167 : G1KY08_ANOCA        0.42  0.56    1   89   89  180   96    3   11  426  G1KY08     Uncharacterized protein OS=Anolis carolinensis GN=F7 PE=3 SV=2
  168 : G1LUS2_AILME        0.42  0.63    1   89  117  208   95    3    9  474  G1LUS2     Uncharacterized protein OS=Ailuropoda melanoleuca GN=F7 PE=3 SV=1
  169 : G3HB48_CRIGR        0.42  0.65  116  325    1  200  210    2   10  202  G3HB48     Coagulation factor IX (Fragment) OS=Cricetulus griseus GN=I79_007664 PE=3 SV=1
  170 : G3PS14_GASAC        0.42  0.61    2   89   67  159   96    5   11  402  G3PS14     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  171 : G3PS25_GASAC        0.42  0.60    2   89   88  180   95    4    9  440  G3PS25     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  172 : G3WY11_SARHA        0.42  0.59    1   89   89  180   96    3   11  447  G3WY11     Uncharacterized protein OS=Sarcophilus harrisii GN=F7 PE=3 SV=1
  173 : G3WY12_SARHA        0.42  0.59    1   89   89  180   96    3   11  434  G3WY12     Uncharacterized protein OS=Sarcophilus harrisii GN=F7 PE=3 SV=1
  174 : M3WKC6_FELCA        0.42  0.59    1   89  117  208   96    3   11  474  M3WKC6     Uncharacterized protein OS=Felis catus GN=F7 PE=3 SV=1
  175 : Q0V9B6_XENTR        0.42  0.60    1   91  111  204   97    3    9  452  Q0V9B6     Coagulation factor VII OS=Xenopus tropicalis GN=f7 PE=2 SV=1
  176 : Q542C2_MOUSE        0.42  0.59    1   89   90  181   96    3   11  446  Q542C2     Coagulation factor VII, isoform CRA_b OS=Mus musculus GN=F7 PE=2 SV=1
  177 : F1Q4A4_CANFA        0.41  0.59    1   89   89  180   96    3   11  446  F1Q4A4     Uncharacterized protein OS=Canis familiaris GN=F7 PE=3 SV=2
  178 : G3SX87_LOXAF        0.41  0.58    1   89   87  180   98    4   13  448  G3SX87     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=LOC100655748 PE=3 SV=1
  179 : G5AVW2_HETGA        0.41  0.61    1   89   94  185   96    3   11  450  G5AVW2     Coagulation factor VII OS=Heterocephalus glaber GN=GW7_08589 PE=3 SV=1
  180 : K9IK51_DESRO        0.41  0.56    1   89  102  193   96    3   11  459  K9IK51     Putative trypsin-like serine protease OS=Desmodus rotundus PE=2 SV=1
  181 : M3YG51_MUSPF        0.41  0.58    1   89   93  184   96    3   11  450  M3YG51     Uncharacterized protein OS=Mustela putorius furo GN=F7 PE=3 SV=1
  182 : Q38J75_CANFA        0.41  0.59    1   89   89  180   96    3   11  446  Q38J75     Coagulation factor VII OS=Canis familiaris PE=2 SV=1
  183 : F7D6Z7_MONDO        0.40  0.56    1   89   89  180   96    3   11  442  F7D6Z7     Uncharacterized protein OS=Monodelphis domestica GN=F7 PE=3 SV=2
  184 : F8W4J1_DANRE        0.40  0.57   93  327   35  256  235    4   13  256  F8W4J1     Uncharacterized protein OS=Danio rerio GN=si:ch73-103b2.3 PE=2 SV=1
  185 : FA7_RAT             0.40  0.57    1   89   90  181   96    3   11  446  Q8K3U6     Coagulation factor VII OS=Rattus norvegicus GN=F7 PE=2 SV=1
  186 : G3VNT5_SARHA        0.40  0.57    2   90  111  201   93    5    6  460  G3VNT5     Uncharacterized protein OS=Sarcophilus harrisii GN=PROC PE=3 SV=1
  187 : H0V548_CAVPO        0.40  0.60    1   89   89  180   96    3   11  445  H0V548     Uncharacterized protein OS=Cavia porcellus GN=LOC100727155 PE=3 SV=1
  188 : H2SDJ8_TAKRU        0.40  0.57    2   91   92  182   95    6    9  467  H2SDJ8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f10 PE=3 SV=1
  189 : M3ZVT4_XIPMA        0.40  0.56    1   89   91  184   94    2    5  451  M3ZVT4     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
  190 : Q804X1_TAKRU        0.40  0.59    2   88   88  176   94    6   12  442  Q804X1     Coagulation factor VIIb OS=Takifugu rubripes PE=2 SV=1
  191 : A7RIT8_NEMVE        0.39  0.49    2   68    4   78   75    2    8   88  A7RIT8     Predicted protein OS=Nematostella vectensis GN=v1g83156 PE=4 SV=1
  192 : B2KI37_RHIFE        0.39  0.59    1   89   89  180   96    3   11  249  B2KI37     Coagulation factor VII (Predicted) (Fragment) OS=Rhinolophus ferrumequinum GN=F7 PE=3 SV=1
  193 : E7FBA9_DANRE        0.39  0.56   93  327   21  242  235    4   13  242  E7FBA9     Trypsinogen 1b OS=Danio rerio GN=si:ch73-103b2.3 PE=2 SV=1
  194 : F6QXJ0_ORNAN        0.39  0.61    1   90   21  112   95    5    8  252  F6QXJ0     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PROC PE=3 SV=1
  195 : F6QXK3_ORNAN        0.39  0.61    1   90   10  101   95    5    8  286  F6QXK3     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PROC PE=3 SV=1
  196 : F7AEE9_MONDO        0.39  0.58    2   90  111  201   93    5    6  460  F7AEE9     Uncharacterized protein OS=Monodelphis domestica GN=PROC PE=3 SV=2
  197 : F8W3C3_DANRE        0.39  0.55   93  327   29  250  235    4   13  250  F8W3C3     Uncharacterized protein (Fragment) OS=Danio rerio GN=zgc:66382 PE=3 SV=1
  198 : G1KEL3_ANOCA        0.39  0.61    2   91   95  188   97    5   10  430  G1KEL3     Uncharacterized protein OS=Anolis carolinensis GN=PROC PE=3 SV=2
  199 : G3PC46_GASAC        0.39  0.52    1   87   91  178   93    5   11  424  G3PC46     Uncharacterized protein OS=Gasterosteus aculeatus GN=PROZ (1 of 2) PE=3 SV=1
  200 : G3PC61_GASAC        0.39  0.52    1   87   91  178   93    5   11  417  G3PC61     Uncharacterized protein OS=Gasterosteus aculeatus GN=PROZ (1 of 2) PE=3 SV=1
  201 : G3PT67_GASAC        0.39  0.62    1   91   88  180   94    4    4  435  G3PT67     Uncharacterized protein OS=Gasterosteus aculeatus GN=PROC PE=3 SV=1
  202 : H2L6K2_ORYLA        0.39  0.59    2   89   88  180   94    4    7  430  H2L6K2     Uncharacterized protein OS=Oryzias latipes GN=LOC101155013 PE=3 SV=1
  203 : H2S872_TAKRU        0.39  0.58    1   89   97  188   93    3    5  455  H2S872     Uncharacterized protein OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  204 : H3CM84_TETNG        0.39  0.54    2   91   86  180   98    6   11  282  H3CM84     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  205 : H3D0U7_TETNG        0.39  0.60   93  325   14  252  240    4    8  256  H3D0U7     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  206 : Q1M2L7_LEPDS        0.39  0.53   93  323   42  257  233    8   19  260  Q1M2L7     Allergen Lep d 3 OS=Lepidoglyphus destructor PE=2 SV=1
  207 : Q1M2M8_GLYDO        0.39  0.53   93  323   42  257  233    8   19  260  Q1M2M8     Gly d 3 OS=Glycyphagus domesticus PE=2 SV=1
  208 : Q4SUA0_TETNG        0.39  0.54    2   91   92  186   98    6   11  379  Q4SUA0     Chromosome 3 SCAF13974, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00012560001 PE=3 SV=1
  209 : Q6GNA2_XENLA        0.39  0.59    1   91   91  184   97    3    9  432  Q6GNA2     MGC82927 protein OS=Xenopus laevis GN=f7 PE=2 SV=1
  210 : Q7SY86_XENLA        0.39  0.61    1   89   97  187   94    5    8  455  Q7SY86     Proc-prov protein OS=Xenopus laevis GN=proc PE=2 SV=1
  211 : Q804X0_TAKRU        0.39  0.58    1   89   97  188   93    3    5  430  Q804X0     Coagulation factor VIIc OS=Takifugu rubripes PE=2 SV=1
  212 : Q90YK1_DANRE        0.39  0.57    1   89   87  179   96    3   10  433  Q90YK1     Coagulation factor VII OS=Danio rerio GN=f7 PE=2 SV=1
  213 : Q91004_GECGE        0.39  0.61  118  327    4  233  230    6   20  235  Q91004     Thrombin (Fragment) OS=Gecko gecko GN=thrombin PE=2 SV=1
  214 : A3RKG7_HUMAN        0.38  0.65   93  327   20  261  243    3    9  273  A3RKG7     Coagulation factor VII (Fragment) OS=Homo sapiens PE=2 SV=1
  215 : A5PLD4_DANRE        0.38  0.56    1   90   95  184   95    4   10  398  A5PLD4     LOC558106 protein (Fragment) OS=Danio rerio GN=prozb PE=2 SV=1
  216 : A7S9K6_NEMVE        0.38  0.53   93  327   27  261  238    3    6  261  A7S9K6     Predicted protein OS=Nematostella vectensis GN=v1g229711 PE=3 SV=1
  217 : B3M1Y7_DROAN        0.38  0.59  118  326   10  218  215    6   12  223  B3M1Y7     GF19924 OS=Drosophila ananassae GN=Dana\GF19924 PE=3 SV=1
  218 : B3XZY9_LAMJA        0.38  0.59    2   91   90  187   98    4    8  484  B3XZY9     Coagulation factor VII OS=Lampetra japonica GN=Factor VII PE=2 SV=1
  219 : B4NJM4_DROWI        0.38  0.59  118  326   10  218  215    6   12  223  B4NJM4     GK13880 OS=Drosophila willistoni GN=Dwil\GK13880 PE=3 SV=1
  220 : C0HAZ4_SALSA        0.38  0.51    1   87   99  186   93    5   11  434  C0HAZ4     Coagulation factor X OS=Salmo salar GN=FA10 PE=2 SV=1
  221 : C3YQH0_BRAFL        0.38  0.58  110  324    1  219  224    5   14  227  C3YQH0     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_241809 PE=3 SV=1
  222 : C3ZES1_BRAFL        0.38  0.57  110  320    1  217  222    6   16  223  C3ZES1     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_209883 PE=3 SV=1
  223 : E3NYI2_9NEOP        0.38  0.55   93  323    1  221  234    7   16  224  E3NYI2     Fibrinolytic enzyme (Fragment) OS=Eupolyphaga sinensis PE=2 SV=1
  224 : F1NGY6_CHICK        0.38  0.61    1   90   88  179   94    5    6  433  F1NGY6     Uncharacterized protein OS=Gallus gallus GN=PROC PE=2 SV=1
  225 : F1QFP3_DANRE        0.38  0.57    1   89   87  179   95    3    8  433  F1QFP3     Uncharacterized protein OS=Danio rerio GN=f7 PE=3 SV=1
  226 : F1QZU6_DANRE        0.38  0.56    1   90   92  181   95    4   10  395  F1QZU6     Uncharacterized protein OS=Danio rerio GN=si:zfos-1962a1.5 PE=3 SV=2
  227 : F7FYM3_ORNAN        0.38  0.57    1   84   90  165   93    5   26  408  F7FYM3     Uncharacterized protein OS=Ornithorhynchus anatinus GN=PROZ PE=3 SV=1
  228 : G1MRY6_MELGA        0.38  0.61    1   90   88  179   94    5    6  433  G1MRY6     Uncharacterized protein OS=Meleagris gallopavo GN=LOC100546662 PE=3 SV=1
  229 : G3HU99_CRIGR        0.38  0.57   93  327   26  250  238    9   16  250  G3HU99     Trypsin-4 OS=Cricetulus griseus GN=I79_014507 PE=3 SV=1
  230 : G3XL84_CYPCA        0.38  0.54   93  327   21  242  235    4   13  242  G3XL84     Trypsin 1 OS=Cyprinus carpio GN=tryp1 PE=2 SV=1
  231 : G9B5E8_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5E8     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  232 : G9B5F3_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5F3     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  233 : G9B5F4_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5F4     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  234 : G9B5F5_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5F5     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  235 : G9B5F6_9NEOP        0.38  0.55   93  323   31  251  237   12   22  254  G9B5F6     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  236 : G9B5F7_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5F7     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  237 : G9B5G0_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5G0     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  238 : G9B5G4_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5G4     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  239 : G9B5G5_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5G5     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  240 : G9B5G8_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5G8     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  241 : G9B5H4_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5H4     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  242 : H0VMC9_CAVPO        0.38  0.61    1   90  100  189   93    5    6  465  H0VMC9     Uncharacterized protein OS=Cavia porcellus GN=LOC100724519 PE=3 SV=1
  243 : H2LQV9_ORYLA        0.38  0.58    1   91   88  180   95    5    6  439  H2LQV9     Uncharacterized protein OS=Oryzias latipes GN=LOC101168986 PE=3 SV=1
  244 : H2LQW1_ORYLA        0.38  0.58    1   91   88  180   95    5    6  437  H2LQW1     Uncharacterized protein OS=Oryzias latipes GN=LOC101168986 PE=3 SV=1
  245 : H2S874_TAKRU        0.38  0.54    2   87   87  177   94    6   11  421  H2S874     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  246 : H2S875_TAKRU        0.38  0.54    2   87   69  159   94    6   11  403  H2S875     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  247 : H2S879_TAKRU        0.38  0.54    2   87   88  178   94    6   11  441  H2S879     Uncharacterized protein OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  248 : H2UUW9_TAKRU        0.38  0.55    1   88   86  174   94    5   11  422  H2UUW9     Uncharacterized protein OS=Takifugu rubripes GN=PROZ (1 of 2) PE=3 SV=1
  249 : H2UUX0_TAKRU        0.38  0.55    1   88   86  174   94    5   11  421  H2UUX0     Uncharacterized protein OS=Takifugu rubripes GN=PROZ (1 of 2) PE=3 SV=1
  250 : H3CM83_TETNG        0.38  0.61    2   88   88  176   94    6   12  442  H3CM83     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
  251 : H3CM85_TETNG        0.38  0.61    1   90   97  189   94    3    5  430  H3CM85     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
  252 : I3KKE3_ORENI        0.38  0.47    1   88   85  172   93    4   10  420  I3KKE3     Uncharacterized protein OS=Oreochromis niloticus GN=PROZ (1 of 2) PE=3 SV=1
  253 : Q2F9N7_9PRIM        0.38  0.52    1   89   65  156   97    3   13  183  Q2F9N7     Cogulation factor VII (Fragment) OS=Gorilla gorilla GN=F7 PE=4 SV=1
  254 : Q4SUA1_TETNG        0.38  0.61    2   88   86  174   94    6   12  453  Q4SUA1     Chromosome 3 SCAF13974, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00012559001 PE=3 SV=1
  255 : Q504H3_DANRE        0.38  0.57    1   89   87  179   95    3    8  433  Q504H3     Coagulation factor VII OS=Danio rerio GN=f7 PE=2 SV=1
  256 : Q7SX90_DANRE        0.38  0.55   93  327   21  242  235    4   13  242  Q7SX90     Zgc:66382 OS=Danio rerio GN=zgc:66382 PE=2 SV=1
  257 : Q804X2_TAKRU        0.38  0.55    2   87   88  178   94    6   11  441  Q804X2     Coagulation factor VII OS=Takifugu rubripes PE=2 SV=1
  258 : Q804X5_CHICK        0.38  0.61    1   90   88  179   94    5    6  433  Q804X5     Anticoagulant protein C OS=Gallus gallus GN=PROC PE=2 SV=1
  259 : Q8JHD0_DANRE        0.38  0.55    1   89   87  179   96    5   10  433  Q8JHD0     Coagulation factor VII OS=Danio rerio GN=f7 PE=3 SV=1
  260 : B3Y604_TRIHK        0.37  0.52   93  327   21  242  235    4   13  242  B3Y604     Trypsin OS=Tribolodon hakonensis PE=2 SV=2
  261 : B3Y6D5_SALLE        0.37  0.54   93  326   21  241  234    4   13  242  B3Y6D5     Trypsin OS=Salvelinus leucomaenis PE=2 SV=2
  262 : B5X8D4_SALSA        0.37  0.54   93  326   21  241  234    4   13  242  B5X8D4     Trypsin-1 OS=Salmo salar GN=TRY1 PE=2 SV=1
  263 : C3YIV9_BRAFL        0.37  0.59  106  324    3  226  227    6   11  229  C3YIV9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_86658 PE=3 SV=1
  264 : C3ZLB7_BRAFL        0.37  0.59   93  323   15  245  240    5   18  250  C3ZLB7     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_121932 PE=3 SV=1
  265 : D2D389_CTEID        0.37  0.54   93  327   21  242  235    4   13  242  D2D389     Trypsinogen OS=Ctenopharyngodon idella PE=2 SV=1
  266 : E0VW11_PEDHC        0.37  0.60   93  326   35  268  241    8   14  274  E0VW11     Tripsin, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM472610 PE=3 SV=1
  267 : F1R894_DANRE        0.37  0.54   93  327   21  242  235    4   13  242  F1R894     Trypsinogen 1a OS=Danio rerio GN=zgc:66382 PE=2 SV=1
  268 : F4X2V3_ACREC        0.37  0.57   93  326   10  242  243    8   19  249  F4X2V3     Serine proteinase stubble (Fragment) OS=Acromyrmex echinatior GN=G5I_12634 PE=3 SV=1
  269 : F6R7E8_MOUSE        0.37  0.57   93  327   24  247  237    7   15  247  F6R7E8     Protein Gm2663 OS=Mus musculus GN=Gm2663 PE=3 SV=1
  270 : G3HUA0_CRIGR        0.37  0.56   93  327    6  230  238    8   16  230  G3HUA0     Trypsin-4 (Fragment) OS=Cricetulus griseus GN=I79_014508 PE=3 SV=1
  271 : G3VBJ1_SARHA        0.37  0.55   93  327   26  249  236    6   13  250  G3VBJ1     Uncharacterized protein OS=Sarcophilus harrisii PE=3 SV=1
  272 : G3XL85_CYPCA        0.37  0.54   93  327   21  242  235    4   13  242  G3XL85     Trypsin 2 OS=Cyprinus carpio GN=tryp2 PE=2 SV=1
  273 : G9B5E7_9NEOP        0.37  0.54   93  324   31  252  238   12   22  254  G9B5E7     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  274 : G9B5E9_9NEOP        0.37  0.54   93  324   31  252  239   13   24  254  G9B5E9     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  275 : G9B5F1_9NEOP        0.37  0.54   93  324   31  252  238   12   22  254  G9B5F1     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  276 : G9B5F2_9NEOP        0.37  0.54   93  323   31  251  237   12   22  254  G9B5F2     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  277 : G9B5F9_9NEOP        0.37  0.54   93  324   31  252  238   12   22  254  G9B5F9     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  278 : G9B5G1_9NEOP        0.37  0.54   93  325   31  253  239   12   22  254  G9B5G1     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  279 : G9B5G7_9NEOP        0.37  0.54   93  323   31  251  237   12   22  254  G9B5G7     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  280 : G9B5H2_9NEOP        0.37  0.54   93  323   31  251  237   12   22  254  G9B5H2     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  281 : H2LPB8_ORYLA        0.37  0.56   93  327   33  258  238    7   15  258  H2LPB8     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101170788 PE=3 SV=1
  282 : H2S873_TAKRU        0.37  0.56    1   87   95  186   94    4    9  430  H2S873     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  283 : H2SA40_TAKRU        0.37  0.60    1   91   88  180   95    5    6  428  H2SA40     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101069699 PE=3 SV=1
  284 : H2SA42_TAKRU        0.37  0.60    1   91   85  177   95    5    6  468  H2SA42     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101069699 PE=3 SV=1
  285 : H2UMW1_TAKRU        0.37  0.57   93  324   16  236  235    5   17  238  H2UMW1     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071730 PE=3 SV=1
  286 : H2UMW2_TAKRU        0.37  0.57   93  326   22  242  235    5   15  245  H2UMW2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071730 PE=3 SV=1
  287 : H2UMW3_TAKRU        0.37  0.57   93  326   29  249  235    5   15  252  H2UMW3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071730 PE=3 SV=1
  288 : H2UUW2_TAKRU        0.37  0.54    1   88   86  177   97    5   14  437  H2UUW2     Uncharacterized protein OS=Takifugu rubripes GN=PROZ (1 of 2) PE=3 SV=1
  289 : H2UUW3_TAKRU        0.37  0.54    1   88   86  177   97    5   14  436  H2UUW3     Uncharacterized protein OS=Takifugu rubripes GN=PROZ (1 of 2) PE=3 SV=1
  290 : H2UUW4_TAKRU        0.37  0.54    1   88   86  177   97    5   14  437  H2UUW4     Uncharacterized protein OS=Takifugu rubripes GN=PROZ (1 of 2) PE=3 SV=1
  291 : H2UUW6_TAKRU        0.37  0.54    1   88   86  177   97    5   14  435  H2UUW6     Uncharacterized protein OS=Takifugu rubripes GN=PROZ (1 of 2) PE=3 SV=1
  292 : H2UUW7_TAKRU        0.37  0.54    1   88   86  177   97    5   14  439  H2UUW7     Uncharacterized protein OS=Takifugu rubripes GN=PROZ (1 of 2) PE=3 SV=1
  293 : H2UUW8_TAKRU        0.37  0.54    1   88   86  177   97    5   14  426  H2UUW8     Uncharacterized protein OS=Takifugu rubripes GN=PROZ (1 of 2) PE=3 SV=1
  294 : H3K3Y6_CTEID        0.37  0.55   93  327   21  242  235    4   13  242  H3K3Y6     Trypsin OS=Ctenopharyngodon idella GN=trp PE=2 SV=1
  295 : I5AP59_DROPS        0.37  0.57   93  326   20  251  240    7   14  256  I5AP59     GA11223, isoform B OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA11223 PE=3 SV=1
  296 : L5KQU0_PTEAL        0.37  0.56   93  327   25  247  236    5   14  247  L5KQU0     Anionic trypsin OS=Pteropus alecto GN=PAL_GLEAN10019030 PE=3 SV=1
  297 : PROZ_MOUSE          0.37  0.57    2   91   91  180   97    2   14  399  Q9CQW3     Vitamin K-dependent protein Z OS=Mus musculus GN=Proz PE=1 SV=1
  298 : Q05CL2_MOUSE        0.37  0.57    2   91   21  110   97    2   14  329  Q05CL2     Proz protein OS=Mus musculus GN=Proz PE=2 SV=1
  299 : Q28731_RABIT        0.37  0.60  115  324    1  231  231    6   21  235  Q28731     Thrombin (Fragment) OS=Oryctolagus cuniculus GN=thrombin PE=2 SV=1
  300 : Q69EZ7_HUMAN        0.37  0.59   93  324    1  254  254    7   22  259  Q69EZ7     Prothrombin B-chain (Fragment) OS=Homo sapiens PE=2 SV=1
  301 : Q69EZ8_HUMAN        0.37  0.59   93  325   37  291  255    8   22  295  Q69EZ8     Prothrombin (Fragment) OS=Homo sapiens PE=2 SV=1
  302 : Q7Z0G1_PHLPP        0.37  0.51   93  324   31  255  236    7   15  257  Q7Z0G1     Trypsin 3 OS=Phlebotomus papatasi GN=tryp3 PE=2 SV=1
  303 : Q8CI01_MOUSE        0.37  0.57    2   91   91  180   97    2   14  241  Q8CI01     Protein Z, vitamin K-dependent plasma glycoprotein, isoform CRA_a OS=Mus musculus GN=Proz PE=2 SV=1
  304 : Q9CPN7_MOUSE        0.37  0.57   93  327   24  247  237    6   15  247  Q9CPN7     Protein 1810009J06Rik OS=Mus musculus GN=1810009J06Rik PE=2 SV=1
  305 : TRY4_RAT            0.37  0.57   93  327   24  247  237    7   15  247  P12788     Trypsin-4 OS=Rattus norvegicus GN=Try4 PE=2 SV=1
  306 : A7RKX8_NEMVE        0.36  0.50   93  321    2  240  242    7   16  240  A7RKX8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g85345 PE=3 SV=1
  307 : A7RXZ9_NEMVE        0.36  0.60  117  325   10  232  223    5   14  232  A7RXZ9     Predicted protein OS=Nematostella vectensis GN=v1g164017 PE=3 SV=1
  308 : A7UNU1_9ACAR        0.36  0.52   93  323   29  250  236   10   19  253  A7UNU1     Ale o 3 allergen OS=Aleuroglyphus ovatus PE=2 SV=1
  309 : A7VMR7_SOLSE        0.36  0.55   93  327   25  247  236    6   14  247  A7VMR7     Trypsinogen 2 OS=Solea senegalensis GN=Tryp2 PE=2 SV=1
  310 : B0KZK0_ACASI        0.36  0.55   93  322   37  258  234    8   16  263  B0KZK0     Allergen Aca s 3 OS=Acarus siro PE=2 SV=1
  311 : B0WAI9_CULQU        0.36  0.58   93  326   21  252  240    7   14  258  B0WAI9     Coagulation factor XI OS=Culex quinquefasciatus GN=CpipJ_CPIJ004093 PE=3 SV=1
  312 : B3RY72_TRIAD        0.36  0.57   93  327    2  240  247    8   20  240  B3RY72     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_25111 PE=3 SV=1
  313 : B3Y8K5_ONCKE2ZPR    0.36  0.54   93  326    1  221  234    4   13  222  B3Y8K5     Anionic trypsin isoform 2 (Fragment) OS=Oncorhynchus keta PE=1 SV=1
  314 : B3Y8K6_ONCKE2ZPS    0.36  0.54   93  326    1  221  234    4   13  222  B3Y8K6     Anionic trypsin isoform 3 (Fragment) OS=Oncorhynchus keta PE=1 SV=1
  315 : B5X8T3_SALSA        0.36  0.53   93  326   21  241  234    4   13  242  B5X8T3     Trypsin-1 OS=Salmo salar GN=TRY1 PE=2 SV=1
  316 : B5XEC7_SALSA        0.36  0.54   93  326   21  241  234    4   13  242  B5XEC7     Trypsin-1 OS=Salmo salar GN=TRY1 PE=2 SV=1
  317 : B6VRV3_ONCMA        0.36  0.54   93  326   21  241  234    4   13  242  B6VRV3     Trypsin OS=Oncorhynchus masou GN=tryp PE=2 SV=2
  318 : B6VRV4_9TELE        0.36  0.54   93  327    1  222  235    4   13  222  B6VRV4     Trypsin (Fragment) OS=Pygocentrus nattereri GN=tryp PE=2 SV=1
  319 : B7P540_IXOSC        0.36  0.58   93  327   44  276  243    8   18  277  B7P540     Proclotting enzyme, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW001322 PE=3 SV=1
  320 : B9V2X7_EPICO        0.36  0.54   93  326   24  244  236    7   17  245  B9V2X7     Trypsinogen 1a (Fragment) OS=Epinephelus coioides PE=2 SV=1
  321 : C3ZPL4_BRAFL        0.36  0.55   93  321   22  238  231    6   16  242  C3ZPL4     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_88359 PE=3 SV=1
  322 : C3ZRZ3_BRAFL        0.36  0.55   93  325   27  252  236    5   13  252  C3ZRZ3     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_272022 PE=3 SV=1
  323 : D2HAJ7_AILME        0.36  0.54   93  321    1  225  235    7   16  233  D2HAJ7     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_007462 PE=3 SV=1
  324 : D6WAH6_TRICA        0.36  0.56   93  327   29  254  237    6   13  254  D6WAH6     Serine protease P24 OS=Tribolium castaneum GN=P24 PE=3 SV=1
  325 : E0VFA7_PEDHC        0.36  0.57   93  316   29  240  230   12   24  255  E0VFA7     Trypsin-delta, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM153430 PE=3 SV=1
  326 : E1CJC3_9TELE        0.36  0.54   93  326   21  241  234    4   13  242  E1CJC3     Trypsin OS=Parahucho perryi GN=tryp1 PE=2 SV=1
  327 : E1CJC4_9TELE        0.36  0.54   93  326   21  241  234    4   13  242  E1CJC4     Trypsin OS=Parahucho perryi GN=tryp2 PE=2 SV=1
  328 : E2AFY8_CAMFO        0.36  0.61   93  326    2  233  240    7   14  238  E2AFY8     Trypsin-1 (Fragment) OS=Camponotus floridanus GN=EAG_11670 PE=3 SV=1
  329 : E9HBL5_DAPPU        0.36  0.58   93  326    2  236  241    7   13  249  E9HBL5     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_60765 PE=3 SV=1
  330 : EURM3_EURMA         0.36  0.54   93  322   30  257  239   10   20  261  O97370     Mite allergen Eur m 3 OS=Euroglyphus maynei GN=EURM3 PE=1 SV=1
  331 : F2WR16_EPICO        0.36  0.53   93  325   21  240  233    4   13  242  F2WR16     Trypsinogen 1a OS=Epinephelus coioides PE=2 SV=1
  332 : F4X2V2_ACREC        0.36  0.60   93  326   11  242  240    7   14  248  F4X2V2     Serine proteinase stubble (Fragment) OS=Acromyrmex echinatior GN=G5I_12633 PE=3 SV=1
  333 : F6SB70_MONDO        0.36  0.54   93  327   25  247  236    5   14  247  F6SB70     Uncharacterized protein OS=Monodelphis domestica GN=LOC100010109 PE=3 SV=1
  334 : F6V8R1_XENTR        0.36  0.55   93  327   25  251  237    4   12  251  F6V8R1     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=prss3 PE=3 SV=1
  335 : F7A744_MONDO        0.36  0.53   93  324    4  223  234    7   16  227  F7A744     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=LOC100010991 PE=3 SV=1
  336 : F7BIQ2_MONDO        0.36  0.57   93  327   23  245  236    5   14  246  F7BIQ2     Uncharacterized protein OS=Monodelphis domestica GN=LOC100010951 PE=3 SV=1
  337 : F7HBQ4_MACMU        0.36  0.55   93  327   38  260  236    6   14  261  F7HBQ4     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=2 SV=1
  338 : G1FE64_9TELE        0.36  0.55   93  324   11  228  232    5   14  231  G1FE64     Trypsinogen I (Fragment) OS=Sardinops caeruleus GN=try1 PE=2 SV=1
  339 : G3LUK8_9PERC        0.36  0.54   93  327   25  247  236    5   14  247  G3LUK8     Trypsinogen OS=Channa argus PE=2 SV=1
  340 : G3PC41_GASAC        0.36  0.49    1   87   91  183   97    5   14  441  G3PC41     Uncharacterized protein OS=Gasterosteus aculeatus GN=PROZ (1 of 2) PE=3 SV=1
  341 : G3PC79_GASAC        0.36  0.49    1   87   91  183   97    5   14  429  G3PC79     Uncharacterized protein OS=Gasterosteus aculeatus GN=PROZ (1 of 2) PE=3 SV=1
  342 : G3VR43_SARHA        0.36  0.55   93  327   25  247  236    5   14  247  G3VR43     Uncharacterized protein OS=Sarcophilus harrisii PE=3 SV=1
  343 : G5C5M8_HETGA        0.36  0.56   93  327   24  245  236    7   15  245  G5C5M8     Cationic trypsin-3 OS=Heterocephalus glaber GN=GW7_03992 PE=3 SV=1
  344 : G9B5H0_9NEOP        0.36  0.53   93  323   31  251  237   12   22  254  G9B5H0     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  345 : G9B5J8_9NEOP        0.36  0.53   93  323   31  251  236   12   20  254  G9B5J8     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  346 : G9JKF2_EPICO        0.36  0.53   93  325   21  240  233    4   13  242  G9JKF2     Trypsinogens 1 OS=Epinephelus coioides PE=2 SV=1
  347 : H2MEQ3_ORYLA        0.36  0.55   93  327   30  251  235    5   13  251  H2MEQ3     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101161921 PE=3 SV=1
  348 : H2RVJ0_TAKRU        0.36  0.53    2   91   93  188   99    3   12  436  H2RVJ0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101064607 PE=3 SV=1
  349 : H2SA41_TAKRU        0.36  0.58    1   91   86  181   98    5    9  424  H2SA41     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101069699 PE=3 SV=1
  350 : H2UMW4_TAKRU        0.36  0.55   93  326   22  252  245    6   25  253  H2UMW4     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071730 PE=3 SV=1
  351 : H3C2H9_TETNG        0.36  0.60    1   91   75  167   94    4    4  427  H3C2H9     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=PROC PE=3 SV=1
  352 : H3C399_TETNG        0.36  0.60    1   91   86  178   94    4    4  438  H3C399     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=PROC PE=3 SV=1
  353 : H3C4D6_TETNG        0.36  0.60    1   91   92  184   94    4    4  444  H3C4D6     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=PROC PE=3 SV=1
  354 : H3CAT7_TETNG        0.36  0.60    1   91   87  179   94    4    4  439  H3CAT7     Uncharacterized protein OS=Tetraodon nigroviridis GN=PROC PE=3 SV=1
  355 : H3CCV1_TETNG        0.36  0.56   93  326   16  240  237    5   15  241  H3CCV1     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  356 : H9D159_9TELE        0.36  0.56   93  327    1  222  235    4   13  222  H9D159     Trypsin (Fragment) OS=Colossoma macropomum PE=2 SV=1
  357 : I3NCW3_SPETR        0.36  0.56   93  327   24  246  236    5   14  246  I3NCW3     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
  358 : I4DNU8_PAPXU        0.36  0.55   93  326   23  258  244   11   18  264  I4DNU8     Serine protease OS=Papilio xuthus PE=2 SV=1
  359 : K7J097_NASVI        0.36  0.53   93  322   41  266  240   12   24  270  K7J097     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
  360 : K7J098_NASVI        0.36  0.54   93  325   34  262  241   11   20  263  K7J098     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
  361 : K7J4K9_NASVI        0.36  0.52   93  320   12  228  229    6   13  236  K7J4K9     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
  362 : K7J4L0_NASVI        0.36  0.54   93  320   30  243  229    7   16  252  K7J4L0     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
  363 : M3WFX9_FELCA        0.36  0.56   93  327   34  256  236    5   14  256  M3WFX9     Uncharacterized protein (Fragment) OS=Felis catus GN=LOC101085707 PE=3 SV=1
  364 : M3XJJ3_LATCH        0.36  0.59    1   90   89  180   94    5    6  430  M3XJJ3     Uncharacterized protein OS=Latimeria chalumnae PE=3 SV=1
  365 : M3YAT9_MUSPF        0.36  0.55   93  327   24  246  236    6   14  247  M3YAT9     Uncharacterized protein OS=Mustela putorius furo PE=3 SV=1
  366 : M4AF88_XIPMA        0.36  0.56    1   91  101  193   95    5    6  442  M4AF88     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus GN=PROC PE=3 SV=1
  367 : M4AG26_XIPMA        0.36  0.46    1   90   91  181  101    5   21  476  M4AG26     Uncharacterized protein OS=Xiphophorus maculatus GN=F9 (2 of 2) PE=3 SV=1
  368 : Q0IF79_AEDAE        0.36  0.53   93  320   29  247  235   12   23  256  Q0IF79     AAEL006429-PA OS=Aedes aegypti GN=AAEL006429 PE=3 SV=1
  369 : Q171W0_AEDAE        0.36  0.54   93  323   10  242  240    9   16  251  Q171W0     AAEL007511-PA (Fragment) OS=Aedes aegypti GN=AAEL007511 PE=3 SV=1
  370 : Q171W1_AEDAE        0.36  0.57   93  326   10  241  240    7   14  247  Q171W1     AAEL007514-PA (Fragment) OS=Aedes aegypti GN=AAEL007514 PE=3 SV=1
  371 : Q17BS3_AEDAE        0.36  0.54   93  327   31  266  246   12   21  270  Q17BS3     AAEL004885-PA OS=Aedes aegypti GN=AAEL004885 PE=3 SV=1
  372 : Q4SH18_TETNG        0.36  0.53   93  327   24  246  236    6   14  246  Q4SH18     Chromosome 8 SCAF14587, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00018366001 PE=3 SV=1
  373 : Q4T8C0_TETNG        0.36  0.56   93  326   16  240  237    5   15  240  Q4T8C0     Chromosome 8 SCAF7842, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00005309001 PE=3 SV=1
  374 : Q52V24_ASTLP2F91    0.36  0.56   93  321    1  233  239    5   16  237  Q52V24     Hepatopancreas trypsin (Fragment) OS=Astacus leptodactylus PE=1 SV=1
  375 : Q6W741_9NEOP        0.36  0.57   93  315   29  240  228    9   21  253  Q6W741     Trypsinogen OS=Pediculus humanus GN=TRY1 PE=2 SV=1
  376 : Q7T1R8_9TELE        0.36  0.54   93  327   21  242  235    4   13  242  Q7T1R8     Trypsinogen OS=Pangasianodon hypophthalmus PE=2 SV=1
  377 : Q7TT42_MOUSE        0.36  0.56   93  327   24  246  237    6   16  246  Q7TT42     Trypsinogen 5 OS=Mus musculus GN=1810009J06Rik PE=2 SV=1
  378 : Q8AV11_ONCKE2ZPQ    0.36  0.53   93  326    1  221  234    4   13  222  Q8AV11     Anionic trypsin (Fragment) OS=Oncorhynchus keta PE=1 SV=1
  379 : Q8QGW3_ANGJA        0.36  0.54   93  326   21  243  234    4   11  244  Q8QGW3     Trypsinogen OS=Anguilla japonica GN=try PE=2 SV=1
  380 : Q90244_ACITR        0.36  0.59  115  324    1  230  230    6   20  234  Q90244     Thrombin (Fragment) OS=Acipenser transmontanus GN=thrombin PE=2 SV=1
  381 : Q98TG9_9TELE        0.36  0.54   93  325   20  238  233    6   14  241  Q98TG9     Trypsinogen II OS=Engraulis japonicus GN=aTryII PE=2 SV=1
  382 : Q9XY51_CTEFE        0.36  0.56   93  313   24  241  228    8   17  256  Q9XY51     Trypsin-like serine protease (Fragment) OS=Ctenocephalides felis GN=SP-2 PE=2 SV=1
  383 : Q9XY59_CTEFE        0.36  0.54   93  315    4  228  235    8   22  242  Q9XY59     Trypsin-like serine protease (Fragment) OS=Ctenocephalides felis GN=SP-40 PE=2 SV=1
  384 : Q9XY60_CTEFE        0.36  0.53   93  323   21  240  233    8   15  245  Q9XY60     Trypsin-like serine protease (Fragment) OS=Ctenocephalides felis GN=SP-5 PE=2 SV=1
  385 : R7V6Y6_9ANNE        0.36  0.58   93  327   14  251  243    5   13  260  R7V6Y6     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_119007 PE=4 SV=1
  386 : R7VEX5_9ANNE        0.36  0.55   93  327   12  251  244    6   13  251  R7VEX5     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_127358 PE=4 SV=1
  387 : TRY1_SALSA  1UTJ    0.36  0.53   93  326   21  241  234    4   13  242  P35031     Trypsin-1 OS=Salmo salar PE=1 SV=1
  388 : TRY2_SALSA          0.36  0.54   93  326   10  230  234    4   13  231  P35032     Trypsin-2 (Fragment) OS=Salmo salar PE=2 SV=1
  389 : A0FGS8_CANFA        0.35  0.53   93  327   20  242  236    5   14  243  A0FGS8     Anionic trypsinogen (Fragment) OS=Canis familiaris PE=3 SV=1
  390 : A1KXH3_DERFA        0.35  0.54   93  322   28  255  240   10   22  259  A1KXH3     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
  391 : A4UCN5_LUTLO        0.35  0.54   93  322   27  249  235    7   17  253  A4UCN5     Trypsin 2 OS=Lutzomyia longipalpis GN=tryp2 PE=2 SV=1
  392 : A4UWM7_ORYLA        0.35  0.54   93  327   21  242  235    4   13  242  A4UWM7     Trypsinogen OS=Oryzias latipes GN=tryp PE=2 SV=1
  393 : A4ZX98_MYXAS        0.35  0.55   93  327   24  246  236    5   14  246  A4ZX98     Trypsin OS=Myxocyprinus asiaticus PE=2 SV=1
  394 : A7LD78_PAROL        0.35  0.54   93  326   21  240  236    8   18  241  A7LD78     Trypsinogen 2 OS=Paralichthys olivaceus GN=TRP2 PE=2 SV=1
  395 : A7S1T0_NEMVE        0.35  0.51   93  325   18  250  236    3    6  252  A7S1T0     Predicted protein OS=Nematostella vectensis GN=v1g101093 PE=3 SV=1
  396 : A7S5M4_NEMVE        0.35  0.52   93  327   13  249  242    8   12  249  A7S5M4     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g105460 PE=3 SV=1
  397 : A7S9K4_NEMVE        0.35  0.57   93  326    1  234  237    3    6  235  A7S9K4     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g110126 PE=3 SV=1
  398 : A7SWQ5_NEMVE        0.35  0.55   93  325    7  239  237    5    8  239  A7SWQ5     Predicted protein OS=Nematostella vectensis GN=v1g218669 PE=3 SV=1
  399 : A7TVD3_BOMMO        0.35  0.51   93  323   35  257  237   11   20  260  A7TVD3     Cocoonase OS=Bombyx mori PE=2 SV=1
  400 : A7UNT7_DERPT        0.35  0.53   93  322   30  257  240   11   22  261  A7UNT7     Der p 3 allergen OS=Dermatophagoides pteronyssinus PE=2 SV=1
  401 : A7UNZ4_BOMMA        0.35  0.51   93  323   35  257  237   11   20  260  A7UNZ4     Cocoonase OS=Bombyx mandarina PE=2 SV=1
  402 : A9YYL0_DERFA        0.35  0.53   93  322   28  255  240   10   22  259  A9YYL0     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
  403 : B0WDC9_CULQU        0.35  0.53   93  322   40  259  235    9   20  263  B0WDC9     Trypsin 7 OS=Culex quinquefasciatus GN=CpipJ_CPIJ005132 PE=3 SV=1
  404 : B1H253_RAT          0.35  0.59    2   91   99  188   97    2   14  410  B1H253     Proz protein (Fragment) OS=Rattus norvegicus GN=Proz PE=2 SV=1
  405 : B3GEG4_SINCH        0.35  0.53   93  326   21  241  234    4   13  242  B3GEG4     Trypsinogen 2 OS=Siniperca chuatsi GN=TRS-B PE=2 SV=1
  406 : B3RZF9_TRIAD        0.35  0.56   93  325    4  248  248    6   18  253  B3RZF9     Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_26286 PE=3 SV=1
  407 : B6CGL8_SPAAU        0.35  0.54   93  326   21  240  234    6   14  241  B6CGL8     Trypsinogen OS=Sparus aurata PE=2 SV=1
  408 : B6CGL9_DIPSG        0.35  0.53   93  326   21  240  234    5   14  241  B6CGL9     Trypsinogen OS=Diplodus sargus PE=2 SV=1
  409 : B7U5S5_DERFA        0.35  0.54   93  322   28  255  240   10   22  259  B7U5S5     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
  410 : B7U5S6_DERFA        0.35  0.54   93  322   28  255  240   10   22  259  B7U5S6     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
  411 : C1BLA2_OSMMO        0.35  0.55   93  327   23  245  236    5   14  245  C1BLA2     Trypsin-3 OS=Osmerus mordax GN=TRY3 PE=2 SV=1
  412 : C3UV51_GADMO        0.35  0.54   93  326   20  240  236    7   17  241  C3UV51     Trypsinogen I (Fragment) OS=Gadus morhua PE=2 SV=1
  413 : C3XYP7_BRAFL        0.35  0.59  108  326    2  229  229    3   11  231  C3XYP7     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_126297 PE=3 SV=1
  414 : C3YDA9_BRAFL        0.35  0.51   93  324    5  243  243    8   15  250  C3YDA9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_218346 PE=3 SV=1
  415 : C3ZRZ4_BRAFL        0.35  0.55   93  325   21  246  238    7   17  246  C3ZRZ4     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_287422 PE=3 SV=1
  416 : C3ZW47_BRAFL        0.35  0.55   93  322    1  244  244    8   14  255  C3ZW47     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_241477 PE=3 SV=1
  417 : C4TP29_THECH        0.35  0.55   93  326   20  240  236    7   17  241  C4TP29     Trypsin (Precursor) OS=Theragra chalcogramma GN=tryp PE=2 SV=3
  418 : C5IWV5_PIG          0.35  0.55   93  327   24  246  236    5   14  246  C5IWV5     Trypsinogen OS=Sus scrofa PE=2 SV=1
  419 : C7DY49_TAKOB        0.35  0.54   93  327   24  246  236    5   14  246  C7DY49     Trypsinogen 2 OS=Takifugu obscurus PE=2 SV=1
  420 : D0G7G2_BORSA        0.35  0.55   93  326   20  240  236    7   17  241  D0G7G2     Trypsin OS=Boreogadus saida GN=tryp PE=2 SV=1
  421 : D0V531_CTEFE        0.35  0.56   93  313   28  245  228    8   17  260  D0V531     Trypsin (Fragment) OS=Ctenocephalides felis PE=2 SV=1
  422 : D1MYR2_ANGJA        0.35  0.54   93  327   21  244  235    4   11  244  D1MYR2     Trypsinogen OS=Anguilla japonica GN=try PE=2 SV=1
  423 : D3TJH6_SINCH        0.35  0.53   93  327   25  247  236    6   14  247  D3TJH6     Pancreatic trypsin OS=Siniperca chuatsi PE=2 SV=1
  424 : D3TJK1_EPICO        0.35  0.53   93  326   21  241  234    4   13  242  D3TJK1     Pancreatic trypsinogen OS=Epinephelus coioides PE=2 SV=1
  425 : D3TP63_GLOMM        0.35  0.53   93  323   31  252  238   11   23  256  D3TP63     Midgut trypsin OS=Glossina morsitans morsitans PE=2 SV=1
  426 : D3ZKM4_RAT          0.35  0.59    2   91   21  110   97    2   14  332  D3ZKM4     Protein Proz OS=Rattus norvegicus GN=Proz PE=3 SV=2
  427 : D6PVN2_EPICO        0.35  0.54   93  327   23  245  236    5   14  245  D6PVN2     Trypsinogen OS=Epinephelus coioides PE=2 SV=1
  428 : D6QUQ4_ANTPE        0.35  0.52   93  323   34  258  238   12   20  261  D6QUQ4     Cocoonase-like protein OS=Antheraea pernyi PE=2 SV=1
  429 : DERF3_DERFA         0.35  0.54   93  322   28  255  240   10   22  259  P49275     Mite allergen Der f 3 OS=Dermatophagoides farinae GN=DERF3 PE=1 SV=2
  430 : DERP3_DERPT         0.35  0.53   93  322   30  257  240   11   22  261  P39675     Mite allergen Der p 3 OS=Dermatophagoides pteronyssinus GN=DERP3 PE=1 SV=1
  431 : E1ZYQ4_CAMFO        0.35  0.56   93  322   20  243  234    7   14  247  E1ZYQ4     Trypsin-4 OS=Camponotus floridanus GN=EAG_08391 PE=3 SV=1
  432 : E9GTT5_DAPPU        0.35  0.54  105  326    4  238  240   11   23  239  E9GTT5     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_54608 PE=3 SV=1
  433 : F1Q5S2_DANRE        0.35  0.50    1   87   94  179   94    5   15  426  F1Q5S2     Uncharacterized protein OS=Danio rerio GN=proza PE=2 SV=1
  434 : F1SRS2_PIG          0.35  0.55   93  327   24  246  236    5   14  246  F1SRS2     Uncharacterized protein OS=Sus scrofa GN=LOC100302368 PE=2 SV=1
  435 : F2XFT0_DISMA        0.35  0.53   93  326   20  240  234    5   13  241  F2XFT0     Trypsinogen H1_1c OS=Dissostichus mawsoni PE=3 SV=1
  436 : F2XFT4_DISMA        0.35  0.54   93  326   20  240  234    4   13  241  F2XFT4     Trypsinogen H1_1g OS=Dissostichus mawsoni PE=3 SV=1
  437 : F2XFV5_DISMA        0.35  0.53   93  326   21  241  234    4   13  242  F2XFV5     Trypsinogen H2_1a OS=Dissostichus mawsoni PE=3 SV=1
  438 : F2XFV7_DISMA        0.35  0.54   93  326   20  240  234    5   13  241  F2XFV7     Trypsinogen H2_1d OS=Dissostichus mawsoni PE=3 SV=1
  439 : F2XFW0_DISMA        0.35  0.53   93  326   21  241  234    4   13  242  F2XFW0     Trypsinogen H2_1g OS=Dissostichus mawsoni PE=3 SV=1
  440 : F2XFX3_DISMA        0.35  0.53   93  326   21  241  234    4   13  242  F2XFX3     H2_1b OS=Dissostichus mawsoni PE=3 SV=1
  441 : F4MI41_9DIPT        0.35  0.52   93  320   31  253  235    9   19  259  F4MI41     Putative trypsin 2 OS=Phlebotomus perniciosus PE=2 SV=1
  442 : F6VNT7_HORSE        0.35  0.56   93  324   26  245  233    5   14  246  F6VNT7     Uncharacterized protein (Fragment) OS=Equus caballus GN=LOC100050047 PE=3 SV=1
  443 : F6XB42_ORNAN        0.35  0.54   93  321   23  249  239   10   22  256  F6XB42     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PRSS55 PE=3 SV=1
  444 : F6XSU3_ORNAN        0.35  0.54   93  327   26  250  237    7   14  250  F6XSU3     Uncharacterized protein OS=Ornithorhynchus anatinus PE=3 SV=1
  445 : F6ZEX0_HORSE        0.35  0.53   93  320    2  226  234    8   15  227  F6ZEX0     Uncharacterized protein (Fragment) OS=Equus caballus GN=TMPRSS4 PE=3 SV=1
  446 : F7DST6_HORSE        0.35  0.56   93  327   24  246  236    5   14  246  F7DST6     Uncharacterized protein OS=Equus caballus GN=LOC100049983 PE=3 SV=1
  447 : F7G640_ORNAN        0.35  0.54   93  317   11  223  228    8   18  241  F7G640     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100088455 PE=3 SV=1
  448 : F7IUA2_ANOGA        0.35  0.58   93  326   22  253  240    7   14  259  F7IUA2     AGAP004570-PA OS=Anopheles gambiae GN=AgaP_AGAP004570 PE=3 SV=1
  449 : G1LIB7_AILME        0.35  0.54   93  327   24  246  236    6   14  247  G1LIB7     Uncharacterized protein OS=Ailuropoda melanoleuca GN=LOC100472031 PE=3 SV=1
  450 : G1MCD2_AILME        0.35  0.53   93  322    1  229  239    9   19  266  G1MCD2     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=3 SV=1
  451 : G1NSS0_MYOLU        0.35  0.55   93  327   24  246  236    6   14  247  G1NSS0     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
  452 : G1SGH0_RABIT        0.35  0.55   93  327   24  246  236    5   14  246  G1SGH0     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100339859 PE=3 SV=1
  453 : G3NG42_GASAC        0.35  0.55   93  327   22  243  235    5   13  243  G3NG42     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  454 : G3NGE3_GASAC        0.35  0.56   93  327   21  242  235    5   13  242  G3NGE3     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  455 : G3NGG0_GASAC        0.35  0.54   93  327   15  240  239    5   17  241  G3NGG0     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  456 : G3NGH2_GASAC        0.35  0.54   95  326    1  222  233    4   12  235  G3NGH2     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  457 : G3NGH9_GASAC        0.35  0.53   93  326   22  245  239    5   20  247  G3NGH9     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  458 : G3NY71_GASAC        0.35  0.52   93  321   24  244  233    7   16  250  G3NY71     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  459 : G3QZE0_GORGO        0.35  0.56   93  327   24  246  236    6   14  247  G3QZE0     Uncharacterized protein OS=Gorilla gorilla gorilla PE=3 SV=1
  460 : G3TM62_LOXAF        0.35  0.54   93  327   24  246  236    5   14  246  G3TM62     Uncharacterized protein OS=Loxodonta africana GN=LOC100659862 PE=3 SV=1
  461 : G3V7Q8_RAT          0.35  0.57   93  327   25  247  236    5   14  247  G3V7Q8     Cationic trypsinogen OS=Rattus norvegicus GN=Prss3 PE=3 SV=1
  462 : G3V8K8_RAT          0.35  0.59    2   91   95  184   97    2   14  406  G3V8K8     Protein Proz OS=Rattus norvegicus GN=Proz PE=4 SV=2
  463 : G5DGE0_9NEOP        0.35  0.54   93  323   31  251  237   12   22  254  G5DGE0     Trypsin-like protein OS=Eupolyphaga sinensis PE=2 SV=1
  464 : G6DSJ5_DANPL        0.35  0.55   93  322   25  247  237   10   21  263  G6DSJ5     Vitellin-degrading protease OS=Danaus plexippus GN=KGM_06501 PE=3 SV=1
  465 : G9B5J0_9NEOP        0.35  0.54   93  323   31  251  237   12   22  254  G9B5J0     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  466 : G9B5J2_9NEOP        0.35  0.54   93  323   31  251  237   12   22  254  G9B5J2     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  467 : G9B5J6_9NEOP        0.35  0.54   93  323   31  251  237   11   22  254  G9B5J6     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  468 : G9JKF3_EPICO        0.35  0.53   93  326   23  243  234    4   13  244  G9JKF3     Trypsinogens 2 OS=Epinephelus coioides PE=2 SV=1
  469 : H0X996_OTOGA        0.35  0.56   93  327   24  246  236    5   14  247  H0X996     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
  470 : H0XFT0_OTOGA        0.35  0.55   93  327   24  246  236    5   14  246  H0XFT0     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
  471 : H0Z9C7_TAEGU        0.35  0.55   93  320    7  233  234    8   13  238  H0Z9C7     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
  472 : H0ZFP6_TAEGU        0.35  0.56    1   87   90  176   94    4   14  408  H0ZFP6     Uncharacterized protein OS=Taeniopygia guttata GN=PROZ PE=3 SV=1
  473 : H0ZSH7_TAEGU        0.35  0.55   93  327   27  249  236    6   14  249  H0ZSH7     Uncharacterized protein OS=Taeniopygia guttata GN=PRSS3 PE=3 SV=1
  474 : H2LQI1_ORYLA        0.35  0.54   93  321    3  230  233    4    9  235  H2LQI1     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101155223 PE=3 SV=1
  475 : H2LX99_ORYLA        0.35  0.51    1   88   32  120   94    5   11  362  H2LX99     Uncharacterized protein OS=Oryzias latipes GN=PROZ (2 of 2) PE=3 SV=1
  476 : H2MEM6_ORYLA        0.35  0.54   93  327   24  245  235    4   13  245  H2MEM6     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101161921 PE=3 SV=1
  477 : H2N2L4_ORYLA        0.35  0.54   93  327   23  245  236    5   14  245  H2N2L4     Uncharacterized protein OS=Oryzias latipes GN=LOC101154931 PE=3 SV=1
  478 : H2R1H9_PANTR        0.35  0.56   93  327   24  246  236    6   14  247  H2R1H9     Uncharacterized protein OS=Pan troglodytes GN=LOC742453 PE=3 SV=1
  479 : H2RRG2_TAKRU        0.35  0.53   93  326   21  241  234    4   13  242  H2RRG2     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066992 PE=3 SV=1
  480 : H2UMW5_TAKRU        0.35  0.54   93  326   23  254  246    6   26  255  H2UMW5     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071730 PE=3 SV=1
  481 : H3BY76_TETNG        0.35  0.53    1   91   19  110   97    5   11  348  H3BY76     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=PROZ (3 of 3) PE=3 SV=1
  482 : H3DKT9_TETNG        0.35  0.55    1   88   88  176   94    5   11  421  H3DKT9     Uncharacterized protein OS=Tetraodon nigroviridis GN=PROZ (1 of 3) PE=3 SV=1
  483 : H9KC43_APIME        0.35  0.62   93  325   18  248  239    7   14  255  H9KC43     Uncharacterized protein OS=Apis mellifera GN=LOC100576158 PE=3 SV=1
  484 : I3JZS8_ORENI        0.35  0.51   93  325   22  243  233    3   11  246  I3JZS8     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100699793 PE=3 SV=1
  485 : I3LBF8_PIG          0.35  0.52   93  327    8  243  244    5   17  244  I3LBF8     Uncharacterized protein OS=Sus scrofa GN=LOC100739292 PE=2 SV=1
  486 : I3NFU5_SPETR        0.35  0.53   93  327   25  247  236    5   14  247  I3NFU5     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
  487 : K7F5S8_PELSI        0.35  0.57    1   91   89  182   97    5    9  428  K7F5S8     Uncharacterized protein OS=Pelodiscus sinensis GN=PROC PE=3 SV=1
  488 : K7G962_PELSI        0.35  0.60    1   91   90  180   98    4   14  410  K7G962     Uncharacterized protein OS=Pelodiscus sinensis GN=PROZ PE=3 SV=1
  489 : K7J094_NASVI        0.35  0.53   93  322   26  251  240   12   24  255  K7J094     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
  490 : K7J095_NASVI        0.35  0.53   93  322   38  263  240   12   24  267  K7J095     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
  491 : L8HQ42_BOSMU        0.35  0.54   93  325    1  230  244   10   25  265  L8HQ42     Serine protease 52 (Fragment) OS=Bos grunniens mutus GN=M91_04940 PE=3 SV=1
  492 : L9L0Y1_TUPCH        0.35  0.54   93  327   25  247  236    5   14  247  L9L0Y1     Cationic trypsin-3 OS=Tupaia chinensis GN=TREES_T100005090 PE=3 SV=1
  493 : M3YB18_MUSPF        0.35  0.57   93  327   24  246  236    5   14  246  M3YB18     Uncharacterized protein OS=Mustela putorius furo PE=3 SV=1
  494 : M3Z995_NOMLE        0.35  0.54   93  327   21  243  236    6   14  244  M3Z995     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=PRSS3 PE=3 SV=1
  495 : M4A844_XIPMA        0.35  0.54   93  327   23  245  236    6   14  245  M4A844     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
  496 : O02570_CULQU        0.35  0.52   93  322   40  259  235    9   20  263  O02570     Late trypsin OS=Culex quinquefasciatus PE=2 SV=1
  497 : O42159_PETMA        0.35  0.51   93  327   21  244  235    3   11  244  O42159     Trypsinogen B1 (Precursor) OS=Petromyzon marinus GN=TRYPB1 PE=2 SV=1
  498 : O42160_PETMA        0.35  0.51   93  327   22  245  235    3   11  245  O42160     Trypsinogen b2 (Precursor) OS=Petromyzon marinus GN=TRYPB2 PE=2 SV=1
  499 : Q0GYP4_SPAAU        0.35  0.53   93  326   21  240  234    5   14  241  Q0GYP4     Trypsinogen II OS=Sparus aurata GN=TRPII PE=2 SV=1
  500 : Q17039_ANOGA        0.35  0.58   93  326   10  241  240    7   14  247  Q17039     Serine proteinase (Fragment) OS=Anopheles gambiae PE=3 SV=1
  501 : Q1AMP9_DISMA        0.35  0.53   93  326   21  241  234    4   13  242  Q1AMP9     Trypsinogen OS=Dissostichus mawsoni GN=AFGP PE=2 SV=1
  502 : Q27J28_9NEOP        0.35  0.53   93  323    2  222  236   11   20  225  Q27J28     Fibrinolytic enzyme (Fragment) OS=Eupolyphaga sinensis PE=2 SV=1
  503 : Q3SY20_HUMAN        0.35  0.56   93  327   24  246  236    6   14  247  Q3SY20     Protease, serine, 2 (Trypsin 2) OS=Homo sapiens GN=PRSS2 PE=2 SV=1
  504 : Q3V2G3_MOUSE        0.35  0.56   93  327   24  246  236    6   14  246  Q3V2G3     Putative uncharacterized protein OS=Mus musculus GN=Prss3 PE=2 SV=1
  505 : Q4G0C2_MOUSE        0.35  0.56   93  327   23  245  236    6   14  245  Q4G0C2     Prss3 protein (Fragment) OS=Mus musculus GN=Prss3 PE=2 SV=1
  506 : Q4QY73_SPAAU        0.35  0.54   93  326   21  240  234    6   14  241  Q4QY73     Trypsinogen-like protein OS=Sparus aurata PE=2 SV=1
  507 : Q4QY79_SPAAU        0.35  0.53   93  326   21  240  234    5   14  241  Q4QY79     Trypsinogen 1-like protein OS=Sparus aurata PE=2 SV=1
  508 : Q4RJM2_TETNG        0.35  0.55    1   88   85  173   94    5   11  418  Q4RJM2     Chromosome 3 SCAF15037, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00033373001 PE=3 SV=1
  509 : Q4TB33_TETNG        0.35  0.58    1   91  398  493   97    4    7  740  Q4TB33     Chromosome undetermined SCAF7209, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00003934001 PE=3 SV=1
  510 : Q5H730_MACMU        0.35  0.56   93  327   24  246  236    6   14  247  Q5H730     Try13 OS=Macaca mulatta GN=try13 PE=3 SV=1
  511 : Q5H731_MACMU        0.35  0.56   93  327   24  246  236    5   14  247  Q5H731     Try12 OS=Macaca mulatta GN=try12 PE=3 SV=1
  512 : Q5H732_MACMU        0.35  0.56   93  327   24  247  236    6   13  248  Q5H732     Try10 OS=Macaca mulatta GN=try10 PE=3 SV=1
  513 : Q5M8T8_XENTR        0.35  0.57   93  327   23  249  240    6   18  249  Q5M8T8     Hypothetical LOC496697 OS=Xenopus tropicalis GN=prss1.2 PE=2 SV=1
  514 : Q5M910_XENTR        0.35  0.58   93  327   23  249  237    5   12  249  Q5M910     Pancreatic trypsin 1 OS=Xenopus tropicalis GN=prss1 PE=2 SV=1
  515 : Q5NV56_HUMAN        0.35  0.56   93  327   24  246  236    6   14  247  Q5NV56     Anionic trypsinogen OS=Homo sapiens GN=TRY8 PE=2 SV=1
  516 : Q66PG8_TAKRU        0.35  0.53   93  326    9  233  236    5   13  235  Q66PG8     Trypsinogen (Fragment) OS=Takifugu rubripes PE=3 SV=1
  517 : Q6DIW2_XENTR        0.35  0.55   93  327   23  249  237    4   12  249  Q6DIW2     MGC89184 protein OS=Xenopus tropicalis GN=prss3 PE=2 SV=1
  518 : Q792Z0_MOUSE        0.35  0.56   93  327   24  246  236    6   14  246  Q792Z0     Protein Prss3 OS=Mus musculus GN=Prss3 PE=3 SV=1
  519 : Q90387_CYNPY        0.35  0.59  116  324    1  230  230    7   21  235  Q90387     Thrombin (Fragment) OS=Cynops pyrrhogaster GN=thrombin PE=2 SV=1
  520 : Q91218_ONCMY        0.35  0.60  116  324    1  230  230    7   21  239  Q91218     Thrombin (Fragment) OS=Oncorhynchus mykiss GN=thrombin PE=2 SV=1
  521 : Q91515_TAKRU        0.35  0.53   93  326   16  236  234    4   13  237  Q91515     Trypsinogen (Fragment) OS=Takifugu rubripes PE=2 SV=1
  522 : Q92099_PARMG        0.35  0.54   93  326   21  241  234    5   13  242  Q92099     Trypsin (Precursor) OS=Paranotothenia magellanica PE=2 SV=1
  523 : Q9CPN9_MOUSE        0.35  0.57   93  327   25  247  236    5   14  247  Q9CPN9     Protein 2210010C04Rik OS=Mus musculus GN=2210010C04Rik PE=2 SV=1
  524 : Q9D7Y7_MOUSE        0.35  0.57   94  327   26  247  235    6   14  247  Q9D7Y7     Putative uncharacterized protein OS=Mus musculus GN=2210010C04Rik PE=2 SV=1
  525 : Q9W6K0_9PERC        0.35  0.52   93  326   23  247  236    5   13  249  Q9W6K0     Trypsinogen-like serine protease OS=Notothenia coriiceps PE=2 SV=1
  526 : Q9W7Q5_PAROL        0.35  0.50   93  327   22  246  240    5   20  247  Q9W7Q5     Trypsinogen 3 OS=Paralichthys olivaceus PE=2 SV=2
  527 : Q9W7Q6_PAROL        0.35  0.54   93  326   18  237  234    5   14  238  Q9W7Q6     Trypsinogen 2 (Fragment) OS=Paralichthys olivaceus PE=2 SV=1
  528 : Q9W7Q7_PAROL        0.35  0.54   93  326   21  241  236    7   17  242  Q9W7Q7     Trypsinogen 1 OS=Paralichthys olivaceus PE=2 SV=1
  529 : Q9XY55_CTEFE        0.35  0.52   93  315   29  252  236   11   25  265  Q9XY55     Trypsin-like serine protease OS=Ctenocephalides felis GN=SP-28 PE=2 SV=1
  530 : R0JSD5_SETTU        0.35  0.51   93  322   36  261  240   11   24  263  R0JSD5     Uncharacterized protein OS=Setosphaeria turcica Et28A GN=SETTUDRAFT_93425 PE=4 SV=1
  531 : TRY2_CANFA          0.35  0.53   93  327   24  246  236    5   14  247  P06872     Anionic trypsin OS=Canis familiaris PE=2 SV=1
  532 : TRY2_HUMAN          0.35  0.56   93  327   24  246  236    6   14  247  P07478     Trypsin-2 OS=Homo sapiens GN=PRSS2 PE=1 SV=1
  533 : TRY3_RAT            0.35  0.57   93  327   25  247  236    5   14  247  P08426     Cationic trypsin-3 OS=Rattus norvegicus GN=Try3 PE=2 SV=1
  534 : TRYA_RAT            0.35  0.56   93  327   25  246  236    7   15  246  P32821     Trypsin V-A OS=Rattus norvegicus PE=2 SV=1
  535 : TRYB_RAT            0.35  0.57   93  327   25  246  236    7   15  246  P32822     Trypsin V-B OS=Rattus norvegicus PE=2 SV=1
  536 : TRYP_ASTAS          0.35  0.56   93  321    1  233  240    5   18  237  P00765     Trypsin-1 OS=Astacus astacus PE=1 SV=1
  537 : TRYP_PIG    1Z7K    0.35  0.55   93  327    9  231  236    5   14  231  P00761     Trypsin OS=Sus scrofa PE=1 SV=1
  538 : A1A508_HUMAN        0.34  0.55   93  327   24  246  236    6   14  247  A1A508     PRSS3 protein OS=Homo sapiens GN=PRSS3 PE=2 SV=1
  539 : A2TGR7_BOMMO        0.34  0.52  105  323    8  218  222    7   14  221  A2TGR7     Cocoonase (Fragment) OS=Bombyx mori PE=2 SV=1
  540 : A4QP82_DANRE        0.34  0.56    1   86   95  185   95    5   13  431  A4QP82     Zgc:163025 protein OS=Danio rerio GN=zgc:163025 PE=2 SV=1
  541 : A4UCN4_LUTLO        0.34  0.53   93  324   30  253  237    8   18  255  A4UCN4     Trypsin 1 OS=Lutzomyia longipalpis GN=tryp1 PE=2 SV=1
  542 : A5PJB4_BOVIN        0.34  0.54   93  327   24  246  236    5   14  247  A5PJB4     PRSS2 protein OS=Bos taurus GN=PRSS2 PE=2 SV=1
  543 : A7DZ29_DROME        0.34  0.52   93  325   24  243  238   12   23  245  A7DZ29     Serine protease OS=Drosophila melanogaster GN=CG17240 PE=3 SV=1
  544 : A7DZ34_DROSI        0.34  0.49   93  325   24  243  241   13   29  245  A7DZ34     GD22853 OS=Drosophila simulans GN=CG17240 PE=3 SV=1
  545 : A7RX09_NEMVE        0.34  0.46    1   73   43  114   80    2   15  114  A7RX09     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g96278 PE=4 SV=1
  546 : A7T3C0_NEMVE        0.34  0.52   93  327    7  241  238    3    6  241  A7T3C0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g144191 PE=3 SV=1
  547 : A7YWU9_BOVIN        0.34  0.54   93  327   24  246  236    5   14  247  A7YWU9     PRSS2 protein OS=Bos taurus GN=PRSS2 PE=2 SV=1
  548 : A8CED3_HUMAN        0.34  0.56   93  327   17  239  236    6   14  240  A8CED3     Trypsinogen 5 OS=Homo sapiens GN=PRSS3 PE=2 SV=1
  549 : A8QL65_LOCMI        0.34  0.51   93  325   10  244  243    7   18  244  A8QL65     Trypsin-like serine protease (Fragment) OS=Locusta migratoria manilensis GN=TSP PE=2 SV=1
  550 : B4KTX0_DROMO        0.34  0.55   93  323   31  251  238   10   24  255  B4KTX0     GI21243 OS=Drosophila mojavensis GN=Dmoj\GI21243 PE=3 SV=1
  551 : B4LJ05_DROVI        0.34  0.50   93  327   31  256  240   10   19  265  B4LJ05     GJ21494 OS=Drosophila virilis GN=Dvir\GJ21494 PE=3 SV=1
  552 : B4LJ08_DROVI        0.34  0.49   93  326   34  267  246    9   24  269  B4LJ08     GJ20851 OS=Drosophila virilis GN=Dvir\GJ20851 PE=3 SV=1
  553 : B7P8G5_IXOSC        0.34  0.56   93  324   11  250  244    7   16  252  B7P8G5     Serine protease, putative OS=Ixodes scapularis GN=IscW_ISCW002979 PE=3 SV=1
  554 : C1BKZ0_OSMMO        0.34  0.55   93  326   22  245  235    4   12  246  C1BKZ0     Anionic trypsin-1 OS=Osmerus mordax GN=TRY1 PE=2 SV=1
  555 : C3YCI0_BRAFL        0.34  0.53   93  326   22  259  243    9   14  261  C3YCI0     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_100914 PE=3 SV=1
  556 : C3ZHG3_BRAFL        0.34  0.51    1   76    2   77   82    8   12  161  C3ZHG3     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_158702 PE=4 SV=1
  557 : D0V536_CTEFE        0.34  0.55   93  322   25  240  232    9   18  244  D0V536     Trypsin (Fragment) OS=Ctenocephalides felis PE=2 SV=1
  558 : D2D388_9TELE        0.34  0.54   93  327   25  247  236    6   14  247  D2D388     Trypsinogen OS=Culter alburnus PE=2 SV=1
  559 : D2HP16_AILME        0.34  0.56   93  327   12  234  236    5   14  234  D2HP16     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_013482 PE=3 SV=1
  560 : D2HP34_AILME        0.34  0.53   93  327   15  237  236    5   14  238  D2HP34     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_013507 PE=3 SV=1
  561 : D3TS70_GLOMM        0.34  0.52   93  326   33  253  239   11   23  262  D3TS70     Salivary expressed trypsin OS=Glossina morsitans morsitans PE=2 SV=1
  562 : E0DBK1_9TELE        0.34  0.54   93  326    1  221  236    7   17  222  E0DBK1     Trypsin-1 (Fragment) OS=Gadus macrocephalus GN=tryp PE=2 SV=1
  563 : E0DBK2_9TELE        0.34  0.54   93  326    1  221  236    7   17  222  E0DBK2     Trypsin-2 (Fragment) OS=Gadus macrocephalus GN=tryp PE=2 SV=1
  564 : E0VFA8_PEDHC        0.34  0.52   93  315   29  241  231   12   26  255  E0VFA8     Trypsin, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM153440 PE=3 SV=1
  565 : E0VKQ3_PEDHC        0.34  0.55   93  327   26  258  247   11   26  259  E0VKQ3     Trypsin, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM268620 PE=3 SV=1
  566 : E5RVK3_BOMMO        0.34  0.52   93  323    2  224  233    6   12  227  E5RVK3     Cocoonase OS=Bombyx mori GN=QH-Coc PE=2 SV=1
  567 : E7F5N1_DANRE        0.34  0.51   93  327   23  249  237    6   12  250  E7F5N1     Uncharacterized protein OS=Danio rerio GN=LOC560023 PE=3 SV=1
  568 : E9H014_DAPPU        0.34  0.50   93  326    1  214  236    8   24  215  E9H014     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_56547 PE=3 SV=1
  569 : F1PCE8_CANFA        0.34  0.55   93  327   24  246  236    6   14  246  F1PCE8     Uncharacterized protein OS=Canis familiaris GN=PRSS1 PE=3 SV=1
  570 : F1PZN9_CANFA        0.34  0.50   93  320    6  232  238   11   21  232  F1PZN9     Uncharacterized protein (Fragment) OS=Canis familiaris PE=3 SV=2
  571 : F1Q3T5_CANFA        0.34  0.57   98  320    2  222  234    8   24  228  F1Q3T5     Uncharacterized protein OS=Canis familiaris GN=LOC482172 PE=3 SV=2
  572 : F1R612_DANRE        0.34  0.56    1   86   95  185   95    5   13  431  F1R612     Uncharacterized protein OS=Danio rerio GN=zgc:163025 PE=3 SV=1
  573 : F2XFT3_DISMA        0.34  0.51   93  326   21  241  234    5   13  242  F2XFT3     Trypsinogen H1_1f OS=Dissostichus mawsoni PE=3 SV=1
  574 : F4WTJ3_ACREC        0.34  0.56   93  322   20  244  237   10   19  248  F4WTJ3     Trypsin-7 OS=Acromyrmex echinatior GN=G5I_09191 PE=3 SV=1
  575 : F6T323_HORSE        0.34  0.56   93  327   31  253  236    6   14  254  F6T323     Uncharacterized protein (Fragment) OS=Equus caballus GN=LOC100055297 PE=3 SV=1
  576 : F6V9M1_XENTR        0.34  0.53   93  327   25  251  241    7   20  251  F6V9M1     Uncharacterized protein OS=Xenopus tropicalis GN=klk15 PE=3 SV=1
  577 : F6VSH7_ORNAN        0.34  0.53   93  327   25  247  236    6   14  247  F6VSH7     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100086459 PE=3 SV=1
  578 : F6X2B2_MACMU        0.34  0.55   93  327   24  246  236    6   14  247  F6X2B2     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=2 SV=1
  579 : F7BIT1_MONDO        0.34  0.56   93  327   24  243  235    5   15  243  F7BIT1     Uncharacterized protein OS=Monodelphis domestica GN=LOC100010619 PE=3 SV=1
  580 : F7D9G1_XENTR        0.34  0.53   93  327   32  254  236    6   14  254  F7D9G1     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=prss1 PE=3 SV=1
  581 : F7EM73_ORNAN        0.34  0.55   93  326   24  245  237    8   18  246  F7EM73     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100088455 PE=3 SV=1
  582 : F8U088_9PERO        0.34  0.51   93  327   23  249  241    8   20  250  F8U088     Trypsinogen Y (Fragment) OS=Epinephelus bruneus PE=2 SV=1
  583 : F8W7P3_HUMAN        0.34  0.56   93  327   17  239  236    6   14  240  F8W7P3     Trypsin-3 OS=Homo sapiens GN=PRSS3 PE=2 SV=1
  584 : G1L9Y4_AILME        0.34  0.58   93  320   13  238  235    8   16  240  G1L9Y4     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=LOC100484715 PE=3 SV=1
  585 : G1LI59_AILME        0.34  0.56   93  327   24  246  238    7   18  246  G1LI59     Uncharacterized protein OS=Ailuropoda melanoleuca GN=LOC100471781 PE=3 SV=1
  586 : G1LI64_AILME        0.34  0.56   93  327   23  244  236    5   15  244  G1LI64     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=3 SV=1
  587 : G1PIF1_MYOLU        0.34  0.51   93  325    2  238  247    8   24  273  G1PIF1     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
  588 : G1PSB0_MYOLU        0.34  0.55   93  327   24  246  236    6   14  246  G1PSB0     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
  589 : G1QED3_MYOLU        0.34  0.55   93  327   24  246  236    5   14  246  G1QED3     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
  590 : G1QQL8_NOMLE        0.34  0.54   93  327   24  246  236    6   14  247  G1QQL8     Uncharacterized protein OS=Nomascus leucogenys GN=LOC100592562 PE=3 SV=1
  591 : G1U3L5_RABIT        0.34  0.56   93  327   27  249  236    6   14  249  G1U3L5     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100339606 PE=3 SV=1
  592 : G1U414_RABIT        0.34  0.55   93  327   27  249  236    5   14  249  G1U414     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100339353 PE=3 SV=1
  593 : G3HUC0_CRIGR        0.34  0.54   93  327    2  217  235    7   19  217  G3HUC0     Anionic trypsin-2 (Fragment) OS=Cricetulus griseus GN=I79_014528 PE=3 SV=1
  594 : G3P413_GASAC        0.34  0.52   93  327    4  236  244    9   20  245  G3P413     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus GN=TMPRSS2 PE=3 SV=1
  595 : G3PS27_GASAC        0.34  0.59    2   88   89  177   94    6   12  457  G3PS27     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  596 : G3STI1_LOXAF        0.34  0.55   93  327   25  247  236    6   14  247  G3STI1     Uncharacterized protein OS=Loxodonta africana GN=LOC100670373 PE=3 SV=1
  597 : G5EMQ3_THUOR        0.34  0.55   93  326   21  241  234    5   13  242  G5EMQ3     Trypsinogen 1 OS=Thunnus orientalis PE=2 SV=1
  598 : G5EMQ8_PAGMA        0.34  0.54   93  327   21  241  235    6   14  241  G5EMQ8     Trypsinogen OS=Pagrus major PE=2 SV=1
  599 : H0VF02_CAVPO        0.34  0.53   93  325   10  247  245    7   19  269  H0VF02     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100722925 PE=3 SV=1
  600 : H0Y212_OTOGA        0.34  0.54   93  327   25  247  236    6   14  247  H0Y212     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
  601 : H3B697_LATCH        0.34  0.52   93  327   37  259  235    5   12  259  H3B697     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
  602 : H3DMP9_TETNG        0.34  0.56   93  320   11  229  231    7   15  236  H3DMP9     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  603 : H9GDA9_ANOCA        0.34  0.55   93  327   25  247  236    6   14  247  H9GDA9     Uncharacterized protein OS=Anolis carolinensis GN=LOC100565603 PE=3 SV=1
  604 : I3KHT2_ORENI        0.34  0.52   93  327   23  245  236    6   14  245  I3KHT2     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100534516 PE=3 SV=1
  605 : I3MAQ1_SPETR        0.34  0.56   93  327   24  246  236    6   14  246  I3MAQ1     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
  606 : I7HI61_9PERO        0.34  0.53   93  327   21  243  236    5   14  243  I7HI61     Trypsin OS=Lutjanus fulvus GN=trp PE=2 SV=1
  607 : K7G879_PELSI        0.34  0.50    1   91 1753 1846   98    5   11 2195  K7G879     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis GN=FBN3 PE=4 SV=1
  608 : L9L2C2_TUPCH        0.34  0.54   93  327   25  243  235    5   16  243  L9L2C2     Anionic trypsin OS=Tupaia chinensis GN=TREES_T100005221 PE=3 SV=1
  609 : M3WP64_FELCA        0.34  0.56   93  327   26  248  236    6   14  248  M3WP64     Uncharacterized protein (Fragment) OS=Felis catus GN=LOC101085453 PE=3 SV=1
  610 : M3ZWY8_XIPMA        0.34  0.53   93  327   23  249  238    5   14  250  M3ZWY8     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
  611 : N4WZY0_COCHE        0.34  0.48   93  322   31  258  242   12   26  261  N4WZY0     Uncharacterized protein OS=Bipolaris maydis ATCC 48331 GN=COCC4DRAFT_45984 PE=4 SV=1
  612 : O42158_PETMA        0.34  0.51   93  327   24  247  237    6   15  247  O42158     Trypsinogen a2 (Precursor) OS=Petromyzon marinus GN=TRYPA2 PE=2 SV=1
  613 : O42608_PETMA        0.34  0.51   93  327   24  247  237    6   15  247  O42608     Trypsinogen A1 (Precursor) OS=Petromyzon marinus GN=TRYPA3 PE=2 SV=1
  614 : Q05AV3_XENLA        0.34  0.53   93  327   22  244  236    6   14  244  Q05AV3     LOC397853 protein OS=Xenopus laevis GN=LOC397853 PE=2 SV=1
  615 : Q17035_ANOGA        0.34  0.51   93  326    1  228  247   10   32  237  Q17035     Serine proteinase (Fragment) OS=Anopheles gambiae PE=3 SV=1
  616 : Q17LZ9_AEDAE        0.34  0.53   93  323   10  239  238    8   15  247  Q17LZ9     AAEL001178-PA (Fragment) OS=Aedes aegypti GN=AAEL001178 PE=3 SV=1
  617 : Q3B898_XENLA        0.34  0.53   93  327   30  252  236    6   14  252  Q3B898     LOC397853 protein (Fragment) OS=Xenopus laevis GN=LOC397853 PE=2 SV=1
  618 : Q3SY19_HUMAN        0.34  0.57   93  327   24  246  236    6   14  247  Q3SY19     PRSS1 protein OS=Homo sapiens GN=PRSS1 PE=2 SV=1
  619 : Q4RH74_TETNG        0.34  0.57   93  320   11  233  231    7   11  234  Q4RH74     Chromosome undetermined SCAF15067, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00034480001 PE=3 SV=1
  620 : Q4RQD7_TETNG        0.34  0.54   93  320    3  229  235    9   15  230  Q4RQD7     Chromosome 17 SCAF15006, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=PLAU (2 of 3) PE=3 SV=1
  621 : Q4VSI1_PEDHC        0.34  0.54   93  327   26  261  250   11   29  262  Q4VSI1     Try2 (Fragment) OS=Pediculus humanus subsp. corporis GN=try2 PE=3 SV=1
  622 : Q4VSI2_PEDHC        0.34  0.55   93  327   26  258  247   11   26  259  Q4VSI2     Try2 OS=Pediculus humanus subsp. corporis GN=try2 PE=2 SV=1
  623 : Q547S4_BOVIN        0.34  0.54   93  327   24  246  236    5   14  247  Q547S4     Pancreatic anionic trypsinogen OS=Bos taurus GN=TRYP8 PE=3 SV=1
  624 : Q561Z7_DANRE        0.34  0.56   93  327   25  247  236    6   14  247  Q561Z7     Try protein OS=Danio rerio GN=try PE=2 SV=1
  625 : Q5EBE2_XENTR        0.34  0.53   93  327   22  244  236    6   14  244  Q5EBE2     MGC108396 protein OS=Xenopus tropicalis GN=prss1 PE=2 SV=1
  626 : Q5H728_MACMU        0.34  0.55   93  327   24  246  236    6   14  247  Q5H728     Try16 OS=Macaca mulatta GN=try16 PE=3 SV=1
  627 : Q5H729_MACMU        0.34  0.54   93  327   24  246  236    6   14  247  Q5H729     Try14 OS=Macaca mulatta GN=try14 PE=3 SV=1
  628 : Q5H733_MACMU        0.34  0.53   93  327   24  246  236    6   14  247  Q5H733     Try9 OS=Macaca mulatta GN=try9 PE=3 SV=1
  629 : Q5H734_MACMU        0.34  0.52   93  327   24  247  237    6   15  248  Q5H734     Try4 OS=Macaca mulatta GN=try4 PE=3 SV=1
  630 : Q6GPX7_XENLA        0.34  0.56   93  327   23  248  236    5   11  248  Q6GPX7     MGC82534 protein OS=Xenopus laevis GN=prss1.2 PE=2 SV=1
  631 : Q6ISJ4_HUMAN        0.34  0.56   93  327   24  246  236    6   14  247  Q6ISJ4     Mesotrypsinogen OS=Homo sapiens GN=PRSS3 PE=2 SV=1
  632 : Q6R670_OREAU        0.34  0.52   93  327   23  245  236    6   14  245  Q6R670     Trypsin OS=Oreochromis aureus PE=2 SV=1
  633 : Q6R671_ORENI        0.34  0.52   93  327   23  245  236    6   14  245  Q6R671     Trypsin OS=Oreochromis niloticus PE=2 SV=1
  634 : Q7SZT1_XENLA        0.34  0.53   93  327   26  248  236    6   14  248  Q7SZT1     LOC397853 protein (Fragment) OS=Xenopus laevis GN=LOC397853 PE=2 SV=1
  635 : Q98TH0_9TELE        0.34  0.54   93  327   20  240  235    5   14  240  Q98TH0     Trypsinogen OS=Engraulis japonicus PE=2 SV=1
  636 : R0KWP6_ANAPL        0.34  0.52   93  327    9  231  236    5   14  231  R0KWP6     Trypsin I-P1 (Fragment) OS=Anas platyrhynchos GN=Anapl_18720 PE=4 SV=1
  637 : TRY1_BOVIN  1ZZZ    0.34  0.53   93  327   24  246  237    6   16  246  P00760     Cationic trypsin OS=Bos taurus PE=1 SV=3
  638 : TRY1_CANFA          0.34  0.54   93  327   24  246  236    6   14  246  P06871     Cationic trypsin OS=Canis familiaris PE=2 SV=1
  639 : TRY1_CHICK          0.34  0.53   93  327   26  248  236    6   14  248  Q90627     Trypsin I-P1 OS=Gallus gallus PE=2 SV=1
  640 : TRY1_HUMAN  1TRN    0.34  0.56   93  327   24  246  236    6   14  247  P07477     Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1
  641 : TRY2_XENLA          0.34  0.53   93  327   22  244  236    6   14  244  P70059     Trypsin OS=Xenopus laevis PE=2 SV=1
  642 : TRY3_SALSA  1A0J    0.34  0.53   93  327   16  238  240    7   22  238  P35033     Trypsin-3 (Fragment) OS=Salmo salar PE=1 SV=1
  643 : TRY6_HUMAN          0.34  0.56   93  327   24  246  236    6   14  247  Q8NHM4     Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1
  644 : TRYP_PHACE          0.34  0.54   93  322   30  254  238   10   21  258  O97399     Trypsin OS=Phaedon cochleariae PE=2 SV=1
  645 : A2JDL7_CHICK        0.33  0.57   93  326   26  247  235    6   14  248  A2JDL7     Trypsinogen OS=Gallus gallus PE=3 SV=1
  646 : A7DZ33_DROSI        0.33  0.49   93  325   24  243  241   13   29  245  A7DZ33     Serine protease OS=Drosophila simulans GN=CG17240 PE=3 SV=1
  647 : A7DZ38_DROSI        0.33  0.49   93  325   24  243  241   13   29  245  A7DZ38     Serine protease OS=Drosophila simulans GN=CG17240 PE=3 SV=1
  648 : A7RKD3_NEMVE        0.33  0.44    2   86   42  126   95    6   20  277  A7RKD3     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g84597 PE=4 SV=1
  649 : A7RLC0_NEMVE        0.33  0.56   93  326   10  258  253    8   23  259  A7RLC0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g85993 PE=3 SV=1
  650 : A7RYF8_NEMVE        0.33  0.52   93  326    2  236  242    6   15  236  A7RYF8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g97944 PE=3 SV=1
  651 : A7S8Y5_NEMVE        0.33  0.54   93  326    4  238  240    7   11  240  A7S8Y5     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g109239 PE=3 SV=1
  652 : A7SQE8_NEMVE        0.33  0.53   93  327    2  245  248    7   17  246  A7SQE8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g127469 PE=3 SV=1
  653 : A7SY01_NEMVE        0.33  0.53    1   68    4   70   75    2   15   83  A7SY01     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g137372 PE=4 SV=1
  654 : B0W771_CULQU        0.33  0.48   93  324   27  251  239   10   21  251  B0W771     Trypsin delta/gamma OS=Culex quinquefasciatus GN=CpipJ_CPIJ002937 PE=3 SV=1
  655 : B0WE92_CULQU        0.33  0.51   93  322   27  248  235    9   18  252  B0WE92     Trypsin 2 OS=Culex quinquefasciatus GN=CpipJ_CPIJ005271 PE=3 SV=1
  656 : B3N9I4_DROER        0.33  0.50   93  325   24  245  238   10   21  247  B3N9I4     GG24539 OS=Drosophila erecta GN=Dere\GG24539 PE=3 SV=1
  657 : B3SE65_TRIAD        0.33  0.46    1   84  541  637   98    3   15  729  B3SE65     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_34361 PE=4 SV=1
  658 : B3V3M8_HYPMO        0.33  0.57   93  327   22  243  236    5   15  243  B3V3M8     Myofibril-bound serine proteinase OS=Hypophthalmichthys molitrix GN=MBSP PE=2 SV=1
  659 : B4GGG5_DROPE        0.33  0.49   93  322   28  244  242   12   37  248  B4GGG5     GL17341 OS=Drosophila persimilis GN=Dper\GL17341 PE=3 SV=1
  660 : B4JQ66_DROGR        0.33  0.51   93  322   29  250  237   10   22  254  B4JQ66     GH13258 OS=Drosophila grimshawi GN=Dgri\GH13258 PE=3 SV=1
  661 : B5AQM2_9MUSC        0.33  0.53   93  326   31  255  244   11   29  256  B5AQM2     Serine protease 2 OS=Hypoderma diana PE=2 SV=1
  662 : C3Y017_BRAFL        0.33  0.53   93  327    3  240  243    9   13  243  C3Y017     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_209371 PE=3 SV=1
  663 : C3Z4Q6_BRAFL        0.33  0.54   93  327    1  247  252   12   22  247  C3Z4Q6     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_243672 PE=3 SV=1
  664 : C3ZMV5_BRAFL        0.33  0.53   93  326   13  246  241    7   14  247  C3ZMV5     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_59253 PE=3 SV=1
  665 : C3ZVK3_BRAFL        0.33  0.52   93  327    3  245  250    7   22  245  C3ZVK3     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_61430 PE=3 SV=1
  666 : C6L245_PIG          0.33  0.54   93  327   24  246  236    6   14  247  C6L245     Putative trypsinogen OS=Sus scrofa GN=try PE=3 SV=1
  667 : D0V544_CTEFE        0.33  0.49   93  323    2  236  246    8   26  246  D0V544     Chymotrypsin (Fragment) OS=Ctenocephalides felis PE=2 SV=1
  668 : D2HAJ9_AILME        0.33  0.52   93  320    1  228  236    7   16  228  D2HAJ9     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_007464 PE=3 SV=1
  669 : D2HV81_AILME        0.33  0.55   93  320    3  238  241    8   18  239  D2HV81     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_016254 PE=3 SV=1
  670 : D3Z3S5_MOUSE        0.33  0.55   97  327    1  219  233    7   16  219  D3Z3S5     Uncharacterized protein OS=Mus musculus GN=Gm4744 PE=3 SV=2
  671 : E1C996_CHICK        0.33  0.53   93  327   14  236  236    6   14  236  E1C996     Uncharacterized protein (Fragment) OS=Gallus gallus GN=LOC100857124 PE=1 SV=2
  672 : E5SBE6_TRISP        0.33  0.49   93  320   38  273  260   17   56  296  E5SBE6     Transmembrane serine protease 8 OS=Trichinella spiralis GN=Tsp_01070 PE=3 SV=1
  673 : E6ZFE9_DICLA        0.33  0.52   93  324    5  232  237    5   14  242  E6ZFE9     Trypsin OS=Dicentrarchus labrax GN=DLA_It03240 PE=3 SV=1
  674 : E9GXZ7_DAPPU        0.33  0.56   93  325   11  254  248    7   19  254  E9GXZ7     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_306713 PE=3 SV=1
  675 : F1N9P3_CHICK        0.33  0.53   93  327   26  248  236    6   14  248  F1N9P3     Uncharacterized protein OS=Gallus gallus GN=LOC768817 PE=2 SV=2
  676 : F6TU72_XENTR        0.33  0.52   93  325   26  267  250    8   25  277  F6TU72     Uncharacterized protein OS=Xenopus tropicalis GN=xepsin PE=3 SV=1
  677 : F6W0J7_CALJA        0.33  0.54   93  327   26  248  236    6   14  248  F6W0J7     Uncharacterized protein OS=Callithrix jacchus GN=LOC100396682 PE=3 SV=1
  678 : F6YJN1_XENTR        0.33  0.53   93  327   21  243  236    6   14  243  F6YJN1     Uncharacterized protein OS=Xenopus tropicalis GN=LOC100498083 PE=3 SV=1
  679 : F8U087_9PERO        0.33  0.54   93  326   22  245  239    6   20  247  F8U087     Trypsinogen 3 (Fragment) OS=Epinephelus bruneus PE=2 SV=1
  680 : G1K1X9_BOVIN        0.33  0.54    2   87   94  179   95    4   18  439  G1K1X9     Vitamin K-dependent protein Z OS=Bos taurus GN=PROZ PE=2 SV=1
  681 : G1NN41_MELGA        0.33  0.56   93  326   26  247  235    6   14  248  G1NN41     Uncharacterized protein OS=Meleagris gallopavo GN=LOC100544478 PE=3 SV=2
  682 : G3NJS1_GASAC        0.33  0.53   93  327   21  243  236    6   14  243  G3NJS1     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  683 : G3VGZ0_SARHA        0.33  0.52   93  327   25  246  236    7   15  247  G3VGZ0     Uncharacterized protein OS=Sarcophilus harrisii PE=3 SV=1
  684 : G3VGZ1_SARHA        0.33  0.52   93  327   25  246  236    7   15  247  G3VGZ1     Uncharacterized protein OS=Sarcophilus harrisii PE=3 SV=1
  685 : H0ZSH5_TAEGU        0.33  0.54   93  327    6  228  236    5   14  228  H0ZSH5     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
  686 : H2L6L9_ORYLA        0.33  0.54   93  327    1  236  241    6   11  237  H2L6L9     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=3 SV=1
  687 : H2YF27_CIOSA        0.33  0.53   93  323   17  260  250    9   25  264  H2YF27     Uncharacterized protein (Fragment) OS=Ciona savignyi GN=Csa.4525 PE=3 SV=1
  688 : H3J7G3_STRPU        0.33  0.51    1   89  469  556   96    2   15 1267  H3J7G3     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=4 SV=1
  689 : HYPB_HYPLI          0.33  0.53   93  326   31  255  243   13   27  256  P35588     Hypodermin-B OS=Hypoderma lineatum PE=1 SV=1
  690 : I3JZT2_ORENI        0.33  0.50   93  326   21  228  238    7   34  229  I3JZT2     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100700058 PE=3 SV=1
  691 : K7INR7_NASVI        0.33  0.56   93  325   16  259  248    7   19  259  K7INR7     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
  692 : L7N2M3_XENTR        0.33  0.51   93  327    9  234  239    9   17  241  L7N2M3     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=klk1 PE=3 SV=1
  693 : L8HNC2_BOSMU        0.33  0.51   93  327   16  253  251    7   29  253  L8HNC2     Cationic trypsin (Fragment) OS=Bos grunniens mutus GN=M91_15257 PE=3 SV=1
  694 : O16126_9ASCI        0.33  0.50   94  324   19  247  239   11   18  248  O16126     Trypsinogen 1 (Precursor) OS=Boltenia villosa GN=TRYP1 PE=2 SV=1
  695 : O46151_PACLE        0.33  0.53   93  323   32  266  251    9   36  268  O46151     Trypsin (Precursor) OS=Pacifastacus leniusculus PE=3 SV=1
  696 : O76498_DIAAB        0.33  0.50   93  323   23  249  240   10   22  252  O76498     Trypsin (Precursor) OS=Diaprepes abbreviatus PE=2 SV=1
  697 : PROZ_BOVIN          0.33  0.54    2   87   51  136   95    4   18  396  P00744     Vitamin K-dependent protein Z OS=Bos taurus GN=PROZ PE=1 SV=1
  698 : Q0GC72_CARAU        0.33  0.56   93  327   21  242  236    5   15  242  Q0GC72     Myofibril-bound serine proteinase OS=Carassius auratus PE=2 SV=1
  699 : Q16PS2_AEDAE        0.33  0.50   93  324   33  260  241   12   22  260  Q16PS2     AAEL011549-PA OS=Aedes aegypti GN=AAEL011549 PE=3 SV=1
  700 : Q5BAR4_EMENI        0.33  0.51   93  322   23  245  237   10   21  249  Q5BAR4     Serine protease similarity, trypsin family (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2366.2 PE=3 SV=1
  701 : Q5G3K5_PYGNE        0.33  0.53   93  325   18  261  251   10   25  262  Q5G3K5     Neurotrypsin (Fragment) OS=Pygathrix nemaeus GN=PRSS12 PE=3 SV=1
  702 : Q5G3K6_TRAFR        0.33  0.53   93  325   18  261  251   10   25  262  Q5G3K6     Neurotrypsin (Fragment) OS=Trachypithecus francoisi GN=PRSS12 PE=3 SV=1
  703 : Q5G3K7_PYGBI        0.33  0.53   93  325   18  261  251   10   25  262  Q5G3K7     Neurotrypsin (Fragment) OS=Pygathrix bieti GN=PRSS12 PE=3 SV=1
  704 : Q5G3K8_HOOHO        0.33  0.53   93  325   18  261  251   10   25  262  Q5G3K8     Neurotrypsin (Fragment) OS=Hoolock hoolock GN=PRSS12 PE=3 SV=1
  705 : Q792Y6_MOUSE        0.33  0.56   93  327   24  246  236    6   14  246  Q792Y6     MCG4990, isoform CRA_e OS=Mus musculus GN=Prss2 PE=2 SV=1
  706 : Q7M754_MOUSE        0.33  0.57   93  327   24  246  236    6   14  246  Q7M754     Try10-like trypsinogen (Precursor) OS=Mus musculus GN=Gm5409 PE=2 SV=1
  707 : Q8I916_BLOTA        0.33  0.51   93  321   36  260  240   12   26  266  Q8I916     Trypsin OS=Blomia tropicalis PE=2 SV=1
  708 : Q9XYX9_RHYDO        0.33  0.54   93  324   30  248  239   11   27  248  Q9XYX9     Trypsinogen RdoT1 OS=Rhyzopertha dominica PE=2 SV=1
  709 : R4GMN6_HUMAN        0.33  0.50   93  327   40  280  260   15   44  281  R4GMN6     Complement C1r subcomponent (Fragment) OS=Homo sapiens GN=C1R PE=4 SV=1
  710 : R7VQ01_COLLI        0.33  0.52   93  326    4  242  251   11   29  242  R7VQ01     Kallikrein-11 (Fragment) OS=Columba livia GN=A306_10309 PE=4 SV=1
  711 : TRY2_BOVIN          0.33  0.54   93  327   24  246  236    5   14  247  Q29463     Anionic trypsin OS=Bos taurus PE=2 SV=1
  712 : TRY2_CHICK          0.33  0.53   93  327   26  248  236    6   14  248  Q90628     Trypsin I-P38 OS=Gallus gallus PE=2 SV=1
  713 : TRY2_MOUSE          0.33  0.56   93  327   24  246  236    6   14  246  P07146     Anionic trypsin-2 OS=Mus musculus GN=Prss2 PE=2 SV=1
  714 : TRY3_CHICK          0.33  0.57   93  326   26  247  235    6   14  248  Q90629     Trypsin II-P29 OS=Gallus gallus PE=2 SV=1
  715 : TRYP_SQUAC          0.33  0.56   93  326    8  228  234    4   13  229  P00764     Trypsin OS=Squalus acanthias PE=1 SV=1
  716 : A1KXI1_BLOTA        0.32  0.51   93  321   36  260  240   12   26  266  A1KXI1     Blo t 3 allergen OS=Blomia tropicalis PE=2 SV=1
  717 : A7RKX5_NEMVE        0.32  0.50   93  325    2  240  243   10   14  240  A7RKX5     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g85362 PE=3 SV=1
  718 : A7S0V1_NEMVE        0.32  0.47    1   86   35  119   93    2   15  228  A7S0V1     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g100228 PE=4 SV=1
  719 : A7SDB3_NEMVE        0.32  0.53   93  322    4  235  238    7   14  244  A7SDB3     Predicted protein OS=Nematostella vectensis GN=v1g210516 PE=3 SV=1
  720 : A7SQF0_NEMVE        0.32  0.53   93  327    5  250  249    8   17  251  A7SQF0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g127472 PE=3 SV=1
  721 : A7SY07_NEMVE        0.32  0.49    1   73   38  109   80    2   15  109  A7SY07     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g46960 PE=4 SV=1
  722 : A7SYX0_NEMVE        0.32  0.43    2   84    1   84   91    3   15  113  A7SYX0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g138442 PE=4 SV=1
  723 : A7T118_NEMVE        0.32  0.48    1   84    4   86   91    2   15  116  A7T118     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g141165 PE=4 SV=1
  724 : B4JVW1_DROGR        0.32  0.53   93  323   12  239  245   12   31  243  B4JVW1     GH22928 OS=Drosophila grimshawi GN=Dgri\GH22928 PE=3 SV=1
  725 : B4K0E5_DROGR        0.32  0.49   93  323    8  224  238   10   28  234  B4K0E5     GH11999 OS=Drosophila grimshawi GN=Dgri\GH11999 PE=3 SV=1
  726 : B4KFB8_DROMO        0.32  0.50   93  320   35  254  234    8   20  260  B4KFB8     GI17455 OS=Drosophila mojavensis GN=Dmoj\GI17455 PE=3 SV=1
  727 : B4NW78_DROYA        0.32  0.50   93  325   24  242  240   15   28  244  B4NW78     GE15159 OS=Drosophila yakuba GN=Dyak\GE15159 PE=3 SV=1
  728 : B4QB84_DROSI        0.32  0.49   93  326   28  260  250   15   33  262  B4QB84     GD25909 OS=Drosophila simulans GN=Dsim\GD25909 PE=3 SV=1
  729 : C3YLW1_BRAFL        0.32  0.51    1   86   90  175   94    3   16  220  C3YLW1     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_227194 PE=4 SV=1
  730 : C3ZMI6_BRAFL        0.32  0.44    2   86    1   84   93    4   17  194  C3ZMI6     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_233362 PE=4 SV=1
  731 : D2I407_AILME        0.32  0.54   93  321    4  230  241    8   26  230  D2I407     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_020297 PE=3 SV=1
  732 : D3TKX6_GLOMM        0.32  0.48   93  326   22  248  244   12   27  249  D3TKX6     Trypsin (Fragment) OS=Glossina morsitans morsitans PE=2 SV=1
  733 : E2BYI8_HARSA        0.32  0.49   93  327   13  264  256   10   25  265  E2BYI8     Transmembrane protease, serine 9 (Fragment) OS=Harpegnathos saltator GN=EAI_08942 PE=3 SV=1
  734 : E9HAG8_DAPPU        0.32  0.49   93  327    6  242  246   10   20  243  E9HAG8     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_60449 PE=3 SV=1
  735 : E9HMR4_DAPPU        0.32  0.48   93  326   25  253  248   14   33  254  E9HMR4     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_262285 PE=3 SV=1
  736 : F4MI42_9DIPT        0.32  0.50   93  322    1  223  234    6   15  227  F4MI42     Putative trypsin 3 (Fragment) OS=Phlebotomus perniciosus PE=2 SV=1
  737 : F6XAG7_CIOIN        0.32  0.51   93  325    9  263  257   10   26  263  F6XAG7     Uncharacterized protein (Fragment) OS=Ciona intestinalis GN=LOC100176526 PE=3 SV=2
  738 : F7AFK1_HORSE        0.32  0.52   93  327    2  228  243   11   24  228  F7AFK1     Uncharacterized protein (Fragment) OS=Equus caballus GN=KLK12 PE=3 SV=1
  739 : G3PBK6_GASAC        0.32  0.52   93  326   24  248  237    7   15  249  G3PBK6     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  740 : H0Z7A8_TAEGU        0.32  0.49    2   86  214  297   93    5   17  339  H0Z7A8     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=SNED1 PE=4 SV=1
  741 : H2L3H1_ORYLA        0.32  0.55   93  325    1  232  241    8   17  232  H2L3H1     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101170186 PE=3 SV=1
  742 : H2L430_ORYLA        0.32  0.52    1   86  302  387   95    5   18  627  H2L430     Delta-like protein (Fragment) OS=Oryzias latipes GN=DLL3 (2 of 2) PE=3 SV=1
  743 : H2RVJ3_TAKRU        0.32  0.48    2   88   89  173   96    4   20  438  H2RVJ3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101064607 PE=3 SV=1
  744 : H2T4V6_TAKRU        0.32  0.51   93  327   22  247  238    8   15  247  H2T4V6     Uncharacterized protein OS=Takifugu rubripes GN=LOC101064664 PE=3 SV=1
  745 : H2T4V9_TAKRU        0.32  0.51   93  327   23  248  237    7   13  248  H2T4V9     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101064664 PE=3 SV=1
  746 : H3AXT5_LATCH        0.32  0.43    2   86    5   83   93    5   22  266  H3AXT5     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  747 : H3D4F4_TETNG        0.32  0.49   93  327   23  248  237    7   13  248  H3D4F4     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  748 : H3IM40_STRPU        0.32  0.44    1   90  118  200   98    5   23 1133  H3IM40     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=4 SV=1
  749 : H9F592_MACMU        0.32  0.52   93  326   13  253  251   14   27  254  H9F592     Mannan-binding lectin serine protease 2 isoform 1 preproprotein (Fragment) OS=Macaca mulatta GN=MASP2 PE=2 SV=1
  750 : I2NA45_9ACTO        0.32  0.54   93  324   18  235  237   10   24  235  I2NA45     Trypsin-like serine protease OS=Streptomyces tsukubaensis NRRL18488 GN=STSU_03297 PE=3 SV=1
  751 : I3IWK1_ORENI        0.32  0.48    1   89  320  409  101    7   23  689  I3IWK1     Delta-like protein OS=Oreochromis niloticus GN=DLL4 (1 of 2) PE=3 SV=1
  752 : I3IWK2_ORENI        0.32  0.48    1   89  320  409  101    7   23  652  I3IWK2     Delta-like protein OS=Oreochromis niloticus GN=DLL4 (1 of 2) PE=3 SV=1
  753 : J9QWU2_9CRUS        0.32  0.53   93  320    7  232  233    7   12  237  J9QWU2     Trypsin 610 (Fragment) OS=Daphnia magna PE=2 SV=1
  754 : K1P7L3_CRAGI        0.32  0.46    1   86   75  155   93    6   19  256  K1P7L3     Neurogenic locus notch-like protein 1 OS=Crassostrea gigas GN=CGI_10000604 PE=4 SV=1
  755 : K7ZG86_BDEBC        0.32  0.52   93  323   29  254  240   10   23  256  K7ZG86     Trypsin OS=Bdellovibrio bacteriovorus str. Tiberius GN=Bdt_2544 PE=3 SV=1
  756 : L5KXF6_PTEAL        0.32  0.53   93  325  370  640  271   10   38  644  L5KXF6     Prothrombin OS=Pteropus alecto GN=PAL_GLEAN10018124 PE=3 SV=1
  757 : M3VY57_FELCA        0.32  0.52   93  325    2  249  252    7   23  256  M3VY57     Uncharacterized protein (Fragment) OS=Felis catus GN=OVCH2 PE=3 SV=1
  758 : M7AJB9_CHEMY        0.32  0.45    2   86  111  201   93    7   10  413  M7AJB9     Protein delta like protein 2 OS=Chelonia mydas GN=UY3_18389 PE=4 SV=1
  759 : N6TLD4_9CUCU        0.32  0.41    6   73   34  101   76    3   16  108  N6TLD4     Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae GN=YQE_02358 PE=4 SV=1
  760 : Q17036_ANOGA        0.32  0.52   93  321   10  240  240   11   20  250  Q17036     Serine proteinase (Fragment) OS=Anopheles gambiae PE=3 SV=1
  761 : Q179B1_AEDAE        0.32  0.50   93  324   20  247  238    8   16  247  Q179B1     AAEL005689-PA OS=Aedes aegypti GN=AAEL005689 PE=3 SV=1
  762 : Q4G030_RAT          0.32  0.49   93  327  121  363  268   17   58  364  Q4G030     C1r protein (Fragment) OS=Rattus norvegicus GN=C1r PE=2 SV=1
  763 : Q4QQB7_DROME        0.32  0.42    2   86   38  123   95    7   19 1400  Q4QQB7     LD34134p (Fragment) OS=Drosophila melanogaster GN=N PE=2 SV=1
  764 : Q5M902_XENTR        0.32  0.51   93  327   24  243  236    5   17  243  Q5M902     Trypsin 10 OS=Xenopus tropicalis GN=try10 PE=2 SV=1
  765 : Q6GYJ5_STRCA        0.32  0.54   93  326    9  230  235    5   14  231  Q6GYJ5     Pancreatic trypsinogen (Fragment) OS=Struthio camelus PE=2 SV=2
  766 : Q7KPY6_LUCCU        0.32  0.45    2   86  125  210   94    4   17  227  Q7KPY6     Notch homolog (Fragment) OS=Lucilia cuprina GN=Scl PE=4 SV=1
  767 : R7VKE8_9ANNE        0.32  0.51   93  325    2  239  240    7    9  239  R7VKE8     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_113671 PE=4 SV=1
  768 : A4JYS0_DANRE        0.31  0.49    1   86  308  393   95    5   18  664  A4JYS0     Delta-like protein OS=Danio rerio GN=dlc PE=2 SV=1
  769 : A7RKD0_NEMVE        0.31  0.46    2   84    1   82   90    2   15  113  A7RKD0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g62405 PE=4 SV=1
  770 : A7RKD8_NEMVE        0.31  0.44    2   84   82  164   91    3   16  195  A7RKD8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g84399 PE=4 SV=1
  771 : A7S6D2_NEMVE        0.31  0.46    1   84   42  124   91    2   15  169  A7S6D2     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g106413 PE=4 SV=1
  772 : A7S9G1_NEMVE        0.31  0.54   93  325    1  242  247    8   19  245  A7S9G1     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g109826 PE=3 SV=1
  773 : A7SP50_NEMVE        0.31  0.44    1   86   75  161   91    5    9  186  A7SP50     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g125705 PE=4 SV=1
  774 : A7T191_NEMVE        0.31  0.41    2   68    1   66   75    4   17   71  A7T191     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g44265 PE=4 SV=1
  775 : A7T6R5_NEMVE        0.31  0.48    1   86   85  169   93    2   15  240  A7T6R5     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g148151 PE=4 SV=1
  776 : A8P933_BRUMA        0.31  0.52   93  325    4  235  246   12   27  245  A8P933     Trypsin family protein (Fragment) OS=Brugia malayi GN=Bm1_19535 PE=3 SV=1
  777 : B3DFM3_DANRE        0.31  0.49    1   86  308  393   95    5   18  664  B3DFM3     Delta-like protein OS=Danio rerio GN=dlc PE=2 SV=1
  778 : B3N9I5_DROER        0.31  0.48   93  325   24  225  241   14   47  227  B3N9I5     GG24538 OS=Drosophila erecta GN=Dere\GG24538 PE=3 SV=1
  779 : B3RY71_TRIAD        0.31  0.54   93  327    2  238  249   10   26  238  B3RY71     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_25686 PE=3 SV=1
  780 : B7S8U3_9HYME        0.31  0.47   93  324   13  230  236   11   22  232  B7S8U3     Chymotrypsin-like protein OS=Glyptapanteles indiensis GN=GIP_L3_0210 PE=3 SV=1
  781 : C3XPW7_BRAFL        0.31  0.44    1   89 1397 1471   96    3   28 1796  C3XPW7     Uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_67440 PE=4 SV=1
  782 : C3XPW9_BRAFL        0.31  0.41    1   90 1217 1292   97    3   28 2122  C3XPW9     Uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_118457 PE=4 SV=1
  783 : C3Y021_BRAFL        0.31  0.48   93  327   24  216  238    9   48  216  C3Y021     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_57891 PE=3 SV=1
  784 : C3Y2N6_BRAFL        0.31  0.48    1   84  120  214   95    3   11  505  C3Y2N6     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_86801 PE=4 SV=1
  785 : C3Y565_BRAFL        0.31  0.41    1   84   14   96   91    2   15  105  C3Y565     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_235995 PE=4 SV=1
  786 : C3Y635_BRAFL        0.31  0.49    1   67   33  107   75    2    8  109  C3Y635     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_160505 PE=4 SV=1
  787 : C3Y637_BRAFL        0.31  0.48    1   87   86  166   94    6   20  338  C3Y637     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_231922 PE=4 SV=1
  788 : C3Z4M5_BRAFL        0.31  0.46   93  320    1  183  232    3   53  183  C3Z4M5     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_243675 PE=3 SV=1
  789 : C3ZIW4_BRAFL        0.31  0.50   93  326   45  297  262   17   37  298  C3ZIW4     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_105242 PE=3 SV=1
  790 : C3ZQT1_BRAFL        0.31  0.47    1   86   46  130   93    2   15  297  C3ZQT1     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_144886 PE=4 SV=1
  791 : D3TKN2_GLOMM        0.31  0.49   93  320   10  229  235   10   22  236  D3TKN2     Trypsin-like serine protease (Fragment) OS=Glossina morsitans morsitans PE=2 SV=1
  792 : D3TR36_GLOMM        0.31  0.50   93  320   28  248  237   11   25  255  D3TR36     Midgut trypsin OS=Glossina morsitans morsitans PE=2 SV=1
  793 : D3TR38_GLOMM        0.31  0.50   93  320   28  247  236   11   24  254  D3TR38     Midgut trypsin OS=Glossina morsitans morsitans PE=2 SV=1
  794 : DLK2_HUMAN          0.31  0.45    2   86   95  185   93    7   10  383  Q6UY11     Protein delta homolog 2 OS=Homo sapiens GN=DLK2 PE=2 SV=1
  795 : DLLC_DANRE          0.31  0.49    1   86  308  393   95    5   18  664  Q9IAT6     Delta-like protein C OS=Danio rerio GN=dlc PE=2 SV=1
  796 : E5S025_TRISP        0.31  0.47   93  326   39  298  267   13   40  309  E5S025     Peptidase, S1A subfamily OS=Trichinella spiralis GN=Tsp_08945 PE=3 SV=1
  797 : F1R9V2_DANRE        0.31  0.44    2   86    5   83   93    5   22  309  F1R9V2     Uncharacterized protein (Fragment) OS=Danio rerio GN=ncanb PE=4 SV=1
  798 : F4W815_ACREC        0.31  0.49   93  327    7  258  256   10   25  259  F4W815     Serine proteinase stubble OS=Acromyrmex echinatior GN=G5I_01592 PE=3 SV=1
  799 : F6V6A8_MONDO        0.31  0.50   93  324   10  251  252   10   30  251  F6V6A8     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=LOC100022135 PE=3 SV=1
  800 : F7BVC0_CALJA        0.31  0.44    2   86   95  185   93    7   10  383  F7BVC0     Uncharacterized protein OS=Callithrix jacchus GN=DLK2 PE=4 SV=1
  801 : F7C6H1_ORNAN        0.31  0.51   93  326   20  262  258   16   39  264  F7C6H1     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=C1RL PE=3 SV=1
  802 : F7D781_XENTR        0.31  0.44    2   89  223  304   95    7   20  912  F7D781     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=matn4 PE=4 SV=1
  803 : F7G7Y2_MACMU        0.31  0.45    2   86   95  185   93    7   10  383  F7G7Y2     Protein delta homolog 2 OS=Macaca mulatta GN=DLK2 PE=2 SV=1
  804 : F7GPM6_CALJA        0.31  0.51   93  326   35  278  263   11   48  323  F7GPM6     Uncharacterized protein OS=Callithrix jacchus GN=PRSS27 PE=3 SV=1
  805 : F7GPN7_CALJA        0.31  0.51   93  326   36  279  263   11   48  292  F7GPN7     Uncharacterized protein OS=Callithrix jacchus GN=PRSS27 PE=3 SV=1
  806 : F7H8I5_MACMU        0.31  0.44    1   84  715  797   95    7   23 2439  F7H8I5     Uncharacterized protein (Fragment) OS=Macaca mulatta PE=2 SV=1
  807 : F7HQZ9_MACMU        0.31  0.44    1   84  756  838   95    7   23 2537  F7HQZ9     Uncharacterized protein OS=Macaca mulatta PE=2 SV=1
  808 : G1QVL9_NOMLE        0.31  0.45    2   86   95  185   93    7   10  383  G1QVL9     Uncharacterized protein OS=Nomascus leucogenys GN=DLK2 PE=4 SV=1
  809 : G3GUR1_CRIGR        0.31  0.47   93  327  464  704  273   17   70  705  G3GUR1     Complement C1r-A subcomponent OS=Cricetulus griseus GN=I79_001432 PE=3 SV=1
  810 : G3PHL1_GASAC        0.31  0.50    1   89  302  391  101    7   23  659  G3PHL1     Delta-like protein (Fragment) OS=Gasterosteus aculeatus GN=DLL4 (1 of 2) PE=3 SV=1
  811 : G3PJP2_GASAC        0.31  0.51    1   86  315  400   95    5   18  685  G3PJP2     Delta-like protein OS=Gasterosteus aculeatus GN=DLL3 (2 of 2) PE=3 SV=1
  812 : G3QZU4_GORGO        0.31  0.45    2   86   95  185   93    7   10  383  G3QZU4     Uncharacterized protein OS=Gorilla gorilla gorilla GN=DLK2 PE=4 SV=1
  813 : G3TQH5_LOXAF        0.31  0.44    1   84  177  259   95    7   23  698  G3TQH5     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=NOTCH1 PE=4 SV=1
  814 : G3X2Q4_SARHA        0.31  0.49    2   89  791  882   97    6   14 1397  G3X2Q4     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=SLIT1 PE=4 SV=1
  815 : G7NF68_MACMU        0.31  0.44    1   84  736  818   95    7   23 2536  G7NF68     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_07186 PE=4 SV=1
  816 : G7NQR3_MACMU        0.31  0.52   93  327   13  256  254    9   29  257  G7NQR3     Tryptase alpha-1 (Fragment) OS=Macaca mulatta GN=EGK_12329 PE=3 SV=1
  817 : G7PR57_MACFA        0.31  0.44    1   84  624  706   95    7   23 2430  G7PR57     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_06506 PE=4 SV=1
  818 : G8F4F1_MACFA        0.31  0.45    2   86   95  185   93    7   10  383  G8F4F1     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_20376 PE=4 SV=1
  819 : G9JWI6_NEMVE        0.31  0.45    1   91  333  413   98    3   24  613  G9JWI6     Delta-like protein OS=Nematostella vectensis GN=delta PE=2 SV=1
  820 : H0W6S3_CAVPO        0.31  0.51   93  326   14  257  263   11   48  267  H0W6S3     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100735414 PE=3 SV=1
  821 : H2M9P4_ORYLA        0.31  0.40    2   86  301  386   95    6   19 1225  H2M9P4     Delta-like protein (Fragment) OS=Oryzias latipes GN=JAG1 (2 of 2) PE=3 SV=1
  822 : H2M9P8_ORYLA        0.31  0.40    2   86  297  382   95    6   19 1229  H2M9P8     Delta-like protein OS=Oryzias latipes GN=JAG1 (2 of 2) PE=3 SV=1
  823 : H2M9Q1_ORYLA        0.31  0.40    2   86  282  367   95    6   19 1207  H2M9Q1     Delta-like protein (Fragment) OS=Oryzias latipes GN=JAG1 (2 of 2) PE=3 SV=1
  824 : H2PJ55_PONAB        0.31  0.45    2   86   95  185   93    7   10  383  H2PJ55     Uncharacterized protein OS=Pongo abelii GN=DLK2 PE=4 SV=1
  825 : H2PTZ2_PONAB        0.31  0.44    1   84  756  838   95    7   23 2107  H2PTZ2     Uncharacterized protein OS=Pongo abelii GN=NOTCH1 PE=4 SV=1
  826 : H2R794_PANTR        0.31  0.45    2   86   95  185   93    7   10  383  H2R794     Uncharacterized protein OS=Pan troglodytes GN=DLK2 PE=4 SV=1
  827 : H2TVQ8_TAKRU        0.31  0.50   93  324   17  256  248   11   24  258  H2TVQ8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=TPSAB1 PE=3 SV=1
  828 : H2U7G8_TAKRU        0.31  0.48    1   89  324  413  101    7   23  694  H2U7G8     Delta-like protein (Fragment) OS=Takifugu rubripes GN=DLL4 (1 of 2) PE=3 SV=1
  829 : H2U7G9_TAKRU        0.31  0.48    1   89  324  413  101    7   23  694  H2U7G9     Delta-like protein (Fragment) OS=Takifugu rubripes GN=DLL4 (1 of 2) PE=3 SV=1
  830 : H2U7H0_TAKRU        0.31  0.48    1   89  316  405  101    7   23  686  H2U7H0     Delta-like protein (Fragment) OS=Takifugu rubripes GN=DLL4 (1 of 2) PE=3 SV=1
  831 : H2U7H1_TAKRU        0.31  0.48    1   89  327  416  101    7   23  697  H2U7H1     Delta-like protein (Fragment) OS=Takifugu rubripes GN=DLL4 (1 of 2) PE=3 SV=1
  832 : H2ZF31_CIOSA        0.31  0.42    2   86   37  120   93    5   17  390  H2ZF31     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
  833 : H3AI72_LATCH        0.31  0.49   93  320   25  275  257   11   35  278  H3AI72     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
  834 : H3D063_TETNG        0.31  0.49    1   86  318  404   98    7   23  689  H3D063     Delta-like protein OS=Tetraodon nigroviridis GN=DLL4 (1 of 2) PE=3 SV=1
  835 : H3IYP1_STRPU        0.31  0.47    1   84   55  154  100    3   16  187  H3IYP1     Uncharacterized protein (Fragment) OS=Strongylocentrotus purpuratus PE=4 SV=1
  836 : H9FL54_MACMU        0.31  0.44    1   84  141  223   95    7   23  753  H9FL54     Neurogenic locus notch homolog protein 1 preproprotein (Fragment) OS=Macaca mulatta GN=NOTCH1 PE=2 SV=1
  837 : H9Z9C8_MACMU        0.31  0.44    1   84  756  838   95    7   23 2556  H9Z9C8     Neurogenic locus notch homolog protein 1 preproprotein OS=Macaca mulatta GN=NOTCH1 PE=2 SV=1
  838 : I1E9D6_AMPQE        0.31  0.46    1   87  261  341   95    8   22  365  I1E9D6     Uncharacterized protein (Fragment) OS=Amphimedon queenslandica PE=4 SV=1
  839 : I1EII3_AMPQE        0.31  0.53    1   88   40  128   95    7   13  286  I1EII3     Uncharacterized protein (Fragment) OS=Amphimedon queenslandica PE=4 SV=1
  840 : K0K9Q0_SACES        0.31  0.50   93  326   24  247  243   10   28  249  K0K9Q0     Trypsin-like protein OS=Saccharothrix espanaensis (strain ATCC 51144 / DSM 44229 / JCM 9112 / NBRC 15066 / NRRL 15764) GN=BN6_70320 PE=3 SV=1
  841 : K7FUI0_PELSI        0.31  0.47    2   89   89  182   96    7   10  369  K7FUI0     Uncharacterized protein (Fragment) OS=Pelodiscus sinensis GN=DLK2 PE=4 SV=1
  842 : L5JQ65_PTEAL        0.31  0.46    2   86   95  185   93    7   10  383  L5JQ65     Protein delta like protein 2 OS=Pteropus alecto GN=PAL_GLEAN10025398 PE=4 SV=1
  843 : M3X532_FELCA        0.31  0.43    2   86    5   83   93    5   22  314  M3X532     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
  844 : M3ZPW8_XIPMA        0.31  0.47    2   89  321  409  100    7   23  687  M3ZPW8     Delta-like protein OS=Xiphophorus maculatus GN=DLL4 (1 of 2) PE=3 SV=1
  845 : NOTC1_HUMAN 1YYH    0.31  0.44    1   84  756  838   95    7   23 2555  P46531     Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4
  846 : O44332_MANSE        0.31  0.51   93  327   31  254  240    9   21  255  O44332     Hemocyte protease-3 OS=Manduca sexta PE=2 SV=1
  847 : Q0IFC0_AEDAE        0.31  0.56   93  324    8  250  247    7   19  251  Q0IFC0     AAEL005906-PA OS=Aedes aegypti GN=AAEL005906 PE=3 SV=1
  848 : Q4SC13_TETNG        0.31  0.49    1   86  298  384   98    7   23  669  Q4SC13     Delta-like protein (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00020707001 PE=3 SV=1
  849 : Q5RGG6_DANRE        0.31  0.43    1   87  282  364   98    6   26  645  Q5RGG6     Delta-like protein (Fragment) OS=Danio rerio GN=dll4 PE=3 SV=1
  850 : Q5SPB5_DANRE        0.31  0.43    1   87  320  402   98    6   26  683  Q5SPB5     Delta-like protein OS=Danio rerio GN=dll4 PE=3 SV=2
  851 : Q5T3T9_HUMAN        0.31  0.45    2   86   89  179   93    7   10  377  Q5T3T9     Protein delta homolog 2 OS=Homo sapiens GN=DLK2 PE=2 SV=1
  852 : Q8T5W7_CAERE        0.31  0.42    1   74    5   82   85    4   18  129  Q8T5W7     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
  853 : Q8T5W8_CAERE        0.31  0.43    1   73    4   80   84    4   18  128  Q8T5W8     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
  854 : Q8T5X1_CAERE        0.31  0.42    1   73    4   80   84    4   18  128  Q8T5X1     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
  855 : Q8T5X2_CAERE        0.31  0.44    1   73    3   79   84    4   18  127  Q8T5X2     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
  856 : Q8T5X4_CAERE        0.31  0.41    1   74    5   82   85    4   18  129  Q8T5X4     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
  857 : R0JGZ4_ANAPL        0.31  0.51   93  327    5  229  237    6   14  229  R0JGZ4     Kallikrein-6 (Fragment) OS=Anas platyrhynchos GN=Anapl_17536 PE=4 SV=1
  858 : R0L536_ANAPL        0.31  0.49   93  324    6  228  240   10   25  228  R0L536     Kallikrein-11 (Fragment) OS=Anas platyrhynchos GN=Anapl_17535 PE=4 SV=1
  859 : TRYP_SARBU          0.31  0.50   93  326   27  253  243   11   25  254  P51588     Trypsin OS=Sarcophaga bullata PE=1 SV=1
  860 : A7S2E6_NEMVE        0.30  0.50    1   75   35  108   82    2   15  114  A7S2E6     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g101796 PE=4 SV=1
  861 : A7SSR9_NEMVE        0.30  0.50   93  327    2  248  251   10   20  260  A7SSR9     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g130234 PE=3 SV=1
  862 : A7STC0_NEMVE        0.30  0.44    2   84  203  284   93    6   21  386  A7STC0     Predicted protein OS=Nematostella vectensis GN=v1g130899 PE=4 SV=1
  863 : B3RZV5_TRIAD        0.30  0.34    2   86  180  261   97    7   27  316  B3RZV5     Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_57591 PE=4 SV=1
  864 : B5A5B0_MOUSE        0.30  0.50   93  327   29  269  256   10   36  270  B5A5B0     Tryptase alpha/beta 1 OS=Mus musculus GN=Tpsab1 PE=3 SV=1
  865 : C3Y015_BRAFL        0.30  0.47   93  322   14  246  247    6   31  246  C3Y015     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_209214 PE=3 SV=1
  866 : C3Y516_BRAFL        0.30  0.49   93  326   11  211  242   10   49  226  C3Y516     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_60416 PE=3 SV=1
  867 : C3YDH9_BRAFL        0.30  0.52   93  327    2  243  247    9   17  244  C3YDH9     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_218432 PE=3 SV=1
  868 : C3YMA0_BRAFL        0.30  0.49    1   86  133  217   93    2   15  223  C3YMA0     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_210234 PE=4 SV=1
  869 : C3YMD2_BRAFL        0.30  0.49    2   88    1   94   94    1    7  151  C3YMD2     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_178382 PE=4 SV=1
  870 : C3YMV5_BRAFL        0.30  0.37    1   85  227  315  103    9   32  528  C3YMV5     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_117022 PE=4 SV=1
  871 : C3Z5K8_BRAFL        0.30  0.43    1   86    3   87   93    2   15  272  C3Z5K8     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_203173 PE=4 SV=1
  872 : C3Z6G2_BRAFL        0.30  0.48    1   87    4   84   94    6   20  327  C3Z6G2     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_232270 PE=4 SV=1
  873 : C3ZBJ2_BRAFL        0.30  0.47    1   86   90  174   93    2   15  422  C3ZBJ2     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_65067 PE=4 SV=1
  874 : C3ZW46_BRAFL        0.30  0.44    6   84    1   78   87    4   17  106  C3ZW46     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_270316 PE=4 SV=1
  875 : D6WP84_TRICA        0.30  0.49   93  326  106  373  271   17   40  373  D6WP84     Serine protease P92 OS=Tribolium castaneum GN=P92 PE=3 SV=1
  876 : DLK2_MOUSE          0.30  0.44    2   86   95  185   93    7   10  382  Q8K1E3     Protein delta homolog 2 OS=Mus musculus GN=Dlk2 PE=2 SV=3
  877 : DLK2_RAT            0.30  0.44    2   86   95  185   93    7   10  382  D3ZUK3     Protein delta homolog 2 OS=Rattus norvegicus GN=Dlk2 PE=2 SV=1
  878 : E0W4D3_PEDHC        0.30  0.49    1   84   94  177   93    6   18  363  E0W4D3     Putative uncharacterized protein OS=Pediculus humanus subsp. corporis GN=Phum_PHUM617470 PE=4 SV=1
  879 : E1BEB4_BOVIN        0.30  0.42    1   87  880  959   97    8   27 1160  E1BEB4     Uncharacterized protein OS=Bos taurus PE=4 SV=2
  880 : E1BYW1_CHICK        0.30  0.51    1   89  191  278   97    4   17 1470  E1BYW1     Uncharacterized protein (Fragment) OS=Gallus gallus GN=CRB2 PE=2 SV=2
  881 : E1ZM81_CHLVA        0.30  0.47   93  321    1  229  240    8   22  229  E1ZM81     Putative uncharacterized protein (Fragment) OS=Chlorella variabilis GN=CHLNCDRAFT_11918 PE=3 SV=1
  882 : E9FSN4_DAPPU        0.30  0.43    1   84  178  259   93    5   20  440  E9FSN4     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_40767 PE=4 SV=1
  883 : E9GTS5_DAPPU        0.30  0.45   93  324   43  289  262   11   45  292  E9GTS5     Trypsin OS=Daphnia pulex GN=TRY5D PE=3 SV=1
  884 : F6UU50_MONDO        0.30  0.48    2   89  817  907   96    6   13 1349  F6UU50     Uncharacterized protein OS=Monodelphis domestica GN=SLIT1 PE=4 SV=2
  885 : F6VQN3_MONDO        0.30  0.48    2   89  917 1007   96    6   13 1523  F6VQN3     Uncharacterized protein OS=Monodelphis domestica GN=SLIT1 PE=4 SV=2
  886 : F7AJC1_MACMU        0.30  0.51   93  326   35  278  263   11   48  323  F7AJC1     Uncharacterized protein OS=Macaca mulatta GN=PRSS27 PE=2 SV=1
  887 : F7DDZ5_MACMU        0.30  0.51   93  326   36  279  263   11   48  324  F7DDZ5     Uncharacterized protein OS=Macaca mulatta GN=PRSS27 PE=2 SV=1
  888 : F7EWZ8_CALJA        0.30  0.49   93  327    2  244  256   11   34  245  F7EWZ8     Uncharacterized protein (Fragment) OS=Callithrix jacchus PE=3 SV=1
  889 : G1N7Z5_MELGA        0.30  0.52    1   89  180  267   97    4   17 1459  G1N7Z5     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100550306 PE=4 SV=2
  890 : G1TRA2_RABIT        0.30  0.52   93  320    9  240  238    7   16  240  G1TRA2     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=3 SV=1
  891 : G3HYU2_CRIGR        0.30  0.45    2   86   95  185   93    7   10  382  G3HYU2     Protein delta-like 2 OS=Cricetulus griseus GN=I79_016234 PE=4 SV=1
  892 : G3SRV1_LOXAF        0.30  0.44    2   86  132  222   93    7   10  420  G3SRV1     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=DLK2 PE=4 SV=1
  893 : G3WML4_SARHA        0.30  0.43    2   86  106  196   93    7   10  396  G3WML4     Uncharacterized protein (Fragment) OS=Sarcophilus harrisii GN=DLK2 PE=4 SV=1
  894 : G7Q098_MACFA        0.30  0.51   93  326   36  279  263   11   48  324  G7Q098     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_11374 PE=3 SV=1
  895 : G8DZ86_GRYBI        0.30  0.40    2   84  169  254   96    7   23  542  G8DZ86     Delta-like protein (Fragment) OS=Gryllus bimaculatus PE=2 SV=1
  896 : H0V730_CAVPO        0.30  0.42    1   87  378  457   97    8   27  658  H0V730     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=Fbln2 PE=4 SV=1
  897 : H0Z239_TAEGU        0.30  0.50   93  320    6  231  241    9   28  237  H0Z239     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=TMPRSS11B-1 PE=3 SV=1
  898 : H1A5F0_TAEGU        0.30  0.37    2   75   62  129   84    5   26  137  H1A5F0     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=4 SV=1
  899 : H2MAB2_ORYLA        0.30  0.46   93  327  460  715  278   16   65  715  H2MAB2     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101173495 PE=3 SV=1
  900 : H2MWR7_ORYLA        0.30  0.50    2   87    5   93   94    6   13  207  H2MWR7     Uncharacterized protein OS=Oryzias latipes PE=4 SV=1
  901 : H2QAE0_PANTR        0.30  0.50   93  325   35  277  262   11   48  290  H2QAE0     Uncharacterized protein OS=Pan troglodytes GN=PRSS27 PE=3 SV=1
  902 : H2S2H4_TAKRU        0.30  0.49   93  320   41  308  272   11   48  327  H2S2H4     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=MASP1 (1 of 2) PE=3 SV=1
  903 : H2UA78_TAKRU        0.30  0.50   93  320    2  208  238   11   41  209  H2UA78     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101073906 PE=3 SV=1
  904 : H2XY98_CIOIN        0.30  0.55   93  322    2  233  237    8   12  238  H2XY98     Uncharacterized protein (Fragment) OS=Ciona intestinalis PE=3 SV=1
  905 : H2YN76_CIOSA        0.30  0.45    1   86   39  123   93    2   15  400  H2YN76     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
  906 : H2YN97_CIOSA        0.30  0.41    1   84  226  308   93    3   19  400  H2YN97     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
  907 : H2ZQZ6_CIOSA        0.30  0.39    2   84    8   93   94    5   19  107  H2ZQZ6     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
  908 : H3HT82_STRPU        0.30  0.47    2   88  920 1004   97    6   22 2713  H3HT82     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=4 SV=1
  909 : H3IE11_STRPU        0.30  0.42    2   84 1218 1302   96    8   24 1373  H3IE11     Uncharacterized protein OS=Strongylocentrotus purpuratus PE=4 SV=1
  910 : I1EV87_AMPQE        0.30  0.45    1   87  582  667   96    6   19 1002  I1EV87     Uncharacterized protein (Fragment) OS=Amphimedon queenslandica PE=4 SV=1
  911 : I4DNT5_PAPXU        0.30  0.47   93  326   79  337  262   12   31  337  I4DNT5     Easter (Fragment) OS=Papilio xuthus PE=2 SV=1
  912 : J3JXM3_9CUCU        0.30  0.49   93  326  117  376  270   13   46  376  J3JXM3     Uncharacterized protein OS=Dendroctonus ponderosae PE=2 SV=1
  913 : K7FJI1_PELSI        0.30  0.43    1   84  180  255   93    9   26  277  K7FJI1     Uncharacterized protein OS=Pelodiscus sinensis PE=4 SV=1
  914 : L1IYC0_GUITH        0.30  0.41    3   89   34  117   94    4   17  205  L1IYC0     Uncharacterized protein (Fragment) OS=Guillardia theta CCMP2712 GN=GUITHDRAFT_46324 PE=4 SV=1
  915 : M3YNJ5_MUSPF        0.30  0.45    2   86   95  185   93    7   10  383  M3YNJ5     Uncharacterized protein OS=Mustela putorius furo GN=DLK2 PE=4 SV=1
  916 : PRS27_HUMAN         0.30  0.50   93  325   35  277  262   11   48  290  Q9BQR3     Serine protease 27 OS=Homo sapiens GN=PRSS27 PE=1 SV=1
  917 : Q25059_HELER        0.30  0.46    2   86   54  137   94    3   19  406  Q25059     Fibropellin III (Fragment) OS=Heliocidaris erythrogramma PE=2 SV=1
  918 : Q4SXD4_TETNG        0.30  0.48    1   75   29  100   82    2   17  102  Q4SXD4     Chromosome undetermined SCAF12469, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00010910001 PE=4 SV=1
  919 : Q8T5W5_CAERE        0.30  0.42    2   73    1   76   83    4   18  124  Q8T5W5     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
  920 : Q8T5X0_CAERE        0.30  0.41    2   73    1   76   83    4   18  124  Q8T5X0     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
  921 : Q921N4_MOUSE        0.30  0.50   93  327   29  272  258   10   37  273  Q921N4     Tryptase alpha/beta 1 OS=Mus musculus GN=Tpsab1 PE=2 SV=1
  922 : Q9CV76_MOUSE        0.30  0.51   93  327    9  234  243   11   25  234  Q9CV76     MCG144712 (Fragment) OS=Mus musculus GN=Klk12 PE=2 SV=1
  923 : R7UTL3_9ANNE        0.30  0.43    2   84    1   84   93    5   19  221  R7UTL3     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_98122 PE=4 SV=1
  924 : TRYT_MERUN          0.30  0.48   93  327   26  269  263   12   47  270  P50342     Mast cell tryptase OS=Meriones unguiculatus PE=2 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1   49 A Q              0   0  101  253   29     QQQ QQQQ Q QQ Q Q  Q Q  Q QQ                     QQ QQ QQQQ QQQQ   
     2   50 A a    >   +     0   0   22  341    0     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
     3   51 A E  T 3  S+     0   0  187  342   77     EEE EEEE E EE E E  E E  E EE                     EE EE EDED EEEE   
     4   52 A T  T 3  S-     0   0  105  342   54     TTT TTTT T TT T T  T T  T SS                     GS SS SSSS SSSS   
     5   53 A S    <   +     0   0   89  342   62     SSS SSSS S SS S S  S S  S SD                     SS SN NNSN SSNS   
     6   54 A P        +     0   0   10  343   18     PPP PPPP P PP P P  P P  P PP                     PP PP PPPP PPPP   
     7   55 A b        -     0   0   18  344    0     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
     8   56 A Q  S    S+     0   0   92  343   70     QQQ QQQQ Q QQ Q Q  Q Q  Q QQ                     QQ QQ LQQL QQLQ   
     9   57 A N  S    S-     0   0   63  303   24     NNN NNNN N NN N N  N N  N NN                     NN NN NNNN NNNN   
    10   58 A Q  S    S-     0   0  152  336   48     QQQ QQQE Q EE E E  E E  E QQ                     QQ QQ QQEE QQQQ   
    11   59 A G        -     0   0   16  344   17     GGG GGGG G GG G G  G G  G GG                     GG GG GGGG GGGG   
    12   60 A K  E     -A   23   0A 117  344   75     KKK KKKK K KK K K  K K  K KK                     VK KK RKQK AARA   
    13   61 A a  E     -A   22   0A  45  344    0     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
    14   62 A K  E     -A   21   0A 155  344   82     KKK KKKK K RR R R  R R  R RK                     KK KQ KKRK RRKR   
    15   63 A X  E     +A   20   0A 120  302   29     DDD DDDD D DD D D  D D  D DD                     DD DD DDDD DDDD   
    16   64 A G        -     0   0   44  341   74     GGG GGGG G GG G G  G G  G GG                     GG GG GGGG GGGG   
    17   65 A L  S    S-     0   0  152  342   69     LLL LLLL L LL L L  L L  L LL                     LL LL LLLL IILI   
    18   66 A G  S    S+     0   0   67  343   62     GGG GGGG G GG G G  G G  G GG                     GG GG GGGG GGGG   
    19   67 A E        -     0   0  119  329   61     EEE EEEE E EE E E  E E  E QQ                     QE EE EEEE GGEG   
    20   68 A Y  E     -A   15   0A  37  342    9     YYY YYYY Y YY Y Y  Y Y  Y YY                     YY YY YYYY YYYY   
    21   69 A T  E     -A   14   0A  71  343   83     TTT TTTT T TT T T  T T  T TT                     TN NT TSTT TTNT   
    22   70 A b  E     -A   13   0A  20  343    0     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
    23   71 A T  E     -A   12   0A  85  344   80     TTT TTTT T TT T T  T T  T TT                     TT TT TSTT TTTT   
    24   72 A c        -     0   0   44  344    1     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
    25   73 A L    >   -     0   0   62  344   86     LLL LLLL L LL L L  L L  L LL                     LA AL QLLL SSQS   
    26   74 A E  T 3  S+     0   0  177  344   74     EEE EEEE E EE E E  E E  E EE                     EE EE EDEE EEEE   
    27   75 A G  T 3  S+     0   0   29  344   24     GGG GGGG G GG G G  G G  G GG                     GG GG GGGG GGGG   
    28   76 A F  E <   +B   36   0B  40  343   16     FFF FFFF F FF F F  F F  F FF                     FF FF YFYF FFYF   
    29   77 A E  E     +B   35   0B  74  343   63     EEE EEEE E EE E E  E E  E EE                     EE EE EEEE EEEE   
    30   78 A G  S >  S-     0   0   32  343    1     GGG GGGG G GG G G  G G  G GG                     GG GG GGGG GGGG   
    31   79 A K  T 3  S+     0   0  156  343   72     KKK KKKK K KK K K  K K  K KK                     KK KK RKKK KKRK   
    32   80 A N  T 3  S-     0   0   33  343   62     NNN NNNN N NN N N  N N  N NN                     NN NN NNNN NNNN   
    33   81 A c  S <  S+     0   0    1  344    0     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
    34   82 A E        +     0   0   87  342   30     EEE EEEE E EE E E  E E  E EE                     EE EE EEEE EEEE   
    35   83 A L  E    S-B   29   0B  96  289   42     LLL LLLL L LL L L  L L  L LL                     LL LL LLLL LLLL   
    36   84 A F  E     -B   28   0B 139  292   93     FFF FFFF F FF F F  F F  F FF                     LL LT PFSS FFPF   
    37   85 A T        -     0   0   44   76   76     TTT TTTT T TT T T  T T  T TT                     TT TI MATM VVMV   
    38   86 A R        +     0   0   57  101   88     RRR RRRR R RR R R  R R  R RR                     RR RR RRRR RRRR   
    39   87 A K        +     0   0   96  140   78     KKK KKKK K KK K K  K K  K KK                     KK KE KKKQ KKKK   
    40   88 A L        -     0   0   91  168   91     LLL LLLL L LL L L  L L  L LL                     LL LL FLLL LLFL   
    41   89 A d  S  > S+     0   0   15  238   19     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
    42   90 A S  T  4 S+     0   0   98  244   86     SSS SSSS S SS S S  S S  S SS                     SS SS SSSS RRSR   
    43   91 A L  T >4 S-     0   0  120  274   90     LLL LLLL L LL L L  L L  L LL                     LL LL LLVL LLQL   
    44   92 A D  G >4 S-     0   0  107  297   62     DDD DDDD D DD D D  D D  D DD                     DD DD DDDD DDDD   
    45   93 A N  G >< S-     0   0    8  315   63     NNN NNNN N NN N N  N N  N NN                     NN NN NNNN NNNN   
    46   94 A G  G <  S-     0   0    0  316   53     GGG GGGG G GG G G  G G  G GG                     GG GG GGGG GGGG   
    47   95 A D  G <  S+     0   0   44  344   60     DDD DDDD D DD E E  E E  E DD                     DD DD DDDD DDDD   
    48   96 A e    <   -     0   0    0  344    1     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
    49   97 A D  S    S-     0   0   59  344   73     DDD DDDD D DD D D  D D  D DD                     DD DD DDED DDDD   
    50   98 A Q  S    S+     0   0    2  344   62     QQQ QQQQ Q QQ Q Q  Q Q  Q QQ                     QQ QQ QQQQ QQQQ   
    51   99 A F  E     -C   62   0C   4  344   77     FFF FFFF F FF F F  F F  F FF                     FF FF FFFF FFFF   
    52  100 A d  E     +C   61   0C  10  344    0     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
    53  101 A H  E     -C   60   0C  68  344   86     HHH HHHH H HH H H  H H  H HH                     RR RN RQRS RRRR   
    54  102 A E  E     -C   59   0C  92  344   56     EEE EEEE E EE E E  E E  E EE                     EE EE EEEE EEEE   
    55  103 A E  S    S-     0   0  100  344   81     EEE EEEE E EE E E  E E  E EE                     EE EE EMEE EEEE   
    56  104 A Q  S    S-     0   0  175  310   77     QQQ QQQQ Q QQ Q Q  Q Q  Q QQ                     QQ QR QQQR QQQQ   
    57  105 A N  S    S+     0   0  154  307   78     NNN NNNN N NN N N  N N  N NN                     NS SN NNSN NNNN   
    58  106 A S  S    S-     0   0   58  337   71     SSS SSSS S SS S S  S S  S SS                     ES SS SSSS SSSS   
    59  107 A V  E     -C   54   0C   7  343   86     VVV VVVV V VV V V  V V  V VV                     VV VV VVVV VVVV   
    60  108 A V  E     -C   53   0C  45  344   87     VVV VVVV V VV V V  V V  V VV                     VV VV VVVV VVVV   
    61  109 A e  E     +C   52   0C   5  344    0     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
    62  110 A S  E     -C   51   0C  24  344   70     SSS SSSS S SS S S  S S  S SS                     SS SS SSSS SSSS   
    63  111 A f        -     0   0   23  344    0     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
    64  112 A A    >   -     0   0    8  344   70     AAA AAAA A AA A A  A A  A AA                     AA AA AAAA AAAA   
    65  113 A R  T 3  S+     0   0  149  344   83     RRR RRRR R RR R R  R R  R SS                     SS SA SSSS SSSS   
    66  114 A G  T 3  S+     0   0   24  344   13     GGG GGGG G GG G G  G G  G GG                     GG GG GGGG GGGG   
    67  115 A Y  E <   -D   78   0D  20  344    7     YYY YYYY Y YY Y Y  Y Y  Y YY                     YY YY YYYY YYYY   
    68  116 A T  E     -D   77   0D  72  343   81     TTT TTTT T TT T T  T T  T IV                     TI IT ITVI FFIF   
    69  117 A L  E     -D   76   0D  67  340   68     LLL LLLL L LL L L  L L  L LL                     LL LL LLLL LLLL   
    70  118 A A    >   -     0   0   23  340   78     AAA AAAA A AA A A  A A  A AA                     GG GG DGGG GGDG   
    71  119 A D  T 3  S+     0   0  175  340   77     DDD DDDD D DD D D  D D  D DD                     DD DD DDDD NNDN   
    72  120 A N  T 3  S-     0   0   92  340   74     NNN NNNN N NN N N  N N  N DD                     NN NN NDNN DDND   
    73  121 A G  S <  S+     0   0   16  340   56     GGG GGGG S GG G G  G G  G GG                     GG GG GGGG GGGG   
    74  122 A K  S    S+     0   0   71  332   83     KKK KKKK K KK K K  K K  K KK                     KK KK KKKK KKKK   
    75  123 A A        -     0   0   22  330   70     AAA AAAA A AA A A  A A  A AA                     SS SS SSSS SSSS   
    76  124 A f  E     -D   69   0D  12  300   48     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
    77  125 A I  E     -D   68   0D  78  304   82     III IIII I II I I  I I  I II                     II II IIII IIII   
    78  126 A P  E     -D   67   0D  62  304   56     PPP PPPP P PP P P  P P  P PP                     SS SS SSSS SSSS   
    79  127 A T  S    S+     0   0  103  304   79     TTT TTTT T TT T T  T T  T TT                     TT TT TTTT TTTT   
    80  128 A G  S    S-     0   0   32  305   75     GGG GGGG G GG G G  G G  G GG                     DE EE EDEE AAEA   
    81  129 A P  S    S+     0   0  116  311   78     PPP PPPP P PP P P  P P  P PP                     LP PP PLPP PPPP   
    82  130 A Y  S    S+     0   0   59  312   77     YYY YYYY Y YY Y Y  Y Y  Y YY                     FF FF YFFF FFYF   
    83  131 A P    >   -     0   0   17  312   34     PPP PPPP P PP P P  P P  P PP                     PP PP PPPP PPPP   
    84  132 A g  T 3  S+     0   0   16  323    2     CCC CCCC C CC C C  C C  C CC                     CC CC CCCC CCCC   
    85  133 A G  T 3  S+     0   0    0  295   30     GGG GGGG G GG G G  G G  G GG                     GG GG GGGG GGGG   
    86  134 A K    <   -     0   0   69  294   62     KKK KKKK K KK K K  K K  K KK                     KK KK KKKK KKKK   
    87  135 A Q        -     0   0   37  243   74     QQQ QQQQ Q QQ Q Q  Q Q  Q LL                     LR RL LLTH IILI   
    88  136 A T        +     0   0    4  220   79     TTT TTTT T TT T T  T T  T TT                     TT TT TTTT TTTT   
    89  137 A L        +     0   0  105  200   57     LLL LLLL L LL L L  L L  L LL                     LL LM LLMQ TTLT   
    90  138 A E              0   0  104  120   71     EEE EEEE E EE E E  E E  E EE                     GG GG AGGG GG G   
    91  139 A R              0   0  231   97   28     RRR RRRR R RR R R  R R  R RR                     RR RR RRRR RR R   
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3  III   I    I I  I I II I II I  IIIIIIIIIIIIIIIIIIIII  I  I         III
    94   17 B V  B     -E  271   0E   7  561    9  VVV   V    V V  V V VV V VV V  VVVVVVVVVVVVVVVVVVVVV  V  V         VVV
    95   18 B G  S    S+     0   0   25  562    6  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G         GGG
    96   19 B G  S    S-     0   0   26  563    0  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
    97   20 B Q  E     -F  237   0F  98  564   95  QQQ   Q    R R  R R RR R RR R  RRRRRRRRQKQQRRQQRRQRQ  R  Q    K    RRR
    98   21 B E  E     -F  236   0F  80  565   65  EEE   E    E E  E E EE E EE E  DDEEEEEDDEEDDDDNDDDDD  D  D    K    EED
    99   22 B h        -     0   0    8  565   58  CCC   C    C C  C C CC C CC C  CCCCCCCCCCCCCCCCCCCCC  C  C    V    CCC
   100   23 B K    >   -     0   0  123  564   79  KKK   K    K K  E E EE E EE K  KKKKKKKKRQKRERRPAAKRK  R  K    V    HHQ
   101   24 B D  T 3  S+     0   0   60  565   85  DDD   D    D D  N N NN N NN D  DEDDDDDEDERDEEDDEEDED  E  E    S    DDE
   102   25 B G  T 3  S+     0   0    0  565   73  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   103   26 B E  S <  S+     0   0   36  565   67  EEE   E    E E  E E EE E EE E  EEEEEEEEEEEEEEEEEEEEE  E  E    S    EEE
   104   27 B h    >   +     0   0    4  565   91  CCC   C    C C  C C CC C CC C  CCCCCCCCCCCCCCCCCCCCC  C  C    V    CCC
   105   28 B P  T 3   +     0   0    0  567    9  PPP   P    P P  P P PP P PP P  PPPPPPPPPPPPPPPPPPPPP  P  P    A    PPP
   106   29 B W  T 3  S+     0   0    5  568   27  WWW   W    W W  W W WW W WW W  WWWWWWWWWWWWWWWWWWWWW  W  W    W    WWW
   107   30 B Q  E <   -N  122   0G   7  569   24  QQQ   Q    Q Q  Q Q QQ Q QQ Q  QQQQQQQQQQQQQQQQQQQQQ  Q  Q    W    QQQ
   108   31 B A  E     -NO 121 146G   1  559   47  AAA   A    A A  A A AA A AA A  AAAAAAAAAAAAAAAAAAAAA  A  A    A    AAA
   109   32 B L  E     -NO 120 145G   3  567   65  LLL   L    L L  L L LL L LL L  LLLLLLLLLLLLLLLLLLLLL  L  L    L    LLL
   110   33 B L  E     -NO 119 144G   0  570   11  LLL   L    L L  L L LL L LL L  LLLLLLLLLLLLLLLLLLLLL  L  L    L    LLL
   111   34 B I  E     -NO 117 143G   0  570   81  III   I    I I  I I II I II I  IVIIIIVVIIFVIIVIVVVVV  V  V    I    VVI
   112   35 B N  E >   - O   0 142G  30  570   88  NNN   N    N N  N N NN N NN N  NNNNNNNNNNsNDNNNNNNNN  N  N    K    nnY
   113   36 B E  T 3  S+     0   0   63  113   77  EEE   E    E E  E E EE E EE E  EEEEEEEEEEeEEEEEEEEEE  E  E    E    eeE
   114   37 B E  T 3  S-     0   0  136  242   76  EEE   E    E E  E E EE E EE E  EEDDDDDEEEEEEEEEEEEEE  E  D    N    NNN
   115   38 B N  S <  S+     0   0   84  543   52  NNN   N    N N  N N NN N NN N  NNNNNNNNNNTNNNNNNNNNN  N  N    N    GGK
   116   39 B E        -     0   0  100  561   93  EEE   E    E E  E E EE E EE E  EEEEEEEEEEDEEEEEEEEEE  E  K    E    QQE
   117   40 B G  E     +N  111   0G  14  572   55  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   118   41 B F  E     +     0   0G  28  581   35  FFF   F    F F  F F FF F FF F  FFFFFFFFFFFFFFFFFFFFF  F  F    F    FFF
   119   42 B i  E     -N  110   0G   0  578    1  CCC   C    C C  C C CC C CC C  CCCCCCCCCCCCCCCCCCCCC  C  C    C    CCC
   120   43 B G  E     -N  109   0G   1  581    2  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   121   44 B G  E     -N  108   0G   0  581    9  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   122   45 B T  E     -NP 107 130G   0  581   43  TTT   T    T T  T T TT T TT T  TTTTTTTTTTTTTTTTTTTTT  T  T    T    TTT
   123   46 B I  E     + P   0 129G   0  581   23  III   I    I I  I I II I II I  IIIIIIIIIIIIIIIIIIIII  T  I    I    III
   124   47 B L        -     0   0    6  581   27  LLL   L    L L  L L LL L LL L  LLLLLLLLLLLLLLLLLLLLL  L  L    L    LLL
   125   48 B S  S    S-     0   0   22  581   57  SSS   S    S S  S S SS S SS S  SSNNNNNNSNNSSNSSNNSSS  S  N    N    NNN
   126   49 B E  S    S+     0   0   99  581   62  EEE   E    E E  E E EE E EE E  EEEEEEEEEEEEPEEEEEEEE  E  E    E    EEE
   127   50 B F  S    S+     0   0   42  581   82  FFF   F    F F  F F FF F FF F  FFFFFFFYYYFYFFYYFFFFF  F  H    F    YYY
   128   51 B Y  E     - Q   0 185G   7  581   33  YYY   Y    Y Y  Y Y YY Y YY Y  HHYYYYYYYYYHHYHHYYHHH  H  Y    Y    YYF
   129   52 B I  E     -PQ 123 184G   0  581   14  III   I    I I  I I II I II V  VVIIIIIIIIIVVVVVVVIVI  V  I    I    IIV
   130   53 B L  E     +PQ 122 183G   0  581   28  LLL   L    L L  L L LL L LL L  LLLLLLLLLLLLLLLLLLLLL  L  L    L    LLL
   131   54 B T  E     - Q   0 182G   0  581   43  TTT   T    T T  T T TT T TT T  TTTTTTTTTTTTTTTTTTTTT  T  T    T    SSS
   132   55 B A    >>  -     0   0    0  581    2  AAA   A    A A  A A AA A AA A  AAAAAAAAAAAAAAAAAAAAA  A  A    A    AAA
   133   56 B A  G >4 S+     0   0    0  581    8  AAA   A    A A  A A AA A AA A  AAAAAAAAAAAAAAAAAAAAA  A  A    A    AAA
   134   57 B H  G >4 S+     0   0    7  581    0  HHH   H    H H  H H HH H HH H  HHHHHHHHHHHHHHHHHHHHH  H  H    H    HHH
   135   58 B i  G X4 S+     0   0    0  581    2  CCC   C    C C  C C CC C CC C  CCCCCCCCCCCCCCCCCCCCC  C  C    C    CCC
   136   59 B L  G << S+     0   0   31  581   65  LLL   L    L L  L L LL L LL L  LLLLLLLLLLLLLLLLLLVLV  L  L    L    MMM
   137   60 B Y  G <  S+     0   0  109  581   87  YYY   Y    Y Y  Y Y YY Y YY H  HHHHHHHHQHHHHHHHHHQHQ  H  H    D    HHY
   138   61 B Q  S <  S+     0   0   95  581   78  QQQ   Q    Q Q  Q Q QQ Q QQ Q  QQQQQQQQQQQQQQQQQQQQQ  Q  E    Q    QQP
   139   61AB A        -     0   0   16  352   75  AAA   A    A A  A A AA A AA A  AAAAAAAAATAAAAAAAAAAA  A  A    A    AAL
   140   62 B K  S    S-     0   0  172  366   75  KKK   K    K K  K K KK K KK K  KKRRRRRKKRKKKKKKKKKKK  K  K    K    KKK
   141   63 B R  S    S-     0   0  162  570   78  RRR   R    R R  R R RR R RR R  RRRRRRRRKRRRRRRRRRKKK  R  R    L    RRR
   142   64 B F  E     -O  112   0G  36  577   54  FFF   F    F F  F F FF F FF F  FFFFFFFFFFFFFFFFFFFFF  F  F    F    FFF
   143   65 B K  E     -O  111   0G  67  577   78  KKK   K    K K  K K KK K KK K  KTKKKKKKTKKKKKKKTTTKT  K  T    K    KKQ
   144   66 B V  E     -OR 110 161G   0  577   16  VVV   V    V V  V V VV V VV V  VVVVVVVVVVVVVVVVVVVVV  V  V    V    VVV
   145   67 B R  E     -OR 109 160G  40  577   53  RRR   R    R R  R R RR R RR R  RRRRRRRRRRRRRRRRRRRRR  R  R    R    RRL
   146   68 B V  E     +OR 108 159G   1  578   43  VVV   V    V V  V V VV V VV V  VVVVVVVVVVVVVVVVVVVVV  V  V    V    VVV
   147   69 B G  S    S+     0   0    9  578   14  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   148   70 B D        +     0   0   11  579   58  DDD   D    D D  D D DD D DD D  DDDDDDDDEDDDDEDEDDEDE  D  E    D    EEE
   149   71 B R  S    S+     0   0   24  579   73  RRR   R    R R  R R RR R RR R  RRRRRRRRRRLRRRRRRRRRR  H  R    R    RRR
   150   72 B N  B >   -T  234   0H  18  579   65  NNN   N    N N  D D DD D DD D  NNNNNNNNDNNDNNDDNNDND  N  N    N    DDD
   151   73 B T  T 3  S+     0   0   56  579   79  TTT   T    T T  M M MM M MM T  TTTTTTTTTTTTTTTTTTMLM  L  L    K    TTT
   152   74 B E  T 3  S-     0   0  119  579   84  EEE   E    E E  E E EE E EE E  EEEEEEEEDEEEEEEGEEDED  E  E    E    EER
   153   75 B Q  S <  S-     0   0  130  578   86  QQQ   Q    Q Q  Q Q QQ Q QQ K  KKKKKKKKKEQHKKHSQQKKK  K  K    K    KKK
   154   76 B E        +     0   0  165  578   85  EEE   E    E E  E E EE E EE E  EEEEEEEEEEEEEEEEEEEEE  E  E    E    KKE
   155   77 B E        -     0   0   93  438   29  EEE   E    E E  E E EE E EE E  EEEEEEEEEEDEEEEEEEEEE  E  E    D    DDD
   156   78 B G  S    S+     0   0   46  547   33  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    SSG
   157   79 B G  S    S+     0   0   47  555   76  GGG   G    G G  G G GG G GG G  GNNNNNNNNNGNNNNDNNNDN  D  N    N    SSN
   158   80 B E        -     0   0   37  444   33  EEE   E    E E  E E EE E EE E  EEEEEEEEEEEEEEEEEEEEE  E  E    E    EEE
   159   81 B A  E     -R  146   0G  27  457   60  AAA   A    A A  A A AA A AA T  TMMMMMMMVMMEMMEVMMVAV  A  M    T    MME
   160   82 B V  E     -R  145   0G  71  557   81  VVV   V    V V  V V VV V VV V  VVVVVVVAAAVTAATAAAAAA  A  M    V    AAA
   161   83 B H  E     -R  144   0G  14  567   77  HHH   H    H H  H H HH H HH H  HHHHHHHHHHHHHHHHHHHHH  H  H    H    HHH
   162   84 B E        -     0   0   90  569   77  EEE   E    E E  E E EE D EE E  EEEEEEEEEEEEEEEEEEEEE  E  E    E    EEE
   163   85 B V  E     -S  186   0G  27  574   64  VVV   V    V V  V V VV V VV V  VVVVVVVVVVVVVVVVVVVVV  V  V    V    VVV
   164   86 B E  E    S+     0   0G  70  575   73  EEE   E    E E  E E EE E EE E  EEDDDDDEEEDEEEEDEEEEE  E  E    E    EEE
   165   87 B V  E     -S  185   0G  13  576   72  VVV   V    V V  V V VV V VV V  VVVVVVVIMMMVVMVVMMLVL  V  T    V    KKK
   166   88 B V  E     -S  184   0G  72  577   45  VVV   V    V V  I I II I II I  IVVVVVVIIIIVVIVITTATA  T  V    I    VVV
   167   89 B I  E     +S  183   0G  27  578   45  III   I    I I  I I II I II I  IVIIIIILIIIVVIVIVVVVV  V  I    I    IIL
   168   90 B K  E     -S  182   0G  68  578   82  KKK   K    K K  K K KK K KK K  KKKKKKKKKKKKKKKKKKRKR  K  K    K    VVT
   169   91 B H    >   -     0   0   19  579   14  HHH   H    H H  H H HH H HH H  HHHHHHHHHHHHHHHHHHHHH  H  H    H    HHH
   170   92 B N  T 3  S+     0   0  156  579   60  NNN   N    N N  N N NN N NN N  NNNNNNNNNNNNNNNNSSNSN  S  S    K    SSK
   171   93 B R  T 3  S+     0   0  150  576   74  RRR   R    R R  R R RR R RR R  RRKKKKKKKKKRKKRKRRRRR  R  K    E    KKG
   172   94 B F    <   -     0   0   24  579    5  FFF   F    F F  F F FF F FF F  FFFFFFFFFFFFFFFFFFFFF  F  F    F    FFF
   173   95 B T     >  -     0   0   56  579   67  TTT   T    T T  T T TT T TT S  SVQQQQQVVIQVVVVVVVVVV  V  N    D    VVV
   174   96 B K  T  4 S+     0   0  145  525   79  KKK   K    K K  K K KK K KK I  IKRRRRRRRRRKRKKRKKRRR  R  T    N    KKL
   175   97 B E  T  4 S+     0   0  174  533   92  EEE   E    E E  E E EE E EE E  EEDDDDDEEEDEEEEEEEEEE  E  H    K    KKE
   176   98 B T  T  4 S-     0   0   44  561   58  TTT   T    T T  T T TT T TT T  TTTTTTTTTTTTTTTTTTTTT  T  T    T    TTT
   177   99 B Y    ><  +     0   0   60  566   66  YYY   Y    Y Y  Y Y YY Y YY Y  YYYYYYYYYYYYYYYYYYYYY  Y  Y    F    YYF
   178  100 B D  T 3   +     0   0   25  578   38  DDD   D    D D  D D DD D DD D  DDDDDDDDDDDDDDDDDDDDD  D  D    N    DDD
   179  101 B F  T 3  S+     0   0   21  558   68  FFF   F    F F  F F FF F FF F  FYYYYYYFFFFFFFFFFFFFF  F  C    C    FFN
   180  102 B D    <   +     0   0    1  577    0  DDD   D    D D  D D DD D DD D  DDDDDDDDDDDDDDDDDDDDD  D  D    D    DDD
   181  103 B I        +     0   0    0  579   14  III   I    I I  I I II I II I  IIIIIIIIIIIIIIIIIIIII  I  I    I    III
   182  104 B A  E     -QS 131 168G   0  579   60  AAA   A    A A  A A AA A AA T  TAAAAAAAAAAAAAAAAAAAA  A  A    G    AAA
   183  105 B V  E     -QS 130 167G   0  580   15  VVV   V    V V  V V VV V VV V  VVVVVVVVVVMVVVVVVVVVV  V  V    L    VVL
   184  106 B L  E     -QS 129 166G   0  581   30  LLL   L    L L  L L LL L LL L  LLLLLLLIIVLLLLLILLVLV  L  L    L    III
   185  107 B R  E     -QS 128 165G  40  581   42  RRR   R    R R  R R RR R RR R  RRRRRRRKKKRRRKRRRRKKK  K  R    K    KKK
   186  108 B L  E     - S   0 163G   0  581   17  LLL   L    L L  L L LL L LL L  LLLLLLLLLLLLLLLLLLLLL  L  L    L    LLL
   187  109 B K  S    S+     0   0  101  581   69  KKK   K    K K  K K KK K KK K  KKKKKKKKKKKKKKKRKKKKK  K  K    K    KKK
   188  110 B T  S    S-     0   0   82  582   74  TTT   T    T T  S S SS S SS T  TTTTTTTTTTTTTMTTTTTTT  T  T    T    TTK
   189  111 B P        -     0   0   48  582   39  PPP   P    P P  P P PP P PP P  PPPPPPPPPPPPPPPPPPPPP  P  P    P    PPP
   190  112 B I        -     0   0    4  532   62  III   I    I I  I I II I II I  IIIIIIIIIIIIIIIIIIIII  I  I    I    III
   191  113 B T        -     0   0   95  537   72  TTT   T    T T  T T TT T TT T  TTTTTTTTTTTTTTTTRRTTT  T  T    K    TTR
   192  114 B F        +     0   0   56  580   32  FFF   F    F F  F F FF F FF F  FFFFFFFFFFFFFFFFFFFFF  F  F    F    FFF
   193  115 B R  B >   -U  196   0I  52  581   64  RRR   R    R R  R R RR R RR R  RRRRRRRRRRRRRRRRRRRRR  R  R    R    RRR
   194  116 B M  T 3  S+     0   0   29  564   77  MMM   M    M M  M M MM M MM M  MVMMMMMMMMERMMRRRRMTM  T  R    M    MMR
   195  117 B N  T 3  S+     0   0   13  572   89  NNN   N    N N  N N NN N NN N  NNNNNNNNNNNNNNNNNNNNN  N  N    N    NNN
   196  118 B V  B <   +U  193   0I   0  574   26  VVV   V    V V  V V VV V VV V  VVVVVVVVVVVVVVVVVVVVV  V  V    V    VVV
   197  119 B A        -     0   0    1  576   81  AAA   A    A A  A A AA A AA A  AAAAAAAAAAAAAAAAAAAAA  A  A    A    SSA
   198  120 B P        -     0   0    8  576   54  PPP   P    P P  P P PP P PP P  PPPPPPPPPPPPPPPPPPPPP  P  P    P    PPP
   199  121 B A        -     0   0    2  577   39  AAA   A    A A  A A AA A AA A  AAAAAAAAAAAAAAAAAAAAA  A  A    A    AAA
   200  122 B g  B     -g  290   0F   1  578   67  CCC   C    C C  C C CC C CC C  CCCCCCCCCCCCCCCCCCCCC  C  C    C    CCC
   201  123 B L        -     0   0   27  580    5  LLL   L    L L  L L LL L LL L  LLLLLLLLLLLLLLLLLLLLL  L  L    L    LLL
   202  124 B P        -     0   0    7  581   31  PPP   P    P P  P P PP P PP P  PPPPPPPPPPPPPPPPPPPPP  P  P    P    PPP
   203  124AB E     >  -     0   0   92  580   75  EEE   E    E E  E E EE E EE A  AEQQQQQEQEQQQEQQEEQEQ  E  Q    E    EEE
   204  125 B R  H  > S+     0   0  109  580   79  RRR   R    R R  R R RR R RR R  RKKKKKKKKKKKKKKKKKKKK  K  K    K    KKK
   205  126 B D  H  > S+     0   0  124  580   85  DDD   D    D D  D D DD D DD D  DDDDDDDDDDDDDDDDDDDND  N  D    D    DDD
   206  127 B W  H  >>S+     0   0    4  580   87  WWW   W    W W  W W WW W WW W  WWWWWWWWWWWWWWWWWWWWW  W  W    W    WWW
   207  128 B A  I  X>S+     0   0    0  580   75  AAA   A    A A  A A AA A AA A  AAAAAAAAAAAAAAAAAAAAA  A  A    A    AAA
   208  129 B E  I  <5S+     0   0   75  581   83  EEE   E    E E  E E EE E EE E  EEEEEEEEEEEEEEEEEEEEE  E  E    E    EEE
   209  130 B S  I  <5S+     0   0   70  582   65  SSS   S    S S  S S SS S SS S  SSSSSSSSSSASASSSAASAS  A  A    S    DDA
   210  131 B T  I  <5S+     0   0   18  104   77  TTT   T    T T  T T TT T TT T  TTTTTTTTTTTTTTTTTTTTT  T  T    T    IIV
   211  131AB L  I ><  S-     0   0  119  478   80  HHH   H    H H  H H HH H HH H  HHHHHHHHHHHHHHHHHHHHH  H  H    H    HHH
   227  146 B E  T 3  S+     0   0   47  513   76  EEE   E    E E  E E EE E EE E  EEEEEEEEEEEEEEEEEEEEE  E  E    E    EEE
   228  147 B K  T 3  S+     0   0  169  537   69  KKK   K    K K  K K KK K KK K  KMKKKKKKKKKMKKMKKKKRK  R  K    M    KKK
   229  149 B G  S <  S-     0   0   29  548   67  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   230  150 B R        -     0   0  213  557   86  RRR   R    R R  R R RR R RR R  RRRRRRRRRRRRRRRRRRRRR  R  R    R    RRR
   231  151 B Q  B     -V  224   0J  79  563   93  QQQ   Q    Q Q  Q Q QQ Q QQ Q  QLQQQQQAPPQLPTLPLLPPP  P  Q    P    PPT
   232  152 B S        -     0   0   14  569   51  SSS   S    S S  S S SS S SS S  SSSSSSSSSSSSSSSSSSSSS  S  S    S    SSS
   233  153 B T  S    S+     0   0   48  570   73  TTT   T    T T  T T TT T TT T  TPNNNNNTTAKTSTTTSSRSR  S  S    V    TTE
   234  154 B R  B    S-T  150   0H 102  570   86  RRR   R    R R  R R RR R RR T  TTIIIIIITTVTTTTITTTTT  T  T    T    VVT
   235  155 B L        -     0   0    3  578    3  LLL   L    L L  L L LL L LL L  LLLLLLLLLLLLLLLLLLLLL  L  L    L    LLL
   236  156 B K  E     -FH  98 221F  31  578   51  KKK   K    K K  K K KK K KK K  KKKKKKKKKKKKKKKKKKKKK  K  K    K    KKK
   237  157 B M  E     -FH  97 220F  18  579   94  MMM   M    M M  M M MM M MM I  IMMMMMMMMMMMMMMMMMMMM  M  M    M    MMM
   238  158 B L  E     - H   0 219F   4  580   42  LLL   L    L L  L L LL L LL L  LLLLLLLLMLMLLLLLLLMLM  L  L    L    LLL
   239  159 B E  E     - H   0 218F 107  580   72  EEE   E    E E  E E EE E EE E  EEEEEEEEEEEEEEEEEEEEE  E  T    E    EET
   240  160 B V  E     - H   0 217F   0  580   46  VVV   V    V V  V V VV V VV V  VVVVVVVVVVVVVVVVVVVVV  V  V    V    VVV
   241  161 B P  E     - H   0 216F  34  580   26  PPP   P    P P  P P PP P PP P  PPPPPPPPPPPPPPPPPPPPP  P  P    P    PPP
   242  162 B Y  E     -J  263   0F  36  581   45  YYY   Y    Y Y  Y Y YY Y YY Y  YYYYYYYYYYYYYYYYYYYYY  Y  Y    Y    YYF
   243  163 B V  E     -J  262   0F  24  582   35  VVV   V    V V  V V VV V VV V  VVVVVVVVVVVVVVVVVVVVV  V  V    V    VVV
   244  164 B D     >  -     0   0   88  581   58  DDD   D    D D  D D DD D DD D  DDDDDDDDDDDDDDDDDDDDD  D  D    D    EED
   245  165 B R  H  > S+     0   0   51  581   79  RRR   R    R R  R R RR R RR R  RRRRRRRRRRRRRRRRRRRRR  R  R    R    RRR
   246  166 B N  H  > S+     0   0  105  582   75  NNN   N    N N  N N NN N NN N  NNNNNNNNNNNNNNNNSSNNN  N  N    N    STN
   247  167 B S  H  > S+     0   0   48  582   78  SSS   S    S S  S S SS S SS T  TTTTTTTTTTTSTTSTTTTTT  T  T    T    TTT
   248  168 B j  H  X S+     0   0    1  582    2  CCC   C    C C  C C CC C CC C  CCCCCCCCCCCCCCCCCCCCC  C  C    C    CCC
   249  169 B K  H >< S+     0   0   88  582   73  KKK   K    K K  K K KK K KK K  KKKKKKKKKKRKKKKKKKKKK  K  K    K    KKK
   250  170 B L  H 3< S+     0   0  150  547   89  LLL   L    L L  L L LL L LL L  LLLLLLLLLLLLLLRLLLLLL  L  L    L    QQL
   251  171 B S  H 3< S+     0   0   23  578   76  SSS   S    S S  S S SS S SS S  SSSSSSSSSSSSSSSSSSSSS  S  S    S    SSS
   252  172 B S    <<  -     0   0   20  581   83  SSS   S    S S  S S SS S SS S  SSTTTTTSSSTSSSSSSSSSS  S  T    T    SSS
   253  173 B S  S    S+     0   0   79  581   83  SSS   S    S S  S S SS S SS S  SSSSSSSSSSSSSKSSSSSSS  S  G    R    SST
   254  174 B F  S    S-     0   0  124  581   79  FFF   F    F F  F F FF F FF F  FFFFFFFFFFFFFFFFFFFFF  F  F    F    FFF
   255  175 B I        -     0   0  100  582   88  III   I    I I  I I II I II T  TTSSSSSTSVSTTATTTTSLS  L  T    I    DDT
   256  176 B I        -     0   0   13  582   16  III   I    I I  I I II I II I  IIIIIIIIIIIIIIIIIIIII  I  I    I    IIV
   257  177 B T    >   -     0   0   16  582   36  TTT   T    T T  T T TT T TT T  TTTTTTTTTTTTTTTTTTTTT  T  T    T    TTT
   258  178 B Q  T 3  S+     0   0  133  582   68  QQQ   Q    Q Q  Q Q QQ Q QQ Q  QQQQQQQQQQQQQTQQPPQPQ  P  Q    S    PPS
   259  179 B N  T 3  S+     0   0   24  582   61  NNN   N    N N  N N NN N NN N  NNNNNNNNNNNNNNNNNNNNN  N  N    N    NNN
   260  180 B M  E <   - K   0 311F   2  582   11  MMM   M    M M  M M MM M MM M  MMMMMMMMMMMMMMMMMMMMM  M  M    M    MMM
   261  181 B F  E     - K   0 310F   8  581   34  FFF   F    F F  F F FF F FF F  FFFFFFFFFFFFFFFFFFFFF  F  F    F    FFF
   262  182 B j  E     +JK 243 309F   1  582    0  CCC   C    C C  C C CC C CC C  CCCCCCCCCCCCCCCCCCCCC  C  C    C    CCC
   263  183 B A  E     +JK 242 308F   0  582   27  AAA   A    A A  A A AA A AA A  AAAAAAAAAAAAAAAAAAAAA  A  A    A    AAA
   264  184 B G  S    S-     0   0    3  582   10  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   265  185 B Y        -     0   0   56  561   58  YYY   Y    Y Y  Y Y YY Y YY Y  YYYYYYYYYYYYYYYYYYYYY  Y  Y    Y    YYY
   266  185AB D  S    S-     0   0   81  565   84  DDD   N    H H  H H HH H HH E  EEEEEEEDDDDDDDDDDDDDD  D  N    D    DDE
   267  185BB T  S    S+     0   0   76  582   62  TTT   T    A A  A A AA A AA A  AAAAAAASSSAAAAATTTSES  E  D    S    SSS
   268  186 B K  S    S-     0   0  107  532   32  KKK   K    R R  K K KK K KK R  RRKKKKKKKNKRKKRNQQKQK  Q  K    K    RRI
   269  187 B Q  S    S+     0   0  102  537   37  QQQ   Q    Q Q  Q Q QQ Q QQ Q  QPLLLLLPPPQPLPPPPPPPP  P  L    I    PPS
   270  188 B E        +     0   0   33  581   54  EEE   E    E E  E E EE E EE E  EEEEEEEEEEEEEEEEEEEEE  E  E    E    EEE
   271  189 B D  B     -E   94   0E   7  582    3  DDD   D    D D  D D DD D DD D  DDDDDDDDDDDDDDDDDDDDD  D  D    G    DDD
   272  190 B A        -     0   0    7  582   42  AAA   A    A A  A A AA A AA A  AAAAAAAAAAAAAAAAAAAAA  A  T    A    AAA
   273  191 B k    >   -     0   0    7  582    0  CCC   C    C C  C C CC C CC C  CCCCCCCCCCCCCCCCCCCCC  C  C    C    CCC
   274  192 B Q  T 3  S+     0   0   90  582   25  QQQ   Q    Q Q  Q Q QQ Q QQ Q  QQQQQQQQQQQQQQQQQQQQQ  Q  Q    Q    QQE
   275  193 B G  T 3  S+     0   0    6  582    7  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   276  194 B D    X   +     0   0    0  582    0  DDD   D    D D  D D DD D DD D  DDDDDDDDDDDDDDDDDDDDD  D  D    D    DDD
   277  195 B S  T 3  S+     0   0   14  582    1  SSS   S    S S  S S SS S SS S  SSSSSSSSSSSSSSSSSSSSS  S  S    D    SSS
   278  196 B G  T 3  S+     0   0    0  582    0  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   279  197 B G    <   -     0   0    0  582    2  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   280  198 B P  E     - L   0 294F   1  582    3  PPP   P    P P  P P PP P PP P  PPPPPPPPPPPPPPPPPPPPP  P  P    P    PPP
   281  199 B H  E     -IL 219 293F   0  582   49  HHH   H    H H  H H HH H HH H  HHHHHHHHHHHHHHHHHHHHH  H  H    H    HHH
   282  200 B V  E     -IL 218 291F   3  582   27  VVV   V    V V  V V VV V VV V  VVVVVVVVVVVVVVVVVVVVV  V  V    V    VVV
   283  201 B T  E     - L   0 290F   0  582   67  TTT   T    T T  T T TT T TT T  TTTTTTTTTTTTTTTTTTTTT  T  T    T    TTT
   284  202 B R  E     + L   0 289F  99  582   70  RRR   R    R R  R R RR R RR R  RRRRRRRRRRRRRRRRRRRRR  R  R    R    KKK
   285  203 B F  E >  S- L   0 288F  22  582   70  FFF   F    F F  F F FF F FF F  FFFFFFFFFFFFFFFFFFFFF  F  F    F    YYY
   286  204 B K  T 3  S-     0   0   85  206   71  KKK   K    K K  K K KK K KK K  KKKKKKKKKKKRKKRKKKKRK  R  Q    K    KKK
   287  205 B D  T 3  S+     0   0  108  208   57  DDD   D    D D  D D DD D DD D  DNNNNNNDDDDDDDDDDDDDD  D  D    D    DDD
   288  206 B T  E <   - L   0 285F   3  218   75  TTT   T    T T  T T TT T TT T  TTTTTTTTTTTTTTTTTTTTT  T  T    T    TTT
   289  207 B Y  E     - L   0 284F  21  227   50  YYY   Y    Y Y  Y Y YY Y YY Y  YYYYYYYYYYYYYYYYYYYYY  Y  Y    Y    YYY
   290  208 B F  E     -gL 200 283F   0  582   91  FFF   F    F F  F F FF F FF F  FFYYYYYFFFFFFFFFFFFFF  F  Y    F    FFF
   291  209 B V  E     + L   0 282F   1  582   41  VVV   V    V V  V V VV V VV V  VVVVVVVVVVVVVVVVVVVVV  V  V    I    VVV
   292  210 B T  E     +     0   0F   1  582   84  TTT   T    T T  T T TT T TT T  TTTTTTTTTTTTTTTTTTTTT  T  T    T    TTT
   293  211 B G  E     -ML 312 281F   0  582    0  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   294  212 B I  E     -ML 311 280F   0  582   19  III   I    I I  I I II I II I  IIIIIIIIIIIIIIIIIIIII  I  I    I    III
   295  213 B V  E     +M  310   0F   7  582   14  VVV   V    V V  V V VV V VV I  VVVVVVVVVVVVVVVVVVVVV  V  V    I    VVV
   296  214 B S  E     -     0   0F   1  581    0  SSS   S    S S  S S SS S SS S  SSSSSSSSSSSSSSSSSSSSS  S  S    S    SSS
   297  215 B W  E     -M  309   0F  45  582    8  WWW   W    W W  W W WW W WW W  WWWWWWWWWWWWWWWWWWWWW  W  W    W    WWW
   298  216 B G        -     0   0   26  582    0  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   299  217 B E  S    S-     0   0   25  577   90  EEE   E    E E  E E EE E EE E  EEEEEEEEEEEEEEEEEEEEE  E  E    E    EEE
   300  218 B G  S    S-     0   0   19  580   15  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   301  220 B k  S    S-     0   0    7  582    2  CCC   C    C C  C C CC C CC C  CCCCCCCCCCCCCCCCCCCCC  C  C    C    CCC
   302  221 B A  S    S+     0   0    4  581   17  AAA   A    A A  A A AA A AA A  AAAAAAAAAAAAAAAAAAAAA  A  A    A    AAA
   303  222 B R    >   -     0   0  105  578   74  RRR   R    R R  R R RR R RR R  RRRRRRRRRRRRRQRRRRRRR  R  R    R    QQR
   304  223 B K  T 3  S+     0   0  152  578   65  KKK   K    K K  K K KK K KK K  KKKKKKKKKKKKKKKKKKKRK  R  K    K    NNK
   305  223AB G  T 3  S+     0   0   26  582   58  GGG   G    G G  G G GG G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   306  224 B K    <   -     0   0   43  582   85  KKK   K    K K  K K KK K KK K  KKKKKKKKKKKKKKKKKKKKK  K  K    K    KKK
   307  225 B Y        -     0   0   33  582   49  YYY   Y    Y Y  Y Y YY Y YY Y  YYYYYYYYYYYFYYFYFFYYY  Y  F    F    FFY
   308  226 B G  E     -K  263   0F   4  580    2  GGG   G    G G  G G .  G GG G  GGGGGGGGGGGGGGGGGGGGG  G  G    G    GGG
   309  227 B I  E     -KM 262 297F   6  581   10  III   I    I I  I I I  I II I  IIIIIIIVIVIVVVVVVVVVV  V  I    V    VVI
   310  228 B Y  E     -KM 261 295F   1  581    2  YYY   Y    Y Y  Y Y Y  Y YY Y  YYYYYYYYYYYYYYYYYYYYY  Y  Y    Y    YYY
   311  229 B T  E     -KM 260 294F   2  581   40  TTT   T    T T  T T T  T TT T  TTTTTTTTTTTTTTTTTTTTT  T  T    T    TTT
   312  230 B K  E >   - M   0 293F  21  581   40  KKK   K    K K  K K K  K KK K  KKKKKKKKKKKKKKKKKKKKK  K  K    K    KKK
   313  231 B V  G >  S+     0   0    1  581    8  VVV   V    V V  V V V  V VV V  VVVVVVVVVVVVVVVVVVVVV  V  V    V    AAV
   314  232 B T  G 3  S+     0   0    2  579   72  TTT   T    T T  T T T  T TT S  STTTTTTTTTTSTTSTSSTTT  T  T    T    AAT
   315  233 B A  G <  S+     0   0   29  579   80  AAA   A    A A  A A A  A AA G  GATTTTTSNSANANNNNNNNN  N  N    N    TTA
   316  234 B F  S <> S+     0   0    7  575   36  FFF   F    F F  F F F  F FF F  FFFFFFFFFFFFFFFFFFFFF  F  F    F    FFY
   317  235 B L  H  > S+     0   0   23  573   81  LLL   L    L L  L L L  L LL L  LLLLLLLLLLLLLLLLLLLLL  L  L    L    LLL
   318  236 B K  H  > S+     0   0  116  572   68  KKK   K    K K  K K K  K KK K  KKKKKKKKKKKKKKKKKKKKK  K  K    N    SSG
   319  237 B W  H  > S+     0   0   26  572    1  WWW   W    W W  W W W  W WW W  WWWWWWWWWWWWWWWWWWWWW  W  W    W    WWW
   320  238 B I  H  X S+     0   0    1  569   12  III   I    I I  I I I  I II I  IIIIIIIIIIIIIIIIIIIII  I  I    I    III
   321  239 B D  H  < S+     0   0   66  541   72  DDD   D    D D  D D D  D DD D  DNDDDDDDDDDEDDEDDDDED  E  E    E    KKK
   322  240 B R  H >< S+     0   0  136  528   71  RRR   R    R R  R R R  R RR R  RRRRRRRRRRRKKRKKKKKRK  R  K    R    RRR
   323  241 B S  H >< S+     0   0    6  495   71  SSS   S    S S  S S S  S SS S  SSSSSSSCSSSSSSSSIISSS  S  S    S    MMS
   324  242 B M  T 3< S+     0   0   25  452   39  MMM   M    M M  M M M  M MM M  MMMMMMMMMMMMMMMMMMMMM  M  M    M    MMM
   325  243 B K  T <  S+     0   0  153  418   69  KKK   R    K K  K K K  K KK K  KKKKKKKKKKKRRKRRKKRRR  R  R    K    RRR
   326  244 B T    <         0   0   51  369   66  TTT   T    T T  T T T  T TT T  TTAAAAATAAAAAAAAAAGAG  A  A         QQT
   327  245 B R              0   0  197  260   47  RRR   R    R R  R R R  R RR R  RQRRRRRKRRRRKKRRRRRRR  R  K         KKK
## ALIGNMENTS   71 -  140
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1   49 A Q              0   0  101  253   29  Q Q  Q  Q QQQQQ QQQQQQQQQ QQQQQQQQQQQQQQQQQQQ    QQQQ  Q  QQQQQ  QQQQQ
     2   50 A a    >   +     0   0   22  341    0  C C  C  C CCCCC CCCCCCCCC CCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
     3   51 A E  T 3  S+     0   0  187  342   77  E E  E  E KLQSS SSSSSSSSS SSEESTTTASSDEEEETSDLL  SSADLLALLAAAAA  AAAAA
     4   52 A T  T 3  S-     0   0  105  342   54  N S  T  T SSSSS SSSSSSSSS SSSDSTTTSSSSPPPPTSSTT  SSSSTTSTTSSSSS  SSSSS
     5   53 A S    <   +     0   0   89  342   62  N Q  Q  Q NNNNN NNNNNNNNN NNNSNNNNNNNSQQQQNNSNN  NNNSNNSNNSSSSS  SNSSN
     6   54 A P        +     0   0   10  343   18  P P  P  P PPPPP PPPPPPPPP PPPPPPPPPPPPPPPPPPPPP  PPPPPPPPPPPPPP  PPPPP
     7   55 A b        -     0   0   18  344    0  C C  C  C CCCCC CCCCCCCCC CCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
     8   56 A Q  S    S+     0   0   92  343   70  Q Q  Q  Q QHQHH HHHHHHHHH HHLLHVVVQHHQAAAAVHQRR  HHQQRRQKKQQQQQ  QQQQQ
     9   57 A N  S    S-     0   0   63  303   24  N N  N  N YYYYY YYYYYYYYY YYNNY...NYYNNNNN.YNNN  YYNNNNNNNNNNNN  NNNNN
    10   58 A Q  S    S-     0   0  152  336   48  Q H  Q  Q GGGGG GRRRRGRRG GRGQRHHHGRHGDDDDHHGNN  RRGGNNGNNGGGGG  GGGGG
    11   59 A G        -     0   0   16  344   17  G G  G  G GGGGG GGGGGGGGG GGGGGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGG  GGGGG
    12   60 A K  E     -A   23   0A 117  344   75  N D  V  V STSHQ TITTIHTIT TTMSTKKKSTTSTTTTKTSTT  TTSSTTSTTSSSSS  SSSSS
    13   61 A a  E     -A   22   0A  45  344    0  C C  C  C CCCCC CCCCCCCCC CCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
    14   62 A K  E     -A   21   0A 155  344   82  K K  K  K KKNKK KKKKKKKKK KKKRKVVVEKKDLLLLVKDVV  KKEDVVKIIKEKKK  KEKKE
    15   63 A X  E     +A   20   0A 120  302   29  D D  D  D DDDDD DDDDDDDDD DDDDDDDDDDDDDDDDDDD..  DDDD..D..DDDDD  DDDDD
    16   64 A G        -     0   0   44  341   74  G G  G  G GGGGG GGGGGGGGG GGDGGLLLQGGQLLLLLGQYY  GGQQYYQYYQQQQQ  QQQQQ
    17   65 A L  S    S-     0   0  152  342   69  L V  L  L IIIIL IIIIILIII IIILILLLLIIFIIIILIFLL  IILFLLLLLLLLLL  LILLL
    18   66 A G  S    S+     0   0   67  343   62  G G  G  A NGNGG GGGGGGGGG GGNGGQQQQGGQGGGGQGQaa  GGQQaaQggQRQQQ  QQQQQ
    19   67 A E        -     0   0  119  329   61  E E  E  E ESESS SSSSSSSSS SSSESDDDSSSDGGGGDSDss  SSSDssSssSSSSS  SSSSS
    20   68 A Y  E     -A   15   0A  37  342    9  Y Y  Y  Y YYYYY YYYYYYYYY YYYYYFFFYYYYFFFFFYYYY  YYYYYYYYYYYYYY  YYYYY
    21   69 A T  E     -A   14   0A  71  343   83  T T  T  T TTTTT TTTTTTTTT TTETTSSSITTVQQQQSTVYY  TTIVYYIIIIIIII  IIIII
    22   70 A b  E     -A   13   0A  20  343    0  C C  C  C CCCCC CCCCCCCCC CCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
    23   71 A T  E     -A   12   0A  85  344   80  I S  L  L FTLTS TTTTTSTTT TTWTTTTTFTTRFFFFTTRLL  TTFRLLFQQFFFFF  FFFFF
    24   72 A c        -     0   0   44  344    1  C C  C  C CCCCC CCCCCCCCC CCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
    25   73 A L    >   -     0   0   62  344   86  M M  S  S NLNLL LLLLLLLLL LLLPLDDDLLLPPPPPDLPSS  LLPPSALYSLPLLL  LLLLP
    26   74 A E  T 3  S+     0   0  177  344   74  E E  A  A PAADD SSFSSDFSP APADPSSSDPPPEEEESPPEE  PPEPEEPEEPDPPP  PAPPE
    27   75 A G  T 3  S+     0   0   29  344   24  G G  G  G GGGGG GGGGGGGGN GNGGNGGGGNNEEEEEGNEGG  NNDEGGAGGAGAAA  ADAAD
    28   76 A F  E <   +B   36   0B  40  343   16  Y Y  Y  Y FYFYY YYYYYYYYY YYFFYFFFFYYYRRRRFYYYY  YYFYYYFFFFFFFF  FFFFF
    29   77 A E  E     +B   35   0B  74  343   63  E E  E  E EEEQQ EEEEEQEEE EEEEDEEEEEEEDDDDEEEEE  EEEEEEEEEEEEEE  EEEEE
    30   78 A G  S >  S-     0   0   32  343    1  G G  G  G GGGGG GGGGGGGGG GGGGGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGG  GGGGG
    31   79 A K  T 3  S+     0   0  156  343   72  K K  K  K KKKKK KKKKKKKKK KKKRKKKKRKKKSSSSKKKKK  KKRKKKRKKRRRRR  RRRRR
    32   80 A N  T 3  S-     0   0   33  343   62  N N  N  N NNNNN NNNNNNNNN NNNNNHHHNNNSRRRRHNSYY  NNNSYYNYYNNNNN  NNNNN
    33   81 A c  S <  S+     0   0    1  344    0  C C  C  C CCCCC CCCCCCCCC CCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
    34   82 A E        +     0   0   87  342   30  e e  d  d eeeeE eeeeeeeee qeeeeDDDeeeeqqqqDeeee  eeeeeeeqqeeeee  eeeee
    35   83 A L  E    S-B   29   0B  96  289   42  l a  v  v lllvF lllllvlll llqllLLLllllllllLllll  llllllllllllll  lllll
    36   84 A F  E     -B   28   0B 139  292   93  T Y  K  K QLQIV YYYYYIYYF YFDcYrrrIFFKVVVVrFKEE  YYIKEEIKKIIIII  IIIII
    37   85 A T        -     0   0   44   76   76  . .  .  . ....I ......... ...l.ttt........t..EE  ....EE........  .....
    38   86 A R        +     0   0   57  101   88  . .  .  . ...PP .....P... ...S.AAA....AAAVA..TT  ....TT........  .....
    39   87 A K        +     0   0   96  140   78  . .  .  . .K.KK KKKKKKKKK QEASETTT.KK.TTTTTK.LL  QQ..LL........  .....
    40   88 A L        -     0   0   91  168   91  L .  I  I LSLFY SSSSSYSSS SSRESNNN.SS.NNNNNS.KK  SS..KK........  .....
    41   89 A d  S  > S+     0   0   15  238   19  C C  C  C CCCCC CCCCCCCCC CCCNCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
    42   90 A S  T  4 S+     0   0   98  244   86  S S  S  S SRSKK RRRRRKRRR RRSSRSSSMRRISSSSSRIQQ  RREIQQVLLVAVVV  VMMVE
    43   91 A L  T >4 S-     0   0  120  274   90  L L  L  L LVLII VVVVVIVVF VVIEVLLLNAAYTTTTLAYYY  VVNYYYNYYNNNNN  NYNNN
    44   92 A D  G >4 S-     0   0  107  297   62  D D  N  N NDNNN DDDDDNDDF DFKFDNNNNFFDEEEENFDVV  DDDDVVELLEDEEE  EEEED
    45   93 A N  G >< S-     0   0    8  315   63  N N  N  N NNNNN NNNNNNNNN NNNPNNNNNNNNYYYYNNNNN  NNNNNNNNNNNNNN  NNNNN
    46   94 A G  G <  S-     0   0    0  316   53  G G  G  G GGGGG GGGGGGGGG GGGQGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGG  GGGGG
    47   95 A D  G <  S+     0   0   44  344   60  E E  D  D DNEDD DNNNNDNNN NNRGNDDDDNNGYYYYDNGGG  NNGGGGGGGGGGGG  GGGGG
    48   96 A e    <   -     0   0    0  344    1  C C  C  C CCCCC CCCCCCCCC CCCPCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
    49   97 A D  S    S-     0   0   59  344   73  D D  E  E DWDEE WWWWWEWWW WWKVWDDDEWWEEEEEDWEEE  WWDEEEEEEEEEEE  EEEED
    50   98 A Q  S    S+     0   0    2  344   62  Q Q  Q  Q QHQQQ HHHHHQHHH HHQsHHHHQHHQHHHHHHQQQ  HHQQQQQQQQQQQQ  QQQQQ
    51   99 A F  E     -C   62   0C   4  344   77  F F  F  F FFYFF FFFFFFFFF FFFnFDDDYFFYFFFFDFYFF  FFYYFFYFFYYYYY  YYYYY
    52  100 A d  E     +C   61   0C  10  344    0  C C  C  C CCCCC CCCCCCCCC CCCGCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
    53  101 A H  E     -C   60   0C  68  344   86  K K  K  K KKKSS KKKKKSKKK KKKDKHHHSKKAHHHHHKADD  KKSADDSDDSGSSS  SSSSS
    54  102 A E  E     -C   59   0C  92  344   56  E E  S  S VPAVI PHPPSIPHP PSTCSEEEDRRDEEEEERDGG  RRNDGGDGGDADDD  DDDDN
    55  103 A E  S    S-     0   0  100  344   81  E A  V  V VVVqk VVVVVkVVV VVgdVsssHVVQiiiisVEss  VVhEssHssHDHHH  HHHHh
    56  104 A Q  S    S-     0   0  175  310   77  K K  V  V DQDdv QQQQQlQQQ QQdcQdddaQQqdddddQq..  QQeq..t..tpttt  tvtte
    57  105 A N  S    S+     0   0  154  307   78  S N  N  N RNRkk NNNNNkNNN NNGeNlllaSSennnnlSeaa  SSAeaatwwtattt  asatA
    58  106 A S  S    S-     0   0   58  337   71  T T  T  T FDDDD GDDDDDDDD EEKsEAAAREEKRRRRAEKRR  EEKKRRKKKKGKKK  KQKKK
    59  107 A V  E     -C   54   0C   7  343   86  V V  V  V ITVVV IIIIIVIIT IIVVVRRRRTTRRRRRRTRRR  TTRRRRRRRRRRRR  RRRRR
    60  108 A V  E     -C   53   0C  45  344   87  V V  V  V VQVLV QQQQQMQQQ QQVVQTTTSQQVKKKKTQVSS  QQSVSSSKKSFSSS  SSSSF
    61  109 A e  E     +C   52   0C   5  344    0  C C  C  C CCCCC CCCCCCCCC CCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
    62  110 A S  E     -C   51   0C  24  344   70  S S  S  S SSSSS SSSSSSSSS SSSSSSSSWSSFSSSSSSFSS  SSWFSSRAARWRRR  RRQRR
    63  111 A f        -     0   0   23  344    0  C C  C  C CCCCC CCCCCCCCC CCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
    64  112 A A    >   -     0   0    8  344   70  A A  A  A TATAT AAAAATAAA AATAAIIIHAAAAAAAIAAAA  AAHAAAHAAHHHHH  HHHHH
    65  113 A R  T 3  S+     0   0  149  344   83  S K  Q  Q NENDS EEEEESEEE EETREKKKEEEEKKKKKEEEE  EEEEEEEPPEEEEE  EEEEE
    66  114 A G  T 3  S+     0   0   24  344   13  G G  G  G GGGGG SGGGGGGGS SSGGSGGGGSSGGGGGGSGGG  SSGGGGGGGGGGGG  GGGGG
    67  115 A Y  E <   -D   78   0D  20  344    7  Y Y  Y  Y YYYYY YYYYYYYYY YYYYYYYYYYYYYYYYYYYYY  YYYYYYYYYYYYYY  YYYYY
    68  116 A T  E     -D   77   0D  72  343   81  I I  I  I VRIVE LLLLLELLR LRRTRQQQTLRTNNNNQRAAA  RRTAAASVASASSS  STSST
    69  117 A L  E     -D   76   0D  67  340   68  L L  L  L LLLLL LLLLLLLLL LLLLLLLLLLLLLLLLLLLLL  LLLLLLLLLLLLLL  LLLLL
    70  118 A A    >   -     0   0   23  340   78  G G  G  G GGGAA GGGGGAGGG GGAGGQQQQGGASSSSQGAAA  GGQAAALGGLQLLL  LLLLQ
    71  119 A D  T 3  S+     0   0  175  340   77  D D  D  D EDEEE EEEEEEEED DDEDDDDDAVVSDDDDDVSDD  VVASDDAEEAAAAA  APAAA
    72  120 A N  T 3  S-     0   0   92  340   74  D D  D  D NNNDD DDDDDDDDD DDDDDNNNNDDDNNNNNDDDD  DDDDDDDDDDDDDD  DNDDD
    73  121 A G  S <  S+     0   0   16  340   56  G G  Q  Q GGGGG GGGGGGGGG GGQGGSSSGGGGGGGGSGGGG  GGGGGGGRKGGGGG  GGGGE
    74  122 A K  S    S+     0   0   71  332   83  K K  K  K KFKKK HHHHHKHHH YHKKRRRRVHHVFFFFRHVTT  HHVVTTVKKVVVVV  VVVVV
    75  123 A A        -     0   0   22  330   70  S S  S  S SSSQQ SSSSSQSSS SSSSSKKKSSSSAAAAKSSSS  SSSSSSSSSSSSSS  SSSSS
    76  124 A f  E     -D   69   0D  12  300   48  C C  C  C CCCCC CCCCCCCCC CCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
    77  125 A I  E     -D   68   0D  78  304   82  I I  I  I IILVV VVVVVVVVV VVEVVATTTVVINNNNTVIVV  VVAIVVTIITATTT  TTTTA
    78  126 A P  E     -D   67   0D  62  304   56  P P  P  P PAPAS AAAAASAAA AAPSAPPPPAAPPPPPPAPSS  AAPPSSPAAPPPPP  PPPPP
    79  127 A T  S    S+     0   0  103  304   79  T T  T  T TETTK GGGGGKGGE GEATEKKKTEEQTTTTKEQQQ  EETQQQTQQTTTTT  TTTTT
    80  128 A G  S    S-     0   0   32  305   75  E E  V  V DGEVV GGGGGVGGG GGVEGNNNVGGVGGGGNGVVV  GGVVVVVVVVVVVV  VVVVV
    81  129 A P  S    S+     0   0  116  311   78  P P  P  P KEKKK DNNNNKNND DDPPDDDDEDDKNNNNDDKDD  DDEKDDEQQEEEEE  EDEEE
    82  130 A Y  S    S+     0   0   59  312   77  Y Y  F  F YFYYY FFFFFYFFF FFFFFAAAYFFYYYYYAFYYY  FFYYYYYYYYYYYY  YYYYY
    83  131 A P    >   -     0   0   17  312   34  P P  P  P SSSPP SSSSSPSSS SSPPSSSSPSSPSSSSSSPPP  SSPPPPPPPPPPPP  PPPPP
    84  132 A g  T 3  S+     0   0   16  323    2  C C  C  C CCCCC CCCCCCCCC CCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCC  CCCCC
    85  133 A G  T 3  S+     0   0    0  295   30  G G  G  G GGGGG GGGGGGGGG GGGGGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGG  GGGGG
    86  134 A K    <   -     0   0   69  294   62  K K  K  K RRRKK RRRRRKRRR RRRKRQQQKRRKRRRRQRTKK  RRKTKQKKKKKKKK  KKKKK
    87  135 A Q        -     0   0   37  243   74  Y E  L  L RNRVV NNNNNVNNN NNVQNIIIINNIHHHHINIII  NNIIIIIAAIIIII  I III
    88  136 A T        +     0   0    4  220   79  T T  T  T HIHSL IIIIILIII IISIIRRRPIIPKKKKRIPPP  IIPPPPPPPPPPPP  P PPP
    89  137 A L        +     0   0  105  200   57  V L  V  V MKMVM KKKKKVKKK KKVLKIIIVKKVLLLLIKVVV  KKVVVVILLIVIII  I IIV
    90  138 A E              0   0  104  120   71  D E  G  G RSKVK TTTTTKTTA AASGAPQP AA AAAAPA QQ  AA  QQ EE            
    91  139 A R              0   0  231   97   28  R R  R  R RRRRR RRRRRRRRR RR RRKKK RR     KR KK  RR  KK               
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3   I II I  V               I                     VV              IV     
    94   17 B V  B     -E  271   0E   7  561    9   V VV V  V     I         V                     VV              VV     
    95   18 B G  S    S+     0   0   25  562    6   G GG G  G     N         G                     GG              GG     
    96   19 B G  S    S-     0   0   26  563    0   G GG G  G     G         G                     GG              GG     
    97   20 B Q  E     -F  237   0F  98  564   95   R RD D  R     Q         T                     EE              EE     
    98   21 B E  E     -F  236   0F  80  565   65   D DE E  D     D         E                     DN              ND     
    99   22 B h        -     0   0    8  565   58   C CC C  C     C         C                     AA              AA     
   100   23 B K    >   -     0   0  123  564   79   N KK L  R     P         P                     KK              KA     
   101   24 B D  T 3  S+     0   0   60  565   85   D DL P  P     P         K                     PP              PR     
   102   25 B G  T 3  S+     0   0    0  565   73   G GG G  G     G         G                     GG              GG     
   103   26 B E  S <  S+     0   0   36  565   67   E EE Q  E     Q         E                     QQ              QQ     
   104   27 B h    >   +     0   0    4  565   91   C CC C  C     C         C                     FI              FF     
   105   28 B P  T 3   +     0   0    0  567    9   P PP P  P     P         P                     PP              PP     
   106   29 B W  T 3  S+     0   0    5  568   27   W WW W  W     W         W                     WW              WW     
   107   30 B Q  E <   -N  122   0G   7  569   24   Q QQ qQ Q     Q         Q                     QQ              QQ     
   108   31 B A  E     -NO 121 146G   1  559   47   A .A vA A     A         V                     VV              .V     
   109   32 B L  E     -NO 120 145G   3  567   65   L .V LV L     L         L                     LI              VL     
   110   33 B L  E     -NO 119 144G   0  570   11   L .L LL L     L         L                     LL              LL     
   111   34 B I  E     -NO 117 143G   0  570   81   I .I NL V     I         L                     NN              LH     
   112   35 B N  E >   - O   0 142G  30  570   88   K .N EN S     N         H                     GG              NG     
   113   36 B E  T 3  S+     0   0   63  113   77   E .E .E E     E         K                     ..              G.     
   114   37 B E  T 3  S-     0   0  136  242   76   N .K EE E     D         G                     EE              KE     
   115   38 B N  S <  S+     0   0   84  543   52   N .E GG N     S         K                     TI              VI     
   116   39 B E        -     0   0  100  561   93   E .E EE E     I         .                     EE              EA     
   117   40 B G  E     +N  111   0G  14  572   55   G .E EE G     G         A                     AA              AA     
   118   41 B F  E     +     0   0G  28  581   35   F .F FF F     F         F                     FF              FF     
   119   42 B i  E     -N  110   0G   0  578    1   C .C CC C     C         C                     CC              CC     
   120   43 B G  E     -N  109   0G   1  581    2   G .G GG G     G         G                     GG              GG     
   121   44 B G  E     -N  108   0G   0  581    9   G .G GG G     G         G                     GG              GG     
   122   45 B T  E     -NP 107 130G   0  581   43   T .T TT T     T         V                     SA              SS     
   123   46 B I  E     + P   0 129G   0  581   23   I .I II I     I         I                     II              II     
   124   47 B L        -     0   0    6  581   27   L .L LL L     V         Y                     VI              IV     
   125   48 B S  S    S-     0   0   22  581   57   N .N NN S     S         K                     NN              NN     
   126   49 B E  S    S+     0   0   99  581   62   E .E EE K     E         P                     EE              EE     
   127   50 B F  S    S+     0   0   42  581   82   F .D NN D     Y         T                     KK              KK     
   128   51 B Y  E     - Q   0 185G   7  581   33   Y .F FF F     I         W                     WW              WW     
   129   52 B I  E     -PQ 123 184G   0  581   14   I .I II I     I         I                     II              VV     
   130   53 B L  E     +PQ 122 183G   0  581   28   L .L LL L     L         L                     VV              VV     
   131   54 B T  E     - Q   0 182G   0  581   43   T .T TT T     T         T                     TT              TT     
   132   55 B A    >>  -     0   0    0  581    2   A .A AA A     A         A                     AA              AA     
   133   56 B A  G >4 S+     0   0    0  581    8   A .A AA A     A         S                     AA              AA     
   134   57 B H  G >4 S+     0   0    7  581    0   H .H HH H     Q         H                     HH              HH     
   135   58 B i  G X4 S+     0   0    0  581    2   C .C CC C     C         C                     CC              CC     
   136   59 B L  G << S+     0   0   31  581   65   L .I II M     V         M                     IL              II     
   137   60 B Y  G <  S+     0   0  109  581   87   D .N NN N     A         E                     LK              KK     
   138   61 B Q  S <  S+     0   0   95  581   78   Q .Q QQ Q     Q         d                     PP              PP     
   139   61AB A        -     0   0   16  352   75   A .S TT T     T         v                     GG              DG     
   140   62 B K  S    S-     0   0  172  366   75   K .K KK K     R         R                     ID              DV     
   141   63 B R  S    S-     0   0  162  570   78   L .E EE Y     H         F                     KK              NK     
   142   64 B F  E     -O  112   0G  36  577   54   F .I II F     L         L                     II              II     
   143   65 B K  E     -O  111   0G  67  577   78   K .K NK K     K         E                     EE              TT     
   144   66 B V  E     -OR 110 161G   0  577   16   V .V VV V     L         V                     VV              VV     
   145   67 B R  E     -OR 109 160G  40  577   53   R .V VV T     R         I                     VV              VV     
   146   68 B V  E     +OR 108 159G   1  578   43   V VV VV V     L         A                     AA              AA     
   147   69 B G  S    S+     0   0    9  578   14   A SG GG G     G         G                     GG              GG     
   148   70 B D        +     0   0   11  579   58   A DE EE E     V         E                     KE              EE     
   149   71 B R  S    S+     0   0   24  579   73   L RV VV L     S         H                     HH              YH     
   150   72 B N  B >   -T  234   0H  18  579   65   . ND DD N     N         N                     NN              NN     
   151   73 B T  T 3  S+     0   0   56  579   79   . TR RR R     T         T                     II              IT     
   152   74 B E  T 3  S-     0   0  119  579   84   . EE EE E     S         E                     ED              QE     
   153   75 B Q  S <  S-     0   0  130  578   86   . KK KK .     H         V                     KE              EK     
   154   76 B E        +     0   0  165  578   85   . EE KK .     S         L                     KK              TP     
   155   77 B E        -     0   0   93  438   29   . DE EE T     G         E                     EE              EE     
   156   78 B G  S    S+     0   0   46  547   33   . GH QQ R     G         G                     DD              NP     
   157   79 B G  S    S+     0   0   47  555   76   . NS SS E     N         T                     TT              TT     
   158   80 B E        -     0   0   37  444   33   . EE EE G     E         E                     EE              EE     
   159   81 B A  E     -R  146   0G  27  457   60   . MT SS T     A         Q                     QQ              QQ     
   160   82 B V  E     -R  145   0G  71  557   81   . VT MM A     L         R                     RR              KK     
   161   83 B H  E     -R  144   0G  14  567   77   . HH HH H     H         L                     RR              RR     
   162   84 B E        -     0   0   90  569   77   . ET TT R     V         Q                     NN              NN     
   163   85 B V  E     -S  186   0G  27  574   64   . VA VV V     A         V                     VV              VV     
   164   86 B E  E    S+     0   0G  70  575   73   . EE DD E     D         S                     TI              II     
   165   87 B V  E     -S  185   0G  13  576   72   . VK KK K     A         Q                     QR              RR     
   166   88 B V  E     -S  184   0G  72  577   45   . II II I     I         V                     IT              IA     
   167   89 B I  E     +S  183   0G  27  578   45   . VF LI I     V         I                     II              II     
   168   90 B K  E     -S  182   0G  68  578   82   . KV VV I     T         T                     LP              PP     
   169   91 B H    >   -     0   0   19  579   14   . HH HH H     H         H                     HH              YY     
   170   92 B N  T 3  S+     0   0  156  579   60   . KS SS P     H         Q                     HH              HH     
   171   93 B R  T 3  S+     0   0  150  576   74   . GK KK K     G         N                     SQ              KG     
   172   94 B F    <   -     0   0   24  579    5   . FY FF F     Y         Y                     YY              YY     
   173   95 B T     >  -     0   0   56  579   67   . DI ID V     S         S                     nn              nn     
   174   96 B K  T  4 S+     0   0  145  525   79   . NA AA K     P         K                     fi              ii     
   175   97 B E  T  4 S+     0   0  174  533   92   . KE EE L     Q         T                     NN              NN     
   176   98 B T  T  4 S-     0   0   44  561   58   . TT TT T     T         T                     KK              KK     
   177   99 B Y    ><  +     0   0   60  566   66   . YY YY Y     Y         V                     YY              YY     
   178  100 B D  T 3   +     0   0   25  578   38   . ND DD D     S         D                     SS              NS     
   179  101 B F  T 3  S+     0   0   21  558   68   . CN NN Y     N         H                     HH              HH     
   180  102 B D    <   +     0   0    1  577    0   . DD DD D     D         D                     DD              DD     
   181  103 B I        +     0   0    0  579   14   . II II M     V         V                     II              II     
   182  104 B A  E     -QS 131 168G   0  579   60   . AA AA A     A         A                     AA              AA     
   183  105 B V  E     -QS 130 167G   0  580   15   . VL LL V     L         L                     LL              LL     
   184  106 B L  E     -QS 129 166G   0  581   30   L LI LL I     V         L                     LL              LL     
   185  107 B R  E     -QS 128 165G  40  581   42   K KK KK K     K         R                     EE              EE     
   186  108 B L  E     - S   0 163G   0  581   17   L LL LL L     L         L                     LL              LL     
   187  109 B K  S    S+     0   0  101  581   69   K KK KK K     A         A                     DD              DD     
   188  110 B T  S    S-     0   0   82  582   74   T TE EE D     T         G                     KK              KE     
   189  111 B P        -     0   0   48  582   39   P PP PP S     P         P                     PP              PP     
   190  112 B I        -     0   0    4  532   62   I II II I     I         V                     LL              LL     
   191  113 B T        -     0   0   95  537   72   K KQ RR N     R         R                     SI              TE     
   192  114 B F        +     0   0   56  580   32   F FF FF F     F         Y                     LL              LL     
   193  115 B R  B >   -U  196   0I  52  581   64   R RS SS T     T         S                     NN              NN     
   194  116 B M  T 3  S+     0   0   29  564   77   M ME EE Q     R         T                     SS              SS     
   195  117 B N  T 3  S+     0   0   13  572   89   N NY YY N     Y         Y                     YY              YY     
   196  118 B V  B <   +U  193   0I   0  574   26   V VV VV I     I         A                     VV              VV     
   197  119 B A        -     0   0    1  576   81   A AV II I     L         V                     TT              TT     
   198  120 B P        -     0   0    8  576   54   P PP PP P     P         P                     PP              PP     
   199  121 B A        -     0   0    2  577   39   A AA AA A     A         A                     II              II     
   200  122 B g  B     -g  290   0F   1  578   67   C CC CC C     C         C                     CC              CC     
   201  123 B L        -     0   0   27  580    5   L LL LL I     L         L                     IV              II     
   202  124 B P        -     0   0    7  581   31   P PP PP S     P         P                     AA              AA     
   203  124AB E     >  -     0   0   92  580   75   E EQ KK D     E         T                     NN              ND     
   204  125 B R  H  > S+     0   0  109  580   79   K KA AA P     Q         R                     RK              RR     
   205  126 B D  H  > S+     0   0  124  580   85   D DD DD D     D         R                     EE              EE     
   206  127 B W  H  >>S+     0   0    4  580   87   W WF FF F     F         L                     YY              YY     
   207  128 B A  I  X>S+     0   0    0  580   75   A AA AA A     M         A                     TT              TT     
   208  129 B E  I  <5S+     0   0   75  581   83   E EN NN D     E         E                     NN              NN     
   209  130 B S  I  <5S+     0   0   70  582   65   S SE EE Q     K         R                     II              II     
   210  131 B T  I  <5S+     0   0   18  104   77   T TV VV V     V         E                     ..              ..     
   211  131AB L  I ><  S-     0   0  119  478   80   H HF FY H     l         S                     FF              FF     
   227  146 B E  T 3  S+     0   0   47  513   76   E EE ED E     G         E                     SN              NN     
   228  147 B K  T 3  S+     0   0  169  537   69   M MA GG R     E         K                     QK              RR     
   229  149 B G  S <  S-     0   0   29  548   67   G GG GG G     G         G                     GG              GG     
   230  150 B R        -     0   0  213  557   86   R RR RQ H     Q         P                     RR              RR     
   231  151 B Q  B     -V  224   0J  79  563   93   R TL TL Q     P         T                     TQ              QS     
   232  152 B S        -     0   0   14  569   51   S SS SP A     S         S                     AA              AA     
   233  153 B T  S    S+     0   0   48  570   73   V VK KK T     A         D                     SS              SS     
   234  154 B R  B    S-T  150   0H 102  570   86   T TR KK K     I         L                     II              II     
   235  155 B L        -     0   0    3  578    3   L LL LL L     L         L                     LL              LL     
   236  156 B K  E     -FH  98 221F  31  578   51   K KK KK Q     Q         R                     QQ              QQ     
   237  157 B M  E     -FH  97 220F  18  579   94   M MV VV M     R         R                     YY              YY     
   238  158 B L  E     - H   0 219F   4  580   42   L LL LL L     L         L                     LL              LL     
   239  159 B E  E     - H   0 218F 107  580   72   E EE EA Q     S         R                     RR              RK     
   240  160 B V  E     - H   0 217F   0  580   46   V VV VL V     V         V                     VV              VV     
   241  161 B P  E     - H   0 216F  34  580   26   P PP PP P     P         P                     PP              PP     
   242  162 B Y  E     -J  263   0F  36  581   45   Y YY YF Y     Y         R                     LL              FL     
   243  163 B V  E     -J  262   0F  24  582   35   V VV VV V     V         I                     VV              VV     
   244  164 B D     >  -     0   0   88  581   58   D DD NN E     D         R                     DD              DD     
   245  165 B R  H  > S+     0   0   51  581   79   R RR RS R     W         T                     RR              RR     
   246  166 B N  H  > S+     0   0  105  582   75   N NS NT H     Q         Q                     AA              AA     
   247  167 B S  H  > S+     0   0   48  582   78   T TT TT R     T         R                     TT              TT     
   248  168 B j  H  X S+     0   0    1  582    2   C CC CC C     C         C                     CC              CC     
   249  169 B K  H >< S+     0   0   88  582   73   K KK KK K     M         Q                     LL              LL     
   250  170 B L  H 3< S+     0   0  150  547   89   L LQ QQ E     D         E                     RR              RR     
   251  171 B S  H 3< S+     0   0   23  578   76   S SS SS S     S         E                     SS              SS     
   252  172 B S    <<  -     0   0   20  581   83   T TT TT S     T         S                     TT              TT     
   253  173 B S  S    S+     0   0   79  581   83   P PN NS N     P         G                     KK              KK     
   254  174 B F  S    S-     0   0  124  581   79   F FF LF F     L         V                     FF              FF     
   255  175 B I        -     0   0  100  582   88   S SA AV A     S         R                     TS              TT     
   256  176 B I        -     0   0   13  582   16   I II IV I     I         L                     II              II     
   257  177 B T    >   -     0   0   16  582   36   T TT TT T     S         T                     YY              YY     
   258  178 B Q  T 3  S+     0   0  133  582   68   P PE EE E     L         Q                     NN              NN     
   259  179 B N  T 3  S+     0   0   24  582   61   N NN NN N     R         N                     NN              NH     
   260  180 B M  E <   - K   0 311F   2  582   11   M KM MM M     M         M                     MM              MM     
   261  181 B F  E     - K   0 310F   8  581   34   F FF FF F     F         F                     FF              FF     
   262  182 B j  E     +JK 243 309F   1  582    0   C CC CC C     C         C                     CC              CC     
   263  183 B A  E     +JK 242 308F   0  582   27   A AA AA A     A         A                     AA              AA     
   264  184 B G  S    S-     0   0    3  582   10   G GG GG G     G         G                     GG              GG     
   265  185 B Y        -     0   0   56  561   58   Y YY YY F     Y         Y                     FY              FY     
   266  185AB D  S    S-     0   0   81  565   84   D DE DD E     D         I                     HR              DH     
   267  185BB T  S    S+     0   0   76  582   62   S ST TT T     S         E                     EE              VE     
   268  186 B K  S    S-     0   0  107  532   32   K KE EE E     M         G                     GG              GG     
   269  187 B Q  S    S+     0   0  102  537   37   L LQ QE V     G         R                     GG              GG     
   270  188 B E        +     0   0   33  581   54   E EK KK K     E         Q                     RK              KK     
   271  189 B D  B     -E   94   0E   7  582    3   D DD DD D     D         D                     DD              DD     
   272  190 B A        -     0   0    7  582   42   A AA AA A     S         S                     SS              SS     
   273  191 B k    >   -     0   0    7  582    0   C CC CC C     F         C                     CC              CC     
   274  192 B Q  T 3  S+     0   0   90  582   25   Q QQ QQ Q     Q         K                     QE              EQ     
   275  193 B G  T 3  S+     0   0    6  582    7   G GG GG G     G         G                     GG              GG     
   276  194 B D    X   +     0   0    0  582    0   D DD DD D     D         D                     DD              DD     
   277  195 B S  T 3  S+     0   0   14  582    1   A SS SS S     S         S                     SS              SS     
   278  196 B G  T 3  S+     0   0    0  582    0   G GG GG G     G         G                     GG              GG     
   279  197 B G    <   -     0   0    0  582    2   G GG GG G     G         G                     GG              GG     
   280  198 B P  E     - L   0 294F   1  582    3   P PP PP P     P         P                     PP              PP     
   281  199 B H  E     -IL 219 293F   0  582   49   H HH HH H     H         L                     HH              HH     
   282  200 B V  E     -IL 218 291F   3  582   27   V VV VV V     V         V                     VV              VV     
   283  201 B T  E     - L   0 290F   0  582   67   T TT TT T     T         T                     TT              TT     
   284  202 B R  E     + L   0 289F  99  582   70   Q RR RR P     R         E                     EE              EE     
   285  203 B F  E >  S- L   0 288F  22  582   70   F FY YY F     Y         Y                     VV              VV     
   286  204 B K  T 3  S-     0   0   85  206   71   K KK KK K     H         R                     EE              EE     
   287  205 B D  T 3  S+     0   0  108  208   57   D DD DD D     G         G                     GG              GG     
   288  206 B T  E <   - L   0 285F   3  218   75   T TT TT T     T         T                     TT              TT     
   289  207 B Y  E     - L   0 284F  21  227   50   Y YY YY Y     F         W                     NS              SS     
   290  208 B F  E     -gL 200 283F   0  582   91   F FF FF F     F         F                     FF              FF     
   291  209 B V  E     + L   0 282F   1  582   41   I IV VV V     I         L                     LL              LL     
   292  210 B T  E     +     0   0F   1  582   84   T TT TT T     T         L                     TT              TT     
   293  211 B G  E     -ML 312 281F   0  582    0   G GG GG G     G         G                     GG              GG     
   294  212 B I  E     -ML 311 280F   0  582   19   I II II I     I         I                     II              II     
   295  213 B V  E     +M  310   0F   7  582   14   I IV VV V     R         V                     II              II     
   296  214 B S  E     -     0   0F   1  581    0   S SS SS S     S         S                     SS              SS     
   297  215 B W  E     -M  309   0F  45  582    8   W WW WW W     W         W                     WW              WW     
   298  216 B G        -     0   0   26  582    0   G GG GG G     G         G                     GG              GG     
   299  217 B E  S    S-     0   0   25  577   90   E EE EE E     K         R                     EE              EE     
   300  218 B G  S    S-     0   0   19  580   15   G GG GG G     G         G                     EE              EE     
   301  220 B k  S    S-     0   0    7  582    2   C CC CC C     H         C                     CC              CC     
   302  221 B A  S    S+     0   0    4  581   17   A AA AA A     T         A                     AA              AA     
   303  222 B R    >   -     0   0  105  578   74   R RR RR Q     R         R                     MM              IM     
   304  223 B K  T 3  S+     0   0  152  578   65   K KK KK K     K         P                     KK              KK     
   305  223AB G  T 3  S+     0   0   26  582   58   G GG GG G     G         G                     GG              GG     
   306  224 B K    <   -     0   0   43  582   85   K KK KK K     K         Q                     KK              KK     
   307  225 B Y        -     0   0   33  582   49   F FY YY Y     F         Y                     YY              YY     
   308  226 B G  E     -K  263   0F   4  580    2   G GG GG G     G         G                     GG              GG     
   309  227 B I  E     -KM 262 297F   6  581   10   V II VV V     I         I                     II              VI     
   310  228 B Y  E     -KM 261 295F   1  581    2   Y YY YY Y     Y         Y                     YY              YY     
   311  229 B T  E     -KM 260 294F   2  581   40   T TT TT T     T         T                     TT              TT     
   312  230 B K  E >   - M   0 293F  21  581   40   K KK KK K     Q         R                     KK              RK     
   313  231 B V  G >  S+     0   0    1  581    8   V VL LL V     V         V                     VV              VV     
   314  232 B T  G 3  S+     0   0    2  579   72   S TS SS S     S         S                     SS              SS     
   315  233 B A  G <  S+     0   0   29  579   80   N NR RR K     K         N                     RR              WR     
   316  234 B F  S <> S+     0   0    7  575   36   F FF FF L     F         Y                     YY              YY     
   317  235 B L  H  > S+     0   0   23  573   81   L LL LL Y     N         L                     VV              V      
   318  236 B K  H  > S+     0   0  116  572   68   N KR RR K     R         D                     NN              N      
   319  237 B W  H  > S+     0   0   26  572    1   W WW WW W     W         W                     WW              W      
   320  238 B I  H  X S+     0   0    1  569   12   I IV VV L     I         I                                            
   321  239 B D  H  < S+     0   0   66  541   72   E ER R  R     K         H                                            
   322  240 B R  H >< S+     0   0  136  528   71   R KT T  G     E         N                                            
   323  241 B S  H >< S+     0   0    6  495   71   S SV V  V     G                                                      
   324  242 B M  T 3< S+     0   0   25  452   39   M MM M  L     I                                                      
   325  243 B K  T <  S+     0   0  153  418   69   K KR    K     K                                                      
   326  244 B T    <         0   0   51  369   66      Q                                                                 
   327  245 B R              0   0  197  260   47      K                                                                 
## ALIGNMENTS  141 -  210
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1   49 A Q              0   0  101  253   29  QQQ QQQQQQQQQQQQ  QQ QQQQQQQ   QQQQQQNQQQQQ Q Q R  Q QQ   QQQ Q     QQ
     2   50 A a    >   +     0   0   22  341    0  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCSCCCCC CCCCCCCC CCC CCCCCCC   CCC
     3   51 A E  T 3  S+     0   0  187  342   77  SAALAATAAAAAAAAE  AA QSALADA LLAAALAAQAAAAA AEASTSTA NND EAAHKKK   KLQ
     4   52 A T  T 3  S-     0   0  105  342   54  SSSTSSSSSSSSSSSS  SS SSSSSSS SSSSSSSSTSSSSS SPSVPVGS PPP SEESPLS   SSS
     5   53 A S    <   +     0   0   89  342   62  NSSNNNNNNSSSSNNS  NN NNNNNNN SSNNNNNNpNNNNN NHNMGMSN HHQ ANNNRSS   SNN
     6   54 A P        +     0   0   10  343   18  PPPPPPPPPPPPPPPP  PP PPPPPPP PPPPPPPPpPPPPP PPPPPPPP PPP PPPMPPP   PPP
     7   55 A b        -     0   0   18  344    0  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCCCC CCC CCCCCCC   CCC
     8   56 A Q  S    S+     0   0   92  343   70  QQQRQQQQLQQQQQQL  QL VKQMQQQ QQQQQMQQQQQRQQ QNQQQQQK HHP SKKVQKL   LMV
     9   57 A N  S    S-     0   0   63  303   24  NNNNNNNNNNNNNNNN  NN .NNNNNN NNNNNNNNNNNNNN N.NNNNHN ... .NN.NNN   NN.
    10   58 A Q  S    S-     0   0  152  336   48  GGGNGGGGGGGGGGGE  GG NNGGGGG GGGGGGGGGGGGGG GNGNGNGG NNN NGGHGGG   GGN
    11   59 A G        -     0   0   16  344   17  GGGGGGGGGGGGGGGG  GG AGGGGGG GGGGGGGGGGGGGG GGGGGGGG GGG GAAGGAG   GGA
    12   60 A K  E     -A   23   0A 117  344   75  SSSTSSSSSSSSSSSS  LS VVSTTTS SSTTSTTSLSSSST TTTVTVTS TTT VMMATTS   STE
    13   61 A a  E     -A   22   0A  45  344    0  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCCCC CCC CCCCCCC   CCC
    14   62 A K  E     -A   21   0A 155  344   82  QKKVKKEVEEEEEKER  LE KKEFQTE sSVVEFQEVQEEEV QIQVIVhE KKI QSSViTs   sFK
    15   63 A X  E     +A   20   0A 120  302   29  DDD.DDDDDDDDDDDD  DD DDDDDDD qAEEDDDDDEDDDD DDD.N.hD DDD DDDDdRe   eDD
    16   64 A G        -     0   0   44  341   74  QQQYQQQEQQQQQQQH  AQ GGQQHQQ AQNNQQHQQDQQQQ HGDSNSGN SSG GSSLGRG   GQG
    17   65 A L  S    S-     0   0  152  342   69  LLLLLLLLLFFFFLII  LL IILHLFL SAFFLHLLLFFLLF LIFMEMLF FFI IVVYSFP   PHI
    18   66 A G  S    S+     0   0   67  343   62  QQQaQQQQQQQQQQQG  QQ GNQQKQQ SSQQQQKQQQQQQQ KGRgEgGQ GGG GGGQSES   SQG
    19   67 A E        -     0   0  119  329   61  SSSsSSSSASSSSSSY  AA RQSSSNS .STTSSSSSGSSSS SSLtStNS AAS RGGD.T.   .SR
    20   68 A Y  E     -A   15   0A  37  342    9  YYYYYYYYYYYYYYYF  YY FYYYYYY YYYYYYYYYYYYYY YFYYYYYY FFF YYYYYYY   YYF
    21   69 A T  E     -A   14   0A  71  343   83  IIIYIIVVIIIIIIIS  TI DTIIVII SSIIIIVIIVIIII VQIQTQKI EEQ DDDATAT   TID
    22   70 A b  E     -A   13   0A  20  343    0  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCCCC CCC CCCCCCC   CCC
    23   71 A T  E     -A   12   0A  85  344   80  FFFLFFFFFFFFFFFA  LF IYFTFIF FFLLFTFFFFFFFF FIFHLHTL SSI IVVRLKY   YTI
    24   72 A c        -     0   0   44  344    1  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCCCC CCC CCCCCCC   CCC
    25   73 A L    >   -     0   0   62  344   86  RLLALLLLPLLLLLLA  QP NLLPLPL LLLLLPLPLLPPPP PNLPLPNP NNK NKKNLAL   LAN
    26   74 A E  T 3  S+     0   0  177  344   74  APPEPPPAELLLLPAS  KE ESDMLID PPMMDMLDDPEDDA LEPEPETD EEE ESSHPNP   PME
    27   75 A G  T 3  S+     0   0   29  344   24  GDDGSSEDGGGGGSDG  GG GGDGDDD RREENGDDDDESDR DGNGQGGD GGG GGGGQGE   EGG
    28   76 A F  E <   +B   36   0B  40  343   16  FFFYFFFFFFFFFFFF  YF WYFYFYF FFFFFYFFFFFFFF FWFFFFFF WWW WFFYFFF   FYW
    29   77 A E  E     +B   35   0B  74  343   63  EEEEEEEEEEEEEEET  VE EDQEEEQ SSEEEEEQEEEQQE EESGMGTE EEE ETTERHR   REE
    30   78 A G  S >  S-     0   0   32  343    1  GGGGGGGGGGGGGGGG  GG GGGGGGG GGGGGGGGGGGGGG GGGGGGGG GGG GGGGGGG   GGG
    31   79 A K  T 3  S+     0   0  156  343   72  RRRKRRRRRRRRRRRQ  RR RNRRRRR LLRRRRRRRRRRRR RRRQLQAR RRR QVVKVHV   VRR
    32   80 A N  T 3  S-     0   0   33  343   62  NNNYNNNNNNNNNNNI  NN LTNHNNN NNNNNHNNNNHNNN NLNRNRNN LLL LHHYNNN   NHL
    33   81 A c  S <  S+     0   0    1  344    0  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCCCC CCC CCCCCCC   CCC
    34   82 A E        +     0   0   87  342   30  eeeeeeeeeeeeeeee  ee keeeeee eeeeeeeeeqeeee eeeeeeEe qqg qeeddde   eeg
    35   83 A L  E    S-B   29   0B  96  289   42  lllllllllllllllf  ll vllmlll vvlllmllllllll lvlmqfTl ssv mllpklv   vmv
    36   84 A F  E     -B   28   0B 139  292   93  MIIEIIIIIIIIIIIV  NI EGQLIKQ HHIIILIIIIIVII IRITTLVI YYS YCCQTTP   PLY
    37   85 A T        -     0   0   44   76   76  ...E............  .. ....... .............. ....E.K. ... ...TK..   ...
    38   86 A R        +     0   0   57  101   88  ...T...........A  .. Y...... .............. .Y..S.I. ..Y ...ASS.   ...
    39   87 A K        +     0   0   96  140   78  ...L...........K  .. S...... EE............ .T.ED.L. TTT D..TDND   D.S
    40   88 A L        -     0   0   91  168   91  ...K...........R  .. N.VK..V SS...K........ .N.LSKF. NNN N..NSGT   TKN
    41   89 A d  S  > S+     0   0   15  238   19  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCCSC CCC CTTCCCC   CCC
    42   90 A S  T  4 S+     0   0   98  244   86  VVVQVVSLMIIIIVMD  SM STMIAIM LLDDVIAMLDEVMK ASDELLSE SSS SWWSLRL   LIS
    43   91 A L  T >4 S-     0   0  120  274   90  NNNYNNNNNNNNNNYV  YN LFNYNYN LLFFNYNNNNNNNY NLNNLYPN TTI IKKLVYV   VYL
    44   92 A D  G >4 S-     0   0  107  297   62  DEEVEEEADEEEEEEN  DD NREDEDE EEDDEDEEEEEEEE ENEEEQNE NNN DNNDQRE   EDN
    45   93 A N  G >< S-     0   0    8  315   63  NNNNNNNNNNNNNNNN  NN NNNNNNN NNNNNNNNNNNNNN NNNNNNIN NNN NKKNNNN   NNN
    46   94 A G  G <  S-     0   0    0  316   53  GGGGGGGGGGGGGGGG  GG GGGGGGG GGGGGGGGGGGGGG GGGGGGDG GGG GTTGGGG   GGG
    47   95 A D  G <  S+     0   0   44  344   60  GGGGGGGGGGGGGGGD  RG GGGQDDG GGGGGQDGGGGGGG DGGGGQEG GGG GGGGAGG   GQG
    48   96 A e    <   -     0   0    0  344    1  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCCCC CCC CCCCCCC   CCC
    49   97 A D  S    S-     0   0   59  344   73  QEEEEEEEEEEEEEEM  EE MEEEDDE DDNNEEDQEEEEQD DAEEDQAQ EEA ESSDEEE   EES
    50   98 A Q  S    S+     0   0    2  344   62  QQQQQQQQQQQQQQQH  HQ HHQHQQQ HHQQQHQQQQQQQQ QHQHHHsQ QQH HQQHHHH   HHH
    51   99 A F  E     -C   62   0C   4  344   77  YYYFYYYYYYYYYYYF  FY FFYFYYY FFYYYFYYYYYYYY YYYFFFtY FFY FFFDFFF   FFF
    52  100 A d  E     +C   61   0C  10  344    0  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCCCC CCC CCCCCCC   CCC
    53  101 A H  E     -C   60   0C  68  344   86  HSSDSSSISSSSSSST  VS TQSHRVS EESSSHRSSSSSSL RTSKDDVS SST NKKWNRD   DHT
    54  102 A E  E     -C   59   0C  92  344   56  DDDGDDDDDDDDDDDS  ED NGDDDDD EEDDDDDDDDNDDD DEDVEGDN QQE EPPEEEE   EDQ
    55  103 A E  S    S-     0   0  100  344   81  rHHsHHhkhHHHHHHM  Th TShNHSh DdnnhNHhnRHrhn HdRVDsGh ddd vgggDfd   dNp
    56  104 A Q  S    S-     0   0  175  310   77  dmtvaaedeaaaaavg  ee eDesvpe egeeesveevveee vkkra.Ve ddq st.dada   asn
    57  105 A N  S    S+     0   0  154  307   78  Aaa.aaATAttttass  sA tEAtttA rrTTTttATdtGAT tqdnraNT nnq k.tlrRr   rtt
    58  106 A S  S    S-     0   0   58  337   71  GKKRKKKPGKKKKKQG  AG SKGSKLG RRIIRSKRKTKGRV KQT.RSTK QQQ YSSTRSR   RGR
    59  107 A V  E     -C   54   0C   7  343   86  RRRRRRRRRRRRRRRA  RR RFHRRRH LLRRRRRRRRRRRR RRRVLRYR RRR RYYRLYL   LRR
    60  108 A V  E     -C   53   0C  45  344   87  TSSSSSSSSSSSSSSK  KS VSSQTQS NNRRSQTSSISSSQ TYIRAKTS YYH YEESNVN   NQV
    61  109 A e  E     +C   52   0C   5  344    0  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCCCC CCC CCCCCCC   CCC
    62  110 A S  E     -C   51   0C  24  344   70  HWWSWWWRWRRRRWRS  TW SSYSSFY SSYYRSSWRRWRWH SMRSSFVW SSS SSSSSFS   SSS
    63  111 A f        -     0   0   23  344    0  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCCCC CCC CCCCCCC   CCC
    64  112 A A    >   -     0   0    8  344   70  HHHAHHHHHHHHHHHA  AH AAQAHAQ AAEEHAHHHHHHHE HAHAAAAH AAA AAAVAAA   AAA
    65  113 A R  T 3  S+     0   0  149  344   83  EEEEEEEKEEEEEEER  DE QKEEEEE DDRREEEEDEEEEP EPADDHPK PPL SRRADPD   DET
    66  114 A G  T 3  S+     0   0   24  344   13  GGGGGGGGGGGGGGGG  GG GDGGDGG GGGGGGDGGGGGGG DGGGGGLG GGG GGGGGGG   GSG
    67  115 A Y  E <   -D   78   0D  20  344    7  YYYYYYYYYYYYYYYY  YY YYYYYYY YYYYYYYYYYYYYY YYYYHYYY YYY YWWFYYY   YYY
    68  116 A T  E     -D   77   0D  72  343   81  TSSASSSTASSSSSTK  AA RKAKTRA FFAAAKTTTTTTTA VKTEKTTT RRQ RKKKSRG   GKK
    69  117 A L  E     -D   76   0D  67  340   68  LLLLLLLLLLLLLLLL  LL LLLLLLL LLLLLLLLLLLLLL LELLLL L QQE LLLLLLL   LLL
    70  118 A A    >   -     0   0   23  340   78  LLLALLQMQLLLLLLL  FQ NHQGQAQ DDAAQGQQMQQQQA QEQGDA Q MMS SSSHGDD   DGD
    71  119 A D  T 3  S+     0   0  175  340   77  GAADAAPAEAAAAAPQ  EE DADAPSD EEPPDAPDAPTDDP PDPPTS A DDD GRRTDKA   AAE
    72  120 A N  T 3  S-     0   0   92  340   74  DDDDDDDDDDDDDDND  DD DDDDDDD DDDDDDDDDDDDDD DNDDDD D DDN NTTDDDD   DDD
    73  121 A G  S <  S+     0   0   16  340   56  GGGGGGGGGGGGGGGG  DG YGGGEQG GGGGGGEGGKGGGG EPQDGG G PPP HTTSGNG   GGH
    74  122 A K  S    S+     0   0   71  332   83  VVVTVVVVVVVVVVVL  EV KKVLVMV RRVVVLVVVVVVVV VMVKRR M CCM TRRRQSL   LLH
    75  123 A A        -     0   0   22  330   70  SSSSSSSSSSSSSSSN  SS TSSSSSS SSTTSSSSSSSSSS SESSSQ S KKE SddKSTS   SST
    76  124 A f  E     -D   69   0D  12  300   48  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCC C CCC CccCCCC   CCC
    77  125 A I  E     -D   68   0D  78  304   82  TTTVMMAEEMMMMMTD  ME QRMEKLM TTNNAEKMTIAAMN KKMQII A QQD EEEVVLN   NEQ
    78  126 A P  E     -D   67   0D  62  304   56  PPPSPPPPPPPPPPPP  PP PPPPPPP SSPPPPPPPPPPPP PPPSSA P PPP PPPPAPA   APP
    79  127 A T  S    S+     0   0  103  304   79  ATTQTTTTTTTTTTTH  TT AMTTKET TTVVTTKITTTTIV KVTNKE A TTI DAATKQK   KEV
    80  128 A G  S    S-     0   0   32  305   75  VVVVVVVVVVVVVVVV  RV VVVVVVV GGVVVVVVVVVVVV VAVEAV V VVA VVVGEVE   EVV
    81  129 A P  S    S+     0   0  116  311   78  EEEDEEEEEEEEEEDD  EE EPENEEE PPDDENEEEEEEED ENETPE E TTN EPPPPKV   VDE
    82  130 A Y  S    S+     0   0   59  312   77  YYYYYYYYYYYYYYYF  FY FFYYYYY IIYYYYYYYYYYYY YFYFIF Y FFF FYYSIVV   VYF
    83  131 A P    >   -     0   0   17  312   34  PPPPPPPPPPPPPPPP  PP PPPPPPP AAPPPPPPPPPPPP PPPRAP P PPP PPPSAPV   VPP
    84  132 A g  T 3  S+     0   0   16  323    2  CCCCCCCCCCCCCCCC  CC CCCCCCC CCCCCCCCCCCCCC CCCCCC C CCC CCCCCCC   CCC
    85  133 A G  T 3  S+     0   0    0  295   30  GGGGGGGGGGGGGGGG  GG GGGGGGG GGGGGGGGGGGGGG GGGGGG G GGG GGGGGGG   GGG
    86  134 A K    <   -     0   0   69  294   62  KKKQKKKKKKKKKKKR  KK KRKKRKK MMRRRKRKKKKKKR RKKGTQ K RRK RKKQMRK   KKK
    87  135 A Q        -     0   0   37  243   74  IIIIIIIMIIIIIIVT  II LIIIIII VVMMIIIIIIIIII IPIIVL I SSP VVVLVLV   VVS
    88  136 A T        +     0   0    4  220   79  PPPPPPPPPPPPPPPA  PP KQPPPPP PPPPPPPPPPPPPP PKPIPP P VVK V  LPQL   LPK
    89  137 A L        +     0   0  105  200   57  VIIVIII VIIIII L  IV IVIVVVI VVVVVVVVVVVVVV VVVTV  V VVV E  IVIL   LVI
    90  138 A E              0   0  104  120   71     Q                  Q L         L          S E     NNN K  A  T   TL 
    91  139 A R              0   0  231   97   28     K                    K         K            N         K  R  Q   QK 
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3                  VV                         I        I   I       VII   
    94   17 B V  B     -E  271   0E   7  561    9                  II                         V        V   V       VVV   
    95   18 B G  S    S+     0   0   25  562    6                  NN                         G        G   G       GGG   
    96   19 B G  S    S-     0   0   26  563    0                  GG                         G        G   G       GGG   
    97   20 B Q  E     -F  237   0F  98  564   95                  LL                         Y        Y   Y       YSS   
    98   21 B E  E     -F  236   0F  80  565   65                  II                         E        E   E       LAA   
    99   22 B h        -     0   0    8  565   58                  CC                         C        C   C       EVV   
   100   23 B K    >   -     0   0  123  564   79                  PP                         Q        Q   Q       EAA   
   101   24 B D  T 3  S+     0   0   60  565   85                  KK                         P        P   P       QSS   
   102   25 B G  T 3  S+     0   0    0  565   73                  GG                         N        N   N       GGG   
   103   26 B E  S <  S+     0   0   36  565   67                  HH                         S        S   S       GEE   
   104   27 B h    >   +     0   0    4  565   91                  CC                         Q        Q   Q       SAA   
   105   28 B P  T 3   +     0   0    0  567    9                  PP                         P        P   P       PTT   
   106   29 B W  T 3  S+     0   0    5  568   27                  WW                         W        W   W       WYY   
   107   30 B Q  E <   -N  122   0G   7  569   24                  QQ                         Q        Q   Q       qQQ   
   108   31 B A  E     -NO 121 146G   1  559   47                  AA                         A        A   A       vVV   
   109   32 B L  E     -NO 120 145G   3  567   65                  MM                         S        S   S       LSS   
   110   33 B L  E     -NO 119 144G   0  570   11                  LL                         L        L   L       LLL   
   111   34 B I  E     -NO 117 143G   0  570   81                  SS                         N        N   N       RQQ   
   112   35 B N  E >   - O   0 142G  30  570   88                  EE                         S        S   S       RRR   
   113   36 B E  T 3  S+     0   0   63  113   77                  ..                         .        .   .       A..   
   114   37 B E  T 3  S-     0   0  136  242   76                  .N                         .        .   .       D..   
   115   38 B N  S <  S+     0   0   84  543   52                  NN  G                      G        G   G       GSS   
   116   39 B E        -     0   0  100  561   93                  NI  S       E              Y        Y   Y       SSS   
   117   40 B G  E     +N  111   0G  14  572   55                  IY  G       A              H        H   H       GHH   
   118   41 B F  E     +     0   0G  28  581   35                  yT  F       F              F        F   F       FFF   
   119   42 B i  E     -N  110   0G   0  578    1                  cC  C       C              C        C   C       CCC   
   120   43 B G  E     -N  109   0G   1  581    2                  GG  G       G              G        G   G       GGG   
   121   44 B G  E     -N  108   0G   0  581    9                  AA  G       G              G        G   G       GGG   
   122   45 B T  E     -NP 107 130G   0  581   43                  II  T       A              S        S   S       TTT   
   123   46 B I  E     + P   0 129G   0  581   23                  II  L       I              L        L   L       LII   
   124   47 B L        -     0   0    6  581   27                  LL  I       I              V        V   V       III   
   125   48 B S  S    S-     0   0   22  581   57                  SS  S       N              S        S   S       SDD   
   126   49 B E  S    S+     0   0   99  581   62                  EE  D       E              E        E   E       DDD   
   127   50 B F  S    S+     0   0   42  581   82                  QQ  Q       K              Y        Y   Y       QYY   
   128   51 B Y  E     - Q   0 185G   7  581   33                  WW  W       W              W        W   W       WWW   
   129   52 B I  E     -PQ 123 184G   0  581   14                  VV  V       V              V        V   V       VVV   
   130   53 B L  E     +PQ 122 183G   0  581   28                  LL  V       V              V        V   V       VLL   
   131   54 B T  E     - Q   0 182G   0  581   43                  TT  S       T              S        S   S       STT   
   132   55 B A    >>  -     0   0    0  581    2                  AA  A       A              A        A   A       AAA   
   133   56 B A  G >4 S+     0   0    0  581    8                  AA  A       A              A        A   A       AAA   
   134   57 B H  G >4 S+     0   0    7  581    0                  HH  H       H              H        H   H       HHH   
   135   58 B i  G X4 S+     0   0    0  581    2                  CC  C       C              C        C   C       CCC   
   136   59 B L  G << S+     0   0   31  581   65                  VV  M       L              Y        Y   Y       MVV   
   137   60 B Y  G <  S+     0   0  109  581   87                  WW  Q       K              K        K   K       QSS   
   138   61 B Q  S <  S+     0   0   95  581   78                  rr  G       P              S        S   S       ggg   
   139   61AB A        -     0   0   16  352   75                  aa  .       G              .        .   .       vaa   
   140   62 B K  S    S-     0   0  172  366   75                  HH  P       D              .        .   .       DSS   
   141   63 B R  S    S-     0   0  162  570   78                  LL  V       K              R        R   R       HQQ   
   142   64 B F  E     -O  112   0G  36  577   54                  FF  D       I              L        L   V       VLL   
   143   65 B K  E     -O  111   0G  67  577   78                  NN  H       E              E        E   E       TKK   
   144   66 B V  E     -OR 110 161G   0  577   16                  VV  V       V              V        V   V       VVV   
   145   67 B R  E     -OR 109 160G  40  577   53                  TT  T       V              R        R   R       GRR   
   146   68 B V  E     +OR 108 159G   1  578   43                  VV  V       A              L        L   L       RYY   
   147   69 B G  S    S+     0   0    9  578   14                  GG  G       G              G        G   G       DNN   
   148   70 B D        +     0   0   11  579   58                  EE  D       E              E        E   E       YTT   
   149   71 B R  S    S+     0   0   24  579   73                  HH  Y       Y              H        H   H       DVL   
   150   72 B N  B >   -T  234   0H  18  579   65                  DD  D       N              N        N   N       KRR   
   151   73 B T  T 3  S+     0   0   56  579   79                  RR  K       I              I        I   I       LHH   
   152   74 B E  T 3  S-     0   0  119  579   84                  EE  L       D              V        V   V       RNN   
   153   75 B Q  S <  S-     0   0  130  578   86                  II  R       E              I        I   I       ASS   
   154   76 B E        +     0   0  165  578   85                  FF  A       K              N        N   N       EGG   
   155   77 B E        -     0   0   93  438   29                  EE  E       E              E        E   E       P..   
   156   78 B G  S    S+     0   0   46  547   33                  KK  P       D              G        G   G       GGG   
   157   79 B G  S    S+     0   0   47  555   76                  TT  G       T              T        T   T       ESS   
   158   80 B E        -     0   0   37  444   33                  EE  E       E              E        E   E       ...   
   159   81 B A  E     -R  146   0G  27  457   60                  QQ  Q       Q              Q        Q   Q       Q..   
   160   82 B V  E     -R  145   0G  71  557   81                  HH  Q       R              F        F   F       QLL   
   161   83 B H  E     -R  144   0G  14  567   77                  RR  I       R              I        I   I       III   
   162   84 B E        -     0   0   90  569   77                  RR  Q       N              T        T   T       QSS   
   163   85 B V  E     -S  186   0G  27  574   64                  VV  V       V              S        S   S       VVV   
   164   86 B E  E    S+     0   0G  70  575   73                  II  Q       I              E        E   E       QSS   
   165   87 B V  E     -S  185   0G  13  576   72                  KK  K       Q              K        K   K       KEE   
   166   88 B V  E     -S  184   0G  72  577   45                  VV  V       T              V        V   V       VVV   
   167   89 B I  E     +S  183   0G  27  578   45                  LL  L       I              I        I   I       LII   
   168   90 B K  E     -S  182   0G  68  578   82                  II  V       P              R        R   R       VAA   
   169   91 B H    >   -     0   0   19  579   14                  HH  H       H              N        N   N       HHH   
   170   92 B N  T 3  S+     0   0  156  579   60                  PP  P       H              P        P   P       PSS   
   171   93 B R  T 3  S+     0   0  150  576   74                  GG  H       H              N        N   N       HGG   
   172   94 B F    <   -     0   0   24  579    5                  YY  F       Y              Y        Y   Y       FYY   
   173   95 B T     >  -     0   0   56  579   67                  NN  H       N              D        D   D       HSS   
   174   96 B K  T  4 S+     0   0  145  525   79                  KK  A       .              S        S   S       ASS   
   175   97 B E  T  4 S+     0   0  174  533   92                  TT  F       .              W        W   W       FWW   
   176   98 B T  T  4 S-     0   0   44  561   58                  SS  T       .              T        T   D       TTT   
   177   99 B Y    ><  +     0   0   60  566   66                  SS  F       .              I        I   L       FLL   
   178  100 B D  T 3   +     0   0   25  578   38                  DD  D       .              D        D   D       DDD   
   179  101 B F  T 3  S+     0   0   21  558   68                  KK  S       .              S        S   S       SNN   
   180  102 B D    <   +     0   0    1  577    0                  DD  D       .              D        D   D       DDD   
   181  103 B I        +     0   0    0  579   14                  LL  V       .              I        I   I       VII   
   182  104 B A  E     -QS 131 168G   0  579   60                  AA  A       .              M        M   M       AAA   
   183  105 B V  E     -QS 130 167G   0  580   15                  MM  L       A              L        L   L       LLL   
   184  106 B L  E     -QS 129 166G   0  581   30                  LL  L       S              I        I   I       LLL   
   185  107 B R  E     -QS 128 165G  40  581   42                  KK  R       I              K        K   K       RKK   
   186  108 B L  E     - S   0 163G   0  581   17                  LL  L       N              L        L   L       LTT   
   187  109 B K  S    S+     0   0  101  581   69                  HH  A       K              S        S   S       ASS   
   188  110 B T  S    S-     0   0   82  582   74                  RR  R       Y              K        K   K       RSS   
   189  111 B P        -     0   0   48  582   39                  PP  P       S              P        P   P       PPP   
   190  112 B I        -     0   0    4  532   62                  VV  V       L              A        A   A       V..   
   191  113 B T        -     0   0   95  537   72                  KK  L       I              T        T   T       L..   
   192  114 B F        +     0   0   56  580   32                  LL  R       L              L        L   L       RMM   
   193  115 B R  B >   -U  196   0I  52  581   64                  GG  G       N              N        N   N       GTT   
   194  116 B M  T 3  S+     0   0   29  564   77                  LL  P       S              K        K   K       P..   
   195  117 B N  T 3  S+     0   0   13  572   89                  YY  T       Y              Y        Y   Y       TGG   
   196  118 B V  B <   +U  193   0I   0  574   26                  VV  A       V              V        V   V       AII   
   197  119 B A        -     0   0    1  576   81                  VV  A       T              Q        Q   Q       AKK   
   198  120 B P        -     0   0    8  576   54                  PP  P       P              P        P   P       PKK   
   199  121 B A        -     0   0    2  577   39                  II  A       I              V        V   V       AAA   
   200  122 B g  B     -g  290   0F   1  578   67                  CC  C       C              A        A   A       CDD   
   201  123 B L        -     0   0   27  580    5                  LL  L       V              L        L   L       LLL   
   202  124 B P        -     0   0    7  581   31                  PP  P       A              P        P   P       PPP   
   203  124AB E     >  -     0   0   92  580   75                  AA  D       N              N        .   N       DVV   
   204  125 B R  H  > S+     0   0  109  580   79                  QQ  P       R              G        .   G       PSS   
   205  126 B D  H  > S+     0   0  124  580   85                  NN  H       E              C        .   C       HGG   
   206  127 B W  H  >>S+     0   0    4  580   87                  SS  L       Y              A        .   A       LSS   
   207  128 B A  I  X>S+     0   0    0  580   75                  TT  S       T              A        .   A       SDD   
   208  129 B E  I  <5S+     0   0   75  581   83                  II  K       N              D        N   D       KVV   
   209  130 B S  I  <5S+     0   0   70  582   65                  ss  Y       I              G        G   G       YSS   
   210  131 B T  I  <5S+     0   0   18  104   77                  tt  L       .              .        C   .       L..   
   211  131AB L  I ><  S-     0   0  119  478   80                  SS  R       F              M        M   M       RTT   
   227  146 B E  T 3  S+     0   0   47  513   76                  RR  H       N              S        S   S       HEE   
   228  147 B K  T 3  S+     0   0  169  537   69                  FF  L       K              S        S   S       LGG   
   229  149 B G  S <  S-     0   0   29  548   67                  GG  G       G              T        T   T       GGG   
   230  150 B R        -     0   0  213  557   86                  PP  R       R              A        A   A       RSS   
   231  151 B Q  B     -V  224   0J  79  563   93                  PP  S       Q              D        D   D       SLL   
   232  152 B S        -     0   0   14  569   51                  AA  S       A              S        S   S       SAA   
   233  153 B T  S    S+     0   0   48  570   73                  TT  R       S              N        N   N       RSS   
   234  154 B R  B    S-T  150   0H 102  570   86                  II  F       I              K        K   K       FSS   
   235  155 B L        -     0   0    3  578    3                  LL  L       L              L        L   L       LLL   
   236  156 B K  E     -FH  98 221F  31  578   51                  QQ  R       Q              Q        Q   Q       RQQ   
   237  157 B M  E     -FH  97 220F  18  579   94                  RR  R       Y              C        C   C       RKK   
   238  158 B L  E     - H   0 219F   4  580   42                  LL  V       L              L        L   L       VVV   
   239  159 B E  E     - H   0 218F 107  580   72                  TT  T       R              E        E   E       TSS   
   240  160 B V  E     - H   0 217F   0  580   46                  LL  L       V              I        I   I       LVV   
   241  161 B P  E     - H   0 216F  34  580   26                  PP  P       P              P        P   P       PPP   
   242  162 B Y  E     -J  263   0F  36  581   45                  RR  V       L              I        I   I       VVV   
   243  163 B V  E     -J  262   0F  24  582   35                  VV  V       V              L        L   L       VVV   
   244  164 B D     >  -     0   0   88  581   58                  PP  S       D              S        S   S       SDD   
   245  165 B R  H  > S+     0   0   51  581   79                  LL  F       R              D        D   D       FRR   
   246  166 B N  H  > S+     0   0  105  582   75                  QQ  E       A              R        R   R       EAA   
   247  167 B S  H  > S+     0   0   48  582   78                  EE  D       T              D        D   D       DQQ   
   248  168 B j  H  X S+     0   0    1  582    2                  CC  C       C              C        C   C       CCC   
   249  169 B K  H >< S+     0   0   88  582   73                  RR  R       L              K        K   N       rNN   
   250  170 B L  H 3< S+     0   0  150  547   89                  LL  A       R              N        N   N       vSS   
   251  171 B S  H 3< S+     0   0   23  578   76                  HH  S       S              S        S   S       PSS   
   252  172 B S    <<  -     0   0   20  581   83                  TT  T       T              Y        Y   Y       PYY   
   253  173 B S  S    S+     0   0   79  581   83                  KK  E       T              P        P   P       HSS   
   254  174 B F  S    S-     0   0  124  581   79                  LL  Q       F              G        G   G       AGG   
   255  175 B I        -     0   0  100  582   88                  NN  V       T              M        M   M       VDD   
   256  176 B I        -     0   0   13  582   16                  II  I       I              I        I   I       III   
   257  177 B T    >   -     0   0   16  582   36                  TT  T       Y              T        T   T       TTT   
   258  178 B Q  T 3  S+     0   0  133  582   68                  RR  D       N              D        D   D       DPP   
   259  179 B N  T 3  S+     0   0   24  582   61                  NN  N       N              T        T   T       NNN   
   260  180 B M  E <   - K   0 311F   2  582   11                  MM  M       M              M        M   M       MMM   
   261  181 B F  E     - K   0 310F   8  581   34                  LL  F       F              F        F   F       FFF   
   262  182 B j  E     +JK 243 309F   1  582    0                  CC  C       C              C        C   C       CCC   
   263  183 B A  E     +JK 242 308F   0  582   27                  AA  A       A              A        A   A       AAA   
   264  184 B G  S    S-     0   0    3  582   10                  GG  G       G              G        G   G       GGG   
   265  185 B Y        -     0   0   56  561   58                  LL  Y       Y              Y        Y   Y       YVV   
   266  185AB D  S    S-     0   0   81  565   84                  KK  L       R              L        L   L       LSS   
   267  185BB T  S    S+     0   0   76  582   62                  TT  D       E              E        E   E       DAA   
   268  186 B K  S    S-     0   0  107  532   32                  GG  A       G              G        G   G       AGG   
   269  187 B Q  S    S+     0   0  102  537   37                  GG  S       G              G        G   G       SGG   
   270  188 B E        +     0   0   33  581   54                  RR  V       K              K        K   K       VKK   
   271  189 B D  B     -E   94   0E   7  582    3                  DD  D       D              D        D   D       DDD   
   272  190 B A        -     0   0    7  582   42                  AA  A       S              S        S   S       ASS   
   273  191 B k    >   -     0   0    7  582    0                  CC  C       C              C        C   C       CCC   
   274  192 B Q  T 3  S+     0   0   90  582   25                  EE  R       E              Q        Q   Q       RQQ   
   275  193 B G  T 3  S+     0   0    6  582    7                  GG  G       G              G        G   G       GGG   
   276  194 B D    X   +     0   0    0  582    0                  DD  D       D              D        D   D       DDD   
   277  195 B S  T 3  S+     0   0   14  582    1                  SS  S       S              S        S   S       SSS   
   278  196 B G  T 3  S+     0   0    0  582    0                  GG  G       G              G        G   G       GGG   
   279  197 B G    <   -     0   0    0  582    2                  GG  G       G              G        G   G       GGG   
   280  198 B P  E     - L   0 294F   1  582    3                  PP  P       P              P        P   P       PPP   
   281  199 B H  E     -IL 219 293F   0  582   49                  LL  F       H              V        V   V       FVV   
   282  200 B V  E     -IL 218 291F   3  582   27                  VV  V       V              V        V   V       VVV   
   283  201 B T  E     - L   0 290F   0  582   67                  TT  V       T              C        C   C       VSS   
   284  202 B R  E     + L   0 289F  99  582   70                  YY  N       E              N        N   N       NGG   
   285  203 B F  E >  S- L   0 288F  22  582   70                  YY  Y       V              G        G   G       YNN   
   286  204 B K  T 3  S-     0   0   85  206   71                  KK  R       E              .        .   .       R..   
   287  205 B D  T 3  S+     0   0  108  208   57                  KK  G       G              .        .   .       G..   
   288  206 B T  E <   - L   0 285F   3  218   75                  TT  T       T              .        .   .       T..   
   289  207 B Y  E     - L   0 284F  21  227   50                  WW  W       S              .        .   .       W..   
   290  208 B F  E     -gL 200 283F   0  582   91                  FF  F       F              E        E   E       FTT   
   291  209 B V  E     + L   0 282F   1  582   41                  LL  L       L              L        L   L       LVV   
   292  210 B T  E     +     0   0F   1  582   84                  TT  T       T              Q        Q   H       TVV   
   293  211 B G  E     -ML 312 281F   0  582    0                  GG  G       G              G        G   G       GGG   
   294  212 B I  E     -ML 311 280F   0  582   19                  VV  V       I              I        I   I       VAA   
   295  213 B V  E     +M  310   0F   7  582   14                  VV  V       I              V        V   V       VVV   
   296  214 B S  E     -     0   0F   1  581    0                  SS  S       S              S        S   S       SSS   
   297  215 B W  E     -M  309   0F  45  582    8                  WW  W       W              W        W   W       WWW   
   298  216 B G        -     0   0   26  582    0                  GG  G       G              G        G   G       GGG   
   299  217 B E  S    S-     0   0   25  577   90                  KK  E       E              Y        Y   Y       EMM   
   300  218 B G  S    S-     0   0   19  580   15                  GG  G       E              G        G   G       GGG   
   301  220 B k  S    S-     0   0    7  582    2                  CC  C       C              C        C   C       CCC   
   302  221 B A  S    S+     0   0    4  581   17                  AA  A       A              A        A   A       AAA   
   303  222 B R    >   -     0   0  105  578   74                  NN  A       I              Q        Q   E       ARR   
   304  223 B K  T 3  S+     0   0  152  578   65                  EE  E       K              K        K   K       EPP   
   305  223AB G  T 3  S+     0   0   26  582   58                  NN  G       G              D        D   N       GNN   
   306  224 B K    <   -     0   0   43  582   85                  LL  K       K              N        N   H       KYY   
   307  225 B Y        -     0   0   33  582   49                  YY  F       Y              P        P   P       FPP   
   308  226 B G  E     -K  263   0F   4  580    2                  GG  G       G              G        G   G       GGG   
   309  227 B I  E     -KM 262 297F   6  581   10                  VV  V       I              V        V   V       VVV   
   310  228 B Y  E     -KM 261 295F   1  581    2                  YY  Y       Y              Y        Y   Y       YYY   
   311  229 B T  E     -KM 260 294F   2  581   40                  VV  T       T              G        G   G       TTT   
   312  230 B K  E >   - M   0 293F  21  581   40                  RR  R       K              K        K   K       RRR   
   313  231 B V  G >  S+     0   0    1  581    8                  VV  L       V              V        V   V       LVV   
   314  232 B T  G 3  S+     0   0    2  579   72                  TT  G       S              C        C   C       GGG   
   315  233 B A  G <  S+     0   0   29  579   80                  NN  N       R              M        M   M       NNN   
   316  234 B F  S <> S+     0   0    7  575   36                  FF  F       Y              F        F   F       FFF   
   317  235 B L  H  > S+     0   0   23  573   81                  LL  L       V              S        S   S       LRR   
   318  236 B K  H  > S+     0   0  116  572   68                  DD  N       N              Q        Q   Q       NEE   
   319  237 B W  H  > S+     0   0   26  572    1                  WW  W       W              W        W   W       WWW   
   320  238 B I  H  X S+     0   0    1  569   12                  II  I       I              I        I   I       III   
   321  239 B D  H  < S+     0   0   66  541   72                  GG  T       K              A        A   A       TKK   
   322  240 B R  H >< S+     0   0  136  528   71                  NN  S       E              D        D   D       STT   
   323  241 B S  H >< S+     0   0    6  495   71                  II  T       K              T        T   T       TNN   
   324  242 B M  T 3< S+     0   0   25  452   39                  II  V       T              M        M   M       V     
   325  243 B K  T <  S+     0   0  153  418   69                  AA          K              R        R   R       S     
   326  244 B T    <         0   0   51  369   66                  TT                         N        N   N             
   327  245 B R              0   0  197  260   47                  NN                         N        N   N             
## ALIGNMENTS  211 -  280
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1   49 A Q              0   0  101  253   29  QH  Q    Q   QHQKQ             QQQ   QQ QQQ H  QH                     
     2   50 A a    >   +     0   0   22  341    0  CC  C  C C   CCCCC             CCCCCCCCCCCCCC CCC                     
     3   51 A E  T 3  S+     0   0  187  342   77  KA  R  L A   AARDA             AQQKKKAALLAALA KAA                     
     4   52 A T  T 3  S-     0   0  105  342   54  LS  S  S E   QSSSQ             SSSSSSEEASESAS SQS                     
     5   53 A S    <   +     0   0   89  342   62  SS  N  N K   KSNNK             PNNNNNKKQSKSQS NKS                     
     6   54 A P        +     0   0   10  343   18  PP  P  P P   PPPPP             CLLPPPPPPPPPPP PPP                     
     7   55 A b        -     0   0   18  344    0  CC  C  C C   CCCCC             CCCCCCCCCCCCCC CCC                     
     8   56 A Q  S    S+     0   0   92  343   70  KE  Q  Q K   SEQQS             EVVLLLKKQKKQQE LSE                     
     9   57 A N  S    S-     0   0   63  303   24  NH  H  N N   .HHN.             ...NNNNNNNNNNH N.H                     
    10   58 A Q  S    S-     0   0  152  336   48  GD  G  G G   NDGNN             HHHGGGGGNGGGND GND                     
    11   59 A G        -     0   0   16  344   17  AG  G  G A   GGGGG             GGGGGGAAGAAGGG GGG                     
    12   60 A K  E     -A   23   0A 117  344   75  TL  T  T M   ALTKA             VEESSSMMVTMSVL SAL                     
    13   61 A a  E     -A   22   0A  45  344    0  CC  C  C C   CCCCC             CCCCCCCCCCCCCC CCC                     
    14   62 A K  E     -A   21   0A 155  344   82  Tt  K  Q S   KtKQK             IVVsssSSVTSKVt sKt                     
    15   63 A X  E     +A   20   0A 120  302   29  Rq  D  H D   DqD.D             DDDeeeDD.RDD.q eDq                     
    16   64 A G        -     0   0   44  341   74  RN  G  T S   NNGDN             GLLGGGSSSHSQSN GNN                     
    17   65 A L  S    S-     0   0  152  342   69  FA  I  H V   IAIII             LFFSSSVVMFVLMA SIA                     
    18   66 A G  S    S+     0   0   67  343   62  ED  G  T G   GDGsG             GQQSSSGGgEGQgD SGD                     
    19   67 A E        -     0   0  119  329   61  TS  R  V G   SSRgS             SDD...GGaTGSaS .SS                     
    20   68 A Y  E     -A   15   0A  37  342    9  YY  Y  Y Y   YYYYY             FYYYYYYYYYFYYY YYY                     
    21   69 A T  E     -A   14   0A  71  343   83  AM  T  M D   SMTIS             TAATTTDDQADIQM TSM                     
    22   70 A b  E     -A   13   0A  20  343    0  CC  C  C C   CCCCC             CCCCCCCCCCCCCC CCC                     
    23   71 A T  E     -A   12   0A  85  344   80  KL  T  V V   ILTLI             ARRFFFVVLKVFLL FIL                     
    24   72 A c        -     0   0   44  344    1  CC  C  C C   CCCCC             CCCCCCCCCCCCCC CCC                     
    25   73 A L    >   -     0   0   62  344   86  AA  A  P K   DAAPD             KNNLLLKKPAKLPA LDA                     
    26   74 A E  T 3  S+     0   0  177  344   74  NP  E  R S   KPEEK             APPPPPSSEHSPEP PKP                     
    27   75 A G  T 3  S+     0   0   29  344   24  GG  A  G G   GGAGG             GGGEEEGGGGGAGG EGG                     
    28   76 A F  E <   +B   36   0B  40  343   16  FF  Y  W F   WFYYW             WYYFFFFFFFFFFF FWF                     
    29   77 A E  E     +B   35   0B  74  343   63  HS  S  E F   ESSEE             EEESSSTTNHTKNS SES                     
    30   78 A G  S >  S-     0   0   32  343    1  GG  G  G G   GGGGG             GGGGGGGGGGGGGG GGG                     
    31   79 A K  T 3  S+     0   0  156  343   72  HR  H  R V   ARHIA             RKKVVVVVRHARRR VAR                     
    32   80 A N  T 3  S-     0   0   33  343   62  NH  D  V H   QHDNQ             FYYDDDHHHNLNHH DQH                     
    33   81 A c  S <  S+     0   0    1  344    0  CC  C  C C   CCCCC             CCCCCCCCCCCCCC CCC                     
    34   82 A E        +     0   0   87  342   30  de  q  s e   neqqn             qeeeeeeeedeEee ene                     
    35   83 A L  E    S-B   29   0B  96  289   42  ll  q  v v   vvqlv             vvvvvvllfllTfv vvv                     
    36   84 A F  E     -B   28   0B 139  292   93  TD  C  S C   KTCTK             STTPPPCCLSCYLP PKP                     
    37   85 A T        -     0   0   44   76   76  ..  .  T .   .....             .............. ...                     
    38   86 A R        +     0   0   57  101   88  S.  .  G .   Y...Y             YAA......S.... .Y.                     
    39   87 A K        +     0   0   96  140   78  N.  .  Q .   ND..N             STTDDD...N...D DND                     
    40   88 A L        -     0   0   91  168   91  GS  .  S .   NS..N             NNNTTT..KG..KS TKS                     
    41   89 A d  S  > S+     0   0   15  238   19  CC  P  C M   CCP.C             CCCCCCVVCCT.CC CCC                     
    42   90 A S  T  4 S+     0   0   98  244   86  RL  S  K L   SLS.S             SSSLLLVVLRLKLL LSL                     
    43   91 A L  T >4 S-     0   0  120  274   90  YH  A  V D   VHA.V             VVVLLLDDYYEDYH LVH                     
    44   92 A D  G >4 S-     0   0  107  297   62  RD  G  N K   DDG.D             NNNEEESSQRKDQD EDD                     
    45   93 A N  G >< S-     0   0    8  315   63  NN  P  N T   NNPRN             NNNNNNDDNNDQNN NNN                     
    46   94 A G  G <  S-     0   0    0  316   53  GG  L  G K   GGLGG             GGGGGGKKGGQLGG GGG                     
    47   95 A D  G <  S+     0   0   44  344   60  GG  A  R G   GGAGG             GDDGGGGGQGGIQG GGG                     
    48   96 A e    <   -     0   0    0  344    1  CC  C  C C   CCCCC             CCCCCCCCCCCCCC CCC                     
    49   97 A D  S    S-     0   0   59  344   73  EE  E  D S   QEEQQ             ADDEEESSQESVQE EQE                     
    50   98 A Q  S    S+     0   0    2  344   62  HH  H  H Q   HHHQH             HHHHHHQQHHQnHH HHH                     
    51   99 A F  E     -C   62   0C   4  344   77  FF  F  Y F   FFFFF             YDDFFFFFFFFyFF FFF                     
    52  100 A d  E     +C   61   0C  10  344    0  CC  C  C C   CCCCC             CCCCCCCCCCCCCC CCC                     
    53  101 A H  E     -C   60   0C  68  344   86  RT  R  E K   KTRHK             LIIHHHKKNRKSNT HKT                     
    54  102 A E  E     -C   59   0C  92  344   56  EE  P  E P   EEPPE             VEEEEEPPSEPDSE EEE                     
    55  103 A E  S    S-     0   0  100  344   81  fQ  s  e g   dQsGd             eggnnnggsfgHsQ ndq                     
    56  104 A Q  S    S-     0   0  175  310   77  dD  .  a q   aD.La             .ddaaat.editeD aa.                     
    57  105 A N  S    S+     0   0  154  307   78  RG  a  g .   qGaRq             dqqrrr.t.R.a.G qqg                     
    58  106 A S  S    S-     0   0   58  337   71  SR  A  g S   CWASC             AWWRRRSSSSSKSR RCR                     
    59  107 A V  E     -C   54   0C   7  343   86  YR  Y  A Y   RRYFR             RRRGGGFFHYYRHR GRR                     
    60  108 A V  E     -C   53   0C  45  344   87  VN  R  V E   YNRKY             RKKNNNVVKVESKN NYN                     
    61  109 A e  E     +C   52   0C   5  344    0  CC  C  C C   CCCCC             CCCCCCCCCCCCCC CCC                     
    62  110 A S  E     -C   51   0C  24  344   70  FS  F  S S   SSFSS             SSSSSSSSYFSQYS SSS                     
    63  111 A f        -     0   0   23  344    0  CC  C  C C   CCCCC             CCCCCCCCCCCCCC CCC                     
    64  112 A A    >   -     0   0    8  344   70  AA  A  A A   AAAAA             ALLAAAAAAAAHAA AAA                     
    65  113 A R  T 3  S+     0   0  149  344   83  PD  R  P R   SDRSS             PNNDDDQQEPREED DSD                     
    66  114 A G  T 3  S+     0   0   24  344   13  GG  G  G G   GGGGG             DGGGGGGGGGGGGG GGG                     
    67  115 A Y  E <   -D   78   0D  20  344    7  YY  Y  Y W   YYYYY             YYYYYYWWYYWYYY YYY                     
    68  116 A T  E     -D   77   0D  72  343   81  RY  T  H K   QYTTQ             KNNDDDKKKGKSKY DQY                     
    69  117 A L  E     -D   76   0D  67  340   68  LL  L  L L   LLLLL             LLLLLLIILLLLLL LLL                     
    70  118 A A    >   -     0   0   23  340   78  DD  N  A E   TDNGT             ADDDDDSSADNLAD DTD                     
    71  119 A D  T 3  S+     0   0  175  340   77  KN  S  R E   NNSEN             DKKVVVSSAQTAAN VNN                     
    72  120 A N  T 3  S-     0   0   92  340   74  DS  D  N K   DGDDD             DNNDDDSSDDDDDG DDG                     
    73  121 A G  S <  S+     0   0   16  340   56  NG  G  R E   HGGDH             HNNGGGDDGNKGGG GHG                     
    74  122 A K  S    S+     0   0   71  332   83  SQ  R  R R   NQRKN             LRRLLLRRRSKVRQ LNQ                     
    75  123 A A        -     0   0   22  330   70  TK  S  S v   MKSSM             QKKSSSttQTQSQK SMK                     
    76  124 A f  E     -D   69   0D  12  300   48  CC  C  C c   CCC.C             CCCCCCccCCCCCC CCC                     
    77  125 A I  E     -D   68   0D  78  304   82  LR  S  M I   TRS.A             ELLKKKVVVLVTVR KTW                     
    78  126 A P  E     -D   67   0D  62  304   56  PS  P  A P   PSP.P             PPPAAAPPAPPPAS APS                     
    79  127 A T  S    S+     0   0  103  304   79  QH  N  M A   VHN.V             VQQKKKTTEQQTEH KVH                     
    80  128 A G  S    S-     0   0   32  305   75  VE  V  E V   VEV.V             VGGEEEGGVVVVVE EVE                     
    81  129 A P  S    S+     0   0  116  311   78  KV  Q  A T   EVQ.E             ITTSSSRREREEEV SEV                     
    82  130 A Y  S    S+     0   0   59  312   77  VF  N  F F   FFN.F             FTTVVVFFFVYYFF VFF                     
    83  131 A P    >   -     0   0   17  312   34  PP  P  P P   PPP.P             PSSAAAPPPPPPPP APP                     
    84  132 A g  T 3  S+     0   0   16  323    2  CC  C  C C   CCCCC             CCCCCCCCCCCCCC CCC                     
    85  133 A G  T 3  S+     0   0    0  295   30  GG  G  G G   GGG G             GGGGGGGGGGGGGG GGG                     
    86  134 A K    <   -     0   0   69  294   62  RK  T  R K   RKT R             RQQMMMKKRRKKRK MRK                     
    87  135 A Q        -     0   0   37  243   74  LV  T  V V   VVT V             ILLVVVVVLPVILV VVV                     
    88  136 A T        +     0   0    4  220   79  QP  E  A     KPE K             QLL   TTPQVPPP  KP                     
    89  137 A L        +     0   0  105  200   57  IL  M  S     MLM M             MII      I I L  ML                     
    90  138 A E              0   0  104  120   71      S  P     D S D             QSS      H      D                      
    91  139 A R              0   0  231   97   28         K                        RR                                    
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3     I I      I     IIIIIIIIIIIII              I   III IIIIIIIIIIIIIIIII
    94   17 B V  B     -E  271   0E   7  561    9     V V      V     IVVVVVVVVVVVV              V   VVV IVVVVVIVVVVVVVVVV
    95   18 B G  S    S+     0   0   25  562    6     G G      G     GGGGGGGGGGGGG              G   GGG GGGGGGGGGGGGGGGGG
    96   19 B G  S    S-     0   0   26  563    0     G G      G     GGGGGGGGGGGGG              G   GGG GGGGGGGGGGGGGGGGG
    97   20 B Q  E     -F  237   0F  98  564   95     K T      S     YYSSSSSSSSSSS              Y   YYY SYRYQYYYYSSSSSSSS
    98   21 B E  E     -F  236   0F  80  565   65     V A      T     NETTTTTTTTTTT              E   EEE AEPETTNTETTTTTTTT
    99   22 B h        -     0   0    8  565   58     C A      T     CCTTTTTTTTTTT              C   CCC ACTCTCCCCTTTTTTTT
   100   23 B K    >   -     0   0  123  564   79     P K      T     PTTTTTTTTTTTT              Q   TKK STGQSPPETTTTTTTTT
   101   24 B D  T 3  S+     0   0   60  565   85     K H      I     RPIIIIIIIIIII              P   PAP LPVPMKRKPIIIIIIII
   102   25 B G  T 3  S+     0   0    0  565   73     G G      Q     NHQQQQQQQQRQQ              N   YYY GYNNNHNNHQQQQQQQQ
   103   26 B E  S <  S+     0   0   36  565   67     E D      N     SSNNNNNNNNNNN              S   SSS NSRSESSSSNNNNNNNN
   104   27 B h    >   +     0   0    4  565   91     C W      Y     LQYYYYYYYYYYY              Q   QQQ FQYQFVLLQYYYYYYYY
   105   28 B P  T 3   +     0   0    0  567    9     P P      P     PPPPPPPPPPPPP              P   PPP PPPPPPPPPPPPPPPPP
   106   29 B W  T 3  S+     0   0    5  568   27     W W      Y     YWYYYYYYYYYYY              W   WHHWWWWWWYYYWYYYYYYYY
   107   30 B Q  E <   -N  122   0G   7  569   24     Q Q      Q     QQQQQQQQQQQQQ              Q   TQQDQTLQmQQQQQQQQQQQQ
   108   31 B A  E     -NO 121 146G   1  559   47     V A      V     VVVVVVAVVVVVV              A   VVV.AVAAsVVVVVVVVVVVV
   109   32 B L  E     -NO 120 145G   3  567   65     L Q      S     SSSSSSSSSSSSS              S   SSS.RSRSYSSSSSSSSSSSS
   110   33 B L  E     -NO 119 144G   0  570   11     L L    MML     LLLLLLLLLLLLL              L   LLLILLLLLLLLLLLLLLLLL
   111   34 B I  E     -NO 117 143G   0  570   81     L R    FFQ     NNQQQQQQQQQQQ              N   NNNRDNVNNNNNNQQQQQQQQ
   112   35 B N  E >   - O   0 142G  30  570   88     V T    RRY     DSYYYYYYYYYYY              S   SSSPGSYSKDDVSYYYYYYYY
   113   36 B E  T 3  S+     0   0   63  113   77     . T    ...     .............              .   .....................
   114   37 B E  T 3  S-     0   0  136  242   76     N S    ..G     ..GGGGGGGGGGG              .   ...G.........G.GGGGGG
   115   38 B N  S <  S+     0   0   84  543   52     G G    ..G     GGGGGGGGGGGGG              G   GGGR.GDG.GGGGGGGGGGGG
   116   39 B E        -     0   0  100  561   93     A F    ..S     TYSSSSSSSSSSS              Y   YYYN.YGY.ITYYSGSSSSSS
   117   40 B G  E     +N  111   0G  14  572   55     Q P    ..H     GHHHHHHHHHHHH              H   HHHRPHQH.SGHHHSHHHHHH
   118   41 B F  E     +     0   0G  28  581   35    LL Yf f ffI     hFIIIIIIIIIII              F   FFFflFfFfhhIFIlIIIIII
   119   42 B i  E     -N  110   0G   0  578    1    CC Cc c ccC     cCCCCCCCCCCCC              C   CCCccCcCcccCCCcCCCCCC
   120   43 B G  E     -N  109   0G   1  581    2    GG GG G SSG     GGGGGGGGGGGGG              G   GGGGGGGGGGGGGGGGGGGGG
   121   44 B G  E     -N  108   0G   0  581    9    AG GG G GGG     GGGGGGGGGGGGG              G   GGGGGGAGGGGGGGGGGGGGG
   122   45 B T  E     -NP 107 130G   0  581   43    ST SS S SSS     SSSSSSSSSSSSS              S   SSSSTSSSTSSSSSSSSSSSS
   123   46 B I  E     + P   0 129G   0  581   23    LL LL L LLI     LLIIIIIIIIIII              L   LLLLLLLLLLLLLIIIIIIII
   124   47 B L        -     0   0    6  581   27    II IL L LLI     IVIIIIIIIIIII              V   VVVLVVIVIIIIVIIIIIIII
   125   48 B S  S    S-     0   0   22  581   57    SN AT T NTS     SSSSSSSSSSSSS              S   SNNTHSSSNNSNSSSSSSSSS
   126   49 B E  S    S+     0   0   99  581   62    DT PK K SGA     DEAAAAAAAAAAA              E   KEEAPEEEDDDKEAAAAAAAA
   127   50 B F  S    S+     0   0   42  581   82    RI QD D RRN     QYNNNNNNDNNNN              Y   DNNESYNYRQQEYNNNNNNNN
   128   51 B Y  E     - Q   0 185G   7  581   33    WW WY Y WWY     WWYYYYYYYYYYY              W   WWWWYWFWYWWWWYYYYYYYY
   129   52 B I  E     -PQ 123 184G   0  581   14    IV IV V VVV     VVVVVVVVVVVVV              V   VVVVVVVVVVVVVVVVVVVVV
   130   53 B L  E     +PQ 122 183G   0  581   28    LV LL L IIL     LVLLLLLLLLLLL              V   VVVVVVLVLLLLVLLLLLLLL
   131   54 B T  E     - Q   0 182G   0  581   43    TS TT S TTT     SSTTTTTTTTTTT              S   SSSTTSTSTSSSSTTTTTTTT
   132   55 B A    >>  -     0   0    0  581    2    AA AA A AAA     AAAAAAAAAAAAA              A   AAAAAAAAAAAAAAAAAAAAA
   133   56 B A  G >4 S+     0   0    0  581    8    AA TA A AAA     AAAAAAAAAAAAA              A   AAAAAAAAAAAAAAAAAAATA
   134   57 B H  G >4 S+     0   0    7  581    0    HH HH H HHH     HHHHHHHHHHHHH              H   HHHHHHHHHHHHHHHHHHHHH
   135   58 B i  G X4 S+     0   0    0  581    2    CC CC C CCC     CCCCCCCCCCCCC              C   CCCCCCCCCCCCCCCCCCCCC
   136   59 B L  G << S+     0   0   31  581   65    IF VV V III     YYIIIIIVIIIII              Y   YYYIFYVYMYYYYIIIIIIII
   137   60 B Y  G <  S+     0   0  109  581   87    FD EK K RRI     KKIIIIIIIIIII              K   KKKLFKRKKKKHKIIIIIIII
   138   61 B Q  S <  S+     0   0   95  581   78    yk rk k eeg     GSggggggggggg              S   SSSeySrSgRGYSgggggggg
   139   61AB A        -     0   0   16  352   75    aw ar r kka     ..aaaaaaaaaaa              .   ...kp.r.w....aaaaaaaa
   140   62 B K  S    S-     0   0  172  366   75    DR SS S DDS     R.SSSSSSSSSSS              .   ...DG.S.F.RQ.SSSSSSSS
   141   63 B R  S    S-     0   0  162  570   78    DN SK K DDQ     KRQQQQQQQQQQQ              R   RRRDHRKRMRKRRQQQQQQQQ
   142   64 B F  E     -O  112   0G  36  577   54    LL II I FFH     LVHHHHHHHHHHH              V   VVVFWVIVILLFVHHHHHHHH
   143   65 B K  E     -O  111   0G  67  577   78    VI VR R IIR     QERRRRRRRRRRR              E   EEEITERERQQQERRRRRRRR
   144   66 B V  E     -OR 110 161G   0  577   16    VA II I VVV     VVVVVVVVVVVVV              V   VVVIIVIVVVVVVVVVVVVVV
   145   67 B R  E     -OR 109 160G  40  577   53    RV RI I RRR     RRRRRRRRRRRRR              R   RRRRRRIRTRRRRRRRRRRRR
   146   68 B V  E     +OR 108 159G   1  578   43    IL LF F LLV     LLVVVVVVVVVVV              L   LLLLLLLLFLLLLVVVVVVVV
   147   69 B G  S    S+     0   0    9  578   14    GG GG G GGG     GGGGGGGGGGGGG              G   GGGGGGGGGGGGGGGGGGGGG
   148   70 B D        +     0   0   11  579   58    KE AD D RRS     EESSSSSSSSSSS              E   EEEKEEDEEEEEESSSSSSSS
   149   71 B R  S    S+     0   0   24  579   73    HH RH H HHT     HHTTTTTTTTTTT              H   HHHLIHHHHHHNHTTTTTTTT
   150   72 B N  B >   -T  234   0H  18  579   65    ND RD D TTN     NNNNNNNNNNNNN              N   NNNSYNDNDNNNNNNNNNNNN
   151   73 B T  T 3  S+     0   0   56  579   79    RL RQ Q TTS     IISSSSSSSSSSS              I   IIISPIQIRIILISSSSSSSS
   152   74 B E  T 3  S-     0   0  119  579   84    RS VE E NEN     KVNNNNNNNNNNN              V   AKQENAFVCDKQVNNNNNNNN
   153   75 B Q  S <  S-     0   0  130  578   86    IE AI I RRS     VLSSSSSSSSSSS              I   VVVRSVIIVVVVLPSSSSSSS
   154   76 B E        +     0   0  165  578   85    HH Tt t VgG     LNGGGGGGGGGGG              N   TTTgQNtNELLINGGGGGGGG
   155   77 B E        -     0   0   93  438   29    ED Ve e Ee.     EE...........              E   EEEeEEdEKEEEE........
   156   78 B G  S    S+     0   0   46  547   33    KG GS S QQG     GGGGGGGGGGGGG              G   GGGENGSGSGGGGGGGGGGGG
   157   79 B G  S    S+     0   0   47  555   76    tD TH Q TTT     GSTTTTTTTTTTT              T   SSSNTSPTPGGSSTTTTTTTT
   158   80 B E        -     0   0   37  444   33    eE EA A EE.     EE...........              E   EEEEEEAEEEEEE........
   159   81 B A  E     -R  146   0G  27  457   60    KQ KI I SR.     QQ...........              Q   QQQRQQIQTQQQQ........
   160   82 B V  E     -R  145   0G  71  557   81    IS DQ Q SSI     FFIIIIIIIIIII              F   FFFSAYMFRFFLFIIIIIIII
   161   83 B H  E     -R  144   0G  14  567   77    AR YR R YYY     IIYYYYCYYYYYY              I   IIITIIRIYIIIIYYYYYYYY
   162   84 B E        -     0   0   90  569   77    LR IA A MMQ     DSQQQQQQQQQQQ              T   SSSTNTATVDDLSQQQQQQQQ
   163   85 B V  E     -S  186   0G  27  574   64    LV VV V VVV     ASVVVVVVVVVVV              S   SSSVASVSVAAASVVVVVVVV
   164   86 B E  E    S+     0   0G  70  575   73    DA TT T EEA     EEAAAAAAAAAAA              E   QSSQAESEREEAEAAAAAAAA
   165   87 B V  E     -S  185   0G  13  576   72    KQ KS A EEQ     KKQQQQQQQQQQQ              K   QRRESKTKVKKKKQQQQQQQQ
   166   88 B V  E     -S  184   0G  72  577   45    IV VV V IIT     IVTTTTTTTTTTT              V   VVVVVVIVMIIVVTTTTTTTT
   167   89 B I  E     +S  183   0G  27  578   45    II II I VII     IIIIIIIIIIIII              I   IIIITIIITIIIIIIIIIIII
   168   90 B K  E     -S  182   0G  68  578   82    II TK K LVV     RRVVVVVVVVVVV              R   RRRIVRRRGRRLRVVVVVVVV
   169   91 B H    >   -     0   0   19  579   14    HP HH H HHH     HHHHHHHHHHHHH              N   HHHHHHHNDHHHHHHHHHHHH
   170   92 B N  T 3  S+     0   0  156  579   60    PS PK K PPA     PPGGGGGGGGGGG              P   PPPPSPRPFPPPPGGGAGAGG
   171   93 B R  T 3  S+     0   0  150  576   74    KT SS S DDS     KNSSSSSSSSSSS              N   SNNNGSNNSDKGNSSSSSSSS
   172   94 B F    <   -     0   0   24  579    5    YY YF F FFY     YYYYYYYYYYYYY              Y   YYYHYYFYFYYFYYYYYYYYY
   173   95 B T     >  -     0   0   56  579   67    nV hD D NNS     NNSSSSSSSSSSS              D   NSSDnNDDLNNNNSSSSSSSS
   174   96 B K  T  4 S+     0   0  145  525   79    kP pP P GGS     DSSSSSSSSSSFS              S   SSSPwSIS.KDRSSSSSSSSS
   175   97 B E  T  4 S+     0   0  174  533   92    EG KD D DNR     KWRRRRRRRRRRR              W   WYYNAWNW.DKEWRRRRRRRR
   176   98 B T  T  4 S-     0   0   44  561   58    NT TT T TTT     TTTTTTTTTTTTT              D   TNNNTTSDNTTTTTTTTTTTT
   177   99 B Y    ><  +     0   0   60  566   66    LT YY Y YYM     AIMMMMMMMMMMM              L   IIIYPIYLFVANIMMMMMMMM
   178  100 B D  T 3   +     0   0   25  578   38    DN SN N EED     DDDDDDDDDDDDD              D   DDDDDDNDEDDDDDDDDDDDD
   179  101 B F  T 3  S+     0   0   21  558   68    RH HN N SSY     NSYYYYYYYYYYY              S   SNNIYSHSNNNNSYYYYYYYY
   180  102 B D    <   +     0   0    1  577    0    DD DD D DDD     DDDDDDDDDDDDD              D   DDDDDDDDDDDDDDDDDDDDD
   181  103 B I        +     0   0    0  579   14    II IV I IIV     IIVVVVVVVVVVV              I   IIIIIIIIIIIIIVVVVVVVV
   182  104 B A  E     -QS 131 168G   0  579   60    AA AA A AAA     MMAAAAAAAAAAA              M   MMMAAMAMAMMMMAAAAAAAA
   183  105 B V  E     -QS 130 167G   0  580   15    LL LL L LLL     LLLLLLLLLLLLL              L   LLLLVLLLLLLLLLLLLLLLL
   184  106 B L  E     -QS 129 166G   0  581   30    LL LL L LLL     IILLLLLLLLLLL              I   IIIVIILILIIIILLLLLLLL
   185  107 B R  E     -QS 128 165G  40  581   42    RR KR R KKR     KKRRRRRRRRRRR              K   KKKRRKKKRKKKKRRRRRRRR
   186  108 B L  E     - S   0 163G   0  581   17    LL LL L LLT     LLTTTTTTTTTTT              L   LLLLLLLLLLLLLTTTTTTTT
   187  109 B K  S    S+     0   0  101  581   69    RH DR R SSS     KSSSSSSSSSSSS              S   SSSARSRSNKKKSSSSSSSSS
   188  110 B T  S    S-     0   0   82  582   74    KQ KK K GGT     SKTTTTTTTTTTT              K   KKKEHKKKESSTKTTTTTTTT
   189  111 B P        -     0   0   48  582   39    PP PP P ppA     PPAAAAAAAAAAA              P   SPPRAAPPRPPPPAAAAAAAA
   190  112 B I        -     0   0    4  532   62    VV VI I vvI     .A...........              A   AAAIAAVAVA.AA........
   191  113 B T        -     0   0   95  537   72    PV LA A TTS     AT...........              T   TTTASTSTPIAIT........
   192  114 B F        +     0   0   56  580   32    FL YF F FFG     ALIIIIIIIIIII              L   LLLFILFLLLALLIIIIIIII
   193  115 B R  B >   -U  196   0I  52  581   64    ST TS S TTS     rNsssssssssss              N   NNNTNNSNSNrNNssssssss
   194  116 B M  T 3  S+     0   0   29  564   77    DD KK K EES     sQsssssssssss              K   QTTDNQKKDSsRQssssssss
   195  117 B N  T 3  S+     0   0   13  572   89    YH NI I HYS     QYSSSSSSSSSSS              Y   YYYYYYHYTQQKYSSSSSSSS
   196  118 B V  B <   +U  193   0I   0  574   26    IV II I IIV     VVVVVVVVVVVVV              V   VVVIVVVVIVVVVVVVVVVVV
   197  119 B A        -     0   0    1  576   81    QV HK K LLA     SQAAAAAAAAAAA              Q   QQQLSQRQRSSAQAAAAAAAA
   198  120 B P        -     0   0    8  576   54    PP PP P PPT     TPTTTTTTTTTTT              P   PPPPPPPPPTTPPTTTTTTTT
   199  121 B A        -     0   0    2  577   39    VL VI V III     IVINIIIIIIIII              V   VVVVLVVVIVIIVIIIIIIII
   200  122 B g  B     -g  290   0F   1  578   67    CC CC C CCG     SAGGGGGGGGGGG              A   AAACSACACSSSAGGGGGGGG
   201  123 B L        -     0   0   27  580    5    LL LL L LLL     LLLLLLLLLLLLL              L   LLLLLLLLLLLLLLLLLLLLL
   202  124 B P        -     0   0    7  581   31    PP PP P PPE     PPEEEEEEEEEEE              P   PPPPPPPPPPPPPEEEEEEEE
   203  124AB E     >  -     0   0   92  580   75    TE ER R EES     TSSSSSSSSSSSS              N   SSTTTSTNTRTRSSSSSSSSS
   204  125 B R  H  > S+     0   0  109  580   79    KR LY Y VVG     SGGGGGGGGGGGG              G   GSSVYGDGMSSSGGGGGGGGG
   205  126 B D  H  > S+     0   0  124  580   85    ET DN N LLV     CCVVVVVVVVVVV              C   CCCEDCNCLCCCCVVVVVVVV
   206  127 B W  H  >>S+     0   0    4  580   87    TF PY Y DDV     PAVVVVVVVVVVV              A   AAADAAFADAPAAVVVVVVVV
   207  128 B A  I  X>S+     0   0    0  580   75    VS ED D AAS     VASSSSSSSSSSS              A   APPAPAGANSVSASSSSSSSS
   208  129 B E  I  <5S+     0   0   75  581   83    QE PP P RRV     TDVVVVVVVVVVV              D   AAARDANDETTTDVVVVVVVV
   209  130 B S  I  <5S+     0   0   70  582   65    SR VA A RRG     GGGGGGGGGGGGG              G   GGGRGGLGYNGGGGGGGGGGG
   210  131 B T  I  <5S+     0   0   18  104   77    LT .. . LL.     .T...........              .   ...L...T....T........
   211  131AB L  I ><  S-     0   0  119  478   80    SL SS S GQS     n.sssssssssss              M   MMMMTMS.KsNs.stssssss
   227  146 B E  T 3  S+     0   0   47  513   76    SD SE E DEE     F.EEEEEEEEEEE              S   SSSQGSE.EIFH.EEEEEEEE
   228  147 B K  T 3  S+     0   0  169  537   69    TR GG G GGG     G.GGGGGGGGGGG              S   SSSDNSG.DGGY.GGGGGGGG
   229  149 B G  S <  S-     0   0   29  548   67    PG GG G EGG     GTGGGGGGGGGGG              T   TTTGGTGTGGGVTGGGGGGGG
   230  150 B R        -     0   0  213  557   86    AA SE E PPS     KASSSSSSSSSSS              A   AAATNAMAKKKDASSSSSFSS
   231  151 B Q  B     -V  224   0J  79  563   93    LT TL L HYA     YDAAAAAAAAAAA              D   DDDFLDLDPYYYDAAAAAAAA
   232  152 B S        -     0   0   14  569   51    PA PP P SSS     PSSSSSSSSSSSS              S   SSSSASPSSPPPSSSSSSSSS
   233  153 B T  S    S+     0   0   48  570   73    TL DS S TTT     ANTTTTTTTTTTT              N   NNNSSNGNCAAKNTTTTTTTT
   234  154 B R  B    S-T  150   0H 102  570   86    YE YI I TTT     IKTTTTTTTTTTT              K   KKKSRKVKLLILKTTTTPPTT
   235  155 B L        -     0   0    3  578    3    LL LV V LLL     LLLLLLLLLLLLL              L   LLLLLLLLLLLLLLLLLLLLL
   236  156 B K  E     -FH  98 221F  31  578   51    QM QN N MMR     QQRRRRRRRRRRR              Q   QQQKMQQQQQQRQRRRRRRRR
   237  157 B M  E     -FH  97 220F  18  579   94    LV QQ Q QKQ     CCQQQQQQQQQQQ              C   CCCEYCECECCCCQQQQQQQQ
   238  158 B L  E     - H   0 219F   4  580   42    VL VV V VVV     LVVVVVVVVVVVV              L   LLLVVLVLVLLLVVVVVVVVV
   239  159 B E  E     - H   0 218F 107  580   72    NN SK K NSI     EEIIIIITTIIII              E   ENNNYEQEEEEHEIIIITITV
   240  160 B V  E     - H   0 217F   0  580   46    LV VV V LLV     AVVVVVVVVVVVV              I   IIIVVIVIVAAVVVVVVVVVV
   241  161 B P  E     - H   0 216F  34  580   26    PP PP P PPP     PPPPPPPPPPPPP              P   PPPPPPPPPPPPPPPPPPPPP
   242  162 B Y  E     -J  263   0F  36  581   45    IR II I VLI     VIIIIIIIIIIII              I   IIIIVIIIVVVLIIIIIIIII
   243  163 B V  E     -J  262   0F  24  582   35    VL RM M VVV     LLVVVVVVVVVVV              L   LLLIMLLLMLLLLVVVVVVVV
   244  164 B D     >  -     0   0   88  581   58    DM SS S SSS     SSSSSSSSSSSSS              S   SSSRNSSSSSSSSSSSARASS
   245  165 B R  H  > S+     0   0   51  581   79    RT RI I LLD     DEDDDDDDDDDDD              D   SYYQRDLDLADDEDDDDDDDD
   246  166 B N  H  > S+     0   0  105  582   75    DQ AT T RGA     TRAAAAAAAAAAA              R   SSSGNSSRQSTARAAAAAAAA
   247  167 B S  H  > S+     0   0   48  582   78    TD RE E RRS     SDSSSSSSSSSSS              D   DDDKTDQDASSEDSSSASASS
   248  168 B j  H  X S+     0   0    1  582    2    CC CC C CCC     CCCCCCCCCCCCC              C   CCCCCCCCCCCCCCCCCCCCC
   249  169 B K  H >< S+     0   0   88  582   73    Kl Dr r rrn     KNnnnnnnnnnnn              N   DNNrNNrNrKKQNnnnnnnnn
   250  170 B L  H 3< S+     0   0  150  547   89    Av Sk k ppy     SNyyyyyyyyyyy              N   KNNaYNkNsKSANyyyyyyyy
   251  171 B S  H 3< S+     0   0   23  578   76    SG SY Y QQA     SSAAAAAAAAAAA              S   SSSHYSYSYSSSSAAAAAAAA
   252  172 B S    <<  -     0   0   20  581   83    TD YK K YYS     YYSSSSSSSSSSS              Y   YYYAMYKYSYYYYSSSSSSSS
   253  173 B S  S    S+     0   0   79  581   83    KS PS S AAY     PPYYYYYYYYYYC              P   PPPRNPAPAPPPPYYYYYYYY
   254  174 B F  S    S-     0   0  124  581   79    IP NT T KGG     GGGGGGGGGGGGG              G   GGGYGGSGRGGSGGGGGGGGG
   255  175 B I        -     0   0  100  582   88    KN KR R DDG     QMGGGGGGGGGGG              M   MMMDAMRMMQQRMGGGGGGGG
   256  176 B I        -     0   0   13  582   16    II II I III     IIIIIIIIIIIII              V   IIIVIIIIIIIIIIIIIIIII
   257  177 B T    >   -     0   0   16  582   36    TT HT T SST     TTTTTTTTTTTTT              T   TTTTTTTTSTTTTTTTTTTTT
   258  178 B Q  T 3  S+     0   0  133  582   68    DE DS T KKA     SNAAAAAAAAAAA              D   NNNKSSVDESSENAAAAAAAA
   259  179 B N  T 3  S+     0   0   24  582   61    NY SS T NNR     STRRRRRRRRRRR              T   TAANRTNTNNSNTRRRRRRRR
   260  180 B M  E <   - K   0 311F   2  582   11    MM MM M MMM     MMMMMMMMMMMMM              M   MMMMMMMMMMMMMMMMMMMMM
   261  181 B F  E     - K   0 310F   8  581   34    FF IL L FFI     FFIIIIIIIIIII              F   FFFFFFMFLFFVFIIIIIIII
   262  182 B j  E     +JK 243 309F   1  582    0    CC CC C CCC     CCCCCCCCCCCCC              C   CCCCCCCCCCCCCCCCCCCCC
   263  183 B A  E     +JK 242 308F   0  582   27    AA AA A AAA     LAAAAAAAAAAAA              A   AAAAAAAAALLAAAAAAAAAA
   264  184 B G  S    S-     0   0    3  582   10    GG GG G GGG     GGGGGGGGGGGGG              G   GGGGGGGGGGGGGGGGGGGGG
   265  185 B Y        -     0   0   56  561   58    YY IR R RRY     FYYYYYYYYYYYY              Y   YYYSYYKYYFFFYYYYYYYYC
   266  185AB D  S    S-     0   0   81  565   84    SS DP P RTT     LLTTTTTTTTTTT              L   LLLEDLGLLLLLLTTTTTTTT
   267  185BB T  S    S+     0   0   76  582   62    pD KA S TSS     EESSSSSSSSSSS              E   EEETSEFEEEEGESSSSSSSS
   268  186 B K  S    S-     0   0  107  532   32    kG G. . GGG     GGGGGGGGGGGGG              G   GGGGGG.GGGGGGGGGGGGGG
   269  187 B Q  S    S+     0   0  102  537   37    RS G. . GGG     GGGGGGGGGGGGG              G   GGGGGG.GQGGGGGGGGGGGG
   270  188 B E        +     0   0   33  581   54    GK IM M RRR     KKRRRRRRRRRRR              K   KKKRRKEKKKKKKRRRRRRRR
   271  189 B D  B     -E   94   0E   7  582    3    DD DD D DDD     DDDDDDDDDDDDD              D   DDDDDDDDDDDDDDDDDDDDD
   272  190 B A        -     0   0    7  582   42    AS AS S AAA     SSAAAAAAAAAAA              S   SSSSSSSSSSSSSAAAAAAAA
   273  191 B k    >   -     0   0    7  582    0    CC CC C CCC     CCCCCCCCCCCCC              C   CCCCCCCCCCCCCCCCCCCCC
   274  192 B Q  T 3  S+     0   0   90  582   25    EK QQ Q EEQ     DQQQQQQQQQQQQ              Q   QQQDQQQQQDDQQQQQQQQQQ
   275  193 B G  T 3  S+     0   0    6  582    7    GG GG G GGG     GGGGGGGGGGGGG              G   GGGGGGGGGGGGGGGGGGGGG
   276  194 B D    X   +     0   0    0  582    0    DD DD D DDD     DDDDDDDDDDDDD              D   DDDDDDDDDDDDDDDDDDDDD
   277  195 B S  T 3  S+     0   0   14  582    1    SS SS S SSS     SSSSSSSSSSSSS              S   SSSSSSSSSSSSSSSSSSSSS
   278  196 B G  T 3  S+     0   0    0  582    0    GG GG G GGG     GGGGGGGGGGGGG              G   GGGGGGGGGGGGGGGGGGGGG
   279  197 B G    <   -     0   0    0  582    2    GG GG G GGG     GGGGGGGGGGGGG              G   GGGGGGGGGGGGGGGGGGGGG
   280  198 B P  E     - L   0 294F   1  582    3    PP PP P PPP     PPPPPPPPPPPPP              P   PPPPPPPPPPPPPPPPPPPPP
   281  199 B H  E     -IL 219 293F   0  582   49    FH ML L FFL     LVLLLLLLLLLLL              V   VVVFLVLVLVVLVLLLLLLLP
   282  200 B V  E     -IL 218 291F   3  582   27    VA VL L AAV     VVVVVVVVVVVVV              V   VVVVAVLVIVAVVVVVVVVVV
   283  201 B T  E     - L   0 290F   0  582   67    MT CL L AAA     CCAAAAAAAAAAA              C   CCCVCCLCTCCCCAAAAAAAA
   284  202 B R  E     + L   0 289F  99  582   70    KH ES S DYN     NNNNNNNNNNNNN              N   NNNYQNNNENNNNNNNNNNNN
   285  203 B F  E >  S- L   0 288F  22  582   70    nY NN N NDG     GGGGGGGGGGGGG              G   GGGDLNtGrGGGGGGGGGGGG
   286  204 B K  T 3  S-     0   0   85  206   71    dR GG G DN.     .............              .   ...NG.g.d............
   287  205 B D  T 3  S+     0   0  108  208   57    NG GV V GG.     .............              .   ...GG.D.K............
   288  206 B T  E <   - L   0 285F   3  218   75    RT RK K RR.     .............              .   ...KT.K.K............
   289  207 B Y  E     - L   0 284F  21  227   50    WW FY Y WW.     .............              .   ...WW.H.Y............
   290  208 B F  E     -gL 200 283F   0  582   91    YY YF F VMR     EQRRRRRRRRRRR              E   AEENTQTEEEEEQRRRRRRRR
   291  209 B V  E     + L   0 282F   1  582   41    QL II I LLL     LLLLLLLLLLLLL              L   LLLLLLILLILLLLLLLLLLL
   292  210 B T  E     +     0   0F   1  582   84    VT HV V LLV     QQVVVVVVVVVVV              H   HQQISHVHIQQQQVVVVVVVV
   293  211 B G  E     -ML 312 281F   0  582    0    GG GG G GGG     GGGGGGGGGGGGG              G   GGGGGGGGGGGGGGGGGGGGG
   294  212 B I  E     -ML 311 280F   0  582   19    II AI I IIV     IIVVVVVVVVVVV              I   IVVIVIIIVIIIIVVVVVVVV
   295  213 B V  E     +M  310   0F   7  582   14    VV TV V VVV     VVVVVVVVVVVVV              V   VVVVVVVVVVVIVVVVVVVVV
   296  214 B S  E     -     0   0F   1  581    0    SS SS S SSS     SSSSSSSSSSSSS              S   SSSSSSSSSSSSSSSSSSSSS
   297  215 B W  E     -M  309   0F  45  582    8    WW WW W WWW     WWWWWWWWWWWWW              W   WWWWWWWWWWWWWWWWWWWWW
   298  216 B G        -     0   0   26  582    0    GG GG G GGG     GGGGGGGGGGGGG              G   GGGGGGGGGGGGGGGGGGGGG
   299  217 B E  S    S-     0   0   25  577   90    EQ YV V DDV     YYVVVVVVVVVVV              Y   YYYDNYVYNSYFYVVVVVVVV
   300  218 B G  S    S-     0   0   19  580   15    GG GG G GGG     GGGGGGGGGGGGG              G   GGGGGGGGGVGGGGGGGGGGG
   301  220 B k  S    S-     0   0    7  582    2    CC CC C CCC     CCCCCCCCCCCCC              C   CCCCCCCCCCCCCCCCCCCCC
   302  221 B A  S    S+     0   0    4  581   17    DA AG G AAA     AAAAAAAAAAAAA              A   AAAAAAGAAAAAAAAAAAAAA
   303  222 B R    >   -     0   0  105  578   74    RT AR R QLR     LERRRRRRRRRRR              E   EEELLERERMLIERRRRRRRR
   304  223 B K  T 3  S+     0   0  152  578   65    DV PE E PQP     RKPPPPPPPPPPP              K   KPPRAKPKPRRKKPPPPPPPP
   305  223AB G  T 3  S+     0   0   26  582   58    GG GG G GGN     GNNINNNNNNNNN              N   NGGDGNGNGGGNNNNNNNNNN
   306  224 B K    <   -     0   0   43  582   85    KH LY Y KKF     KHFFFFFFFFFFF              H   HNNKNHYHYKKYHFFFFFFFF
   307  225 B Y        -     0   0   33  582   49    YF YP P YYP     PPPPPPPPPPPPP              P   PPPYPPPPPPPPPPPPPPPPP
   308  226 B G  E     -K  263   0F   4  580    2    GG GG G GGG     GGGGGGGGGGGGG              G   GGGGGGGGGGGGGGGGGGGGG
   309  227 B I  E     -KM 262 297F   6  581   10    FV VV V VVV     VVVVVVVVVVVVV              V   VVVVIVVVVVVVVVVVVVVVV
   310  228 B Y  E     -KM 261 295F   1  581    2    YY YY Y YYY     YYYYYYYYYYYYY              Y   YYYYYYYYYYYYYYYYYYYYY
   311  229 B T  E     -KM 260 294F   2  581   40    TT AT T TTA     TGAAAAAAAAAAA              G   GAATTGTGTTTTGAAAAAAAA
   312  230 B K  E >   - M   0 293F  21  581   40    HR KR R RRK     KKKKKKKKKKKKK              K   KKKRRKRKRKKKKKKKKKKKK
   313  231 B V  G >  S+     0   0    1  581    8    VV VV V VVV     VVVVVVVVVVVVV              V   VVVVVVVVVVVVVVVVVVVVV
   314  232 B T  G 3  S+     0   0    2  579   72    FS KS S HHS     CCSSSSSSSSSSS              C   CCCHTCTCTCCCCSSSSSSSS
   315  233 B A  G <  S+     0   0   29  579   80    RQ YK K YRA     NMAAAAAAAAAAA              M   SIIRQSRMRNNNMAAAAAAAA
   316  234 B F  S <> S+     0   0    7  575   36    LY LF F FFV     FFVVVVVVVVVVV              F   FFFFFFYFYYFYFVVVVVVVV
   317  235 B L  H  > S+     0   0   23  573   81    KI LI I RRR     LSRRRRRRRRRRR              S   SNNRRSLSMLLVSRRRRRRRR
   318  236 B K  H  > S+     0   0  116  572   68    KE PP P DES     SQSSSSSSSSSSS              Q   QNDDSQEQDSSDQSSSSSSSS
   319  237 B W  H  > S+     0   0   26  572    1    WW WW W WWW     WWWWWWWWWWWWW              W   WWWWWWWWWWWWWWWWWWWWW
   320  238 B I  H  X S+     0   0    1  569   12    LL II I III     IIIIIIIIIIIII              I   ILLLLILIIIIIIIIIIIIII
   321  239 B D  H  < S+     0   0   66  541   72    KQ KK K V Q     RAQQQQQQQQQQQ              A   ATTQSAHALQREAQQQQQQQQ
   322  240 B R  H >< S+     0   0  136  528   71    KK DS S T S     EDSSSSSSSSSSS              D   DSSEQDRDKEEEDSSSSSSSS
   323  241 B S  H >< S+     0   0    6  495   71    TL EN N N N     TTNNNNNNNNNNN              T   TTTYNTNTHTTMTNNNNNNNN
   324  242 B M  T 3< S+     0   0   25  452   39    VM ML L I       MM                         M   MMMI IMMSMMIMFFF FF  
   325  243 B K  T <  S+     0   0  153  418   69    ER AE D         AK                         R   SAA  SQRKAAVQ     G  
   326  244 B T    <         0   0   51  369   66    KS KN N         AN                         N   NTT  SNNDNAAN        
   327  245 B R              0   0  197  260   47    HE N            NN                         N   N    N N NNNN        
## ALIGNMENTS  281 -  350
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1   49 A Q              0   0  101  253   29   QQQ   QQQQQQ                                              QQ       Q 
     2   50 A a    >   +     0   0   22  341    0   CCC   CCCCCC   CC    C                                    CC      CC 
     3   51 A E  T 3  S+     0   0  187  342   77   KDD   AAAAAA   VV    V                                    AA      QD 
     4   52 A T  T 3  S-     0   0  105  342   54   LNN   EEEEEE   SS    S                                    EE      TN 
     5   53 A S    <   +     0   0   89  342   62   SNN   KKKKKK   QQ    Q                                    NN      NN 
     6   54 A P        +     0   0   10  343   18   PMM   PPPPPP   PP    P                                    PP      PM 
     7   55 A b        -     0   0   18  344    0   CCC   CCCCCC   CC    C                                    CC      CC 
     8   56 A Q  S    S+     0   0   92  343   70   KVV   KKKKKK   LL    L                                    KK      QV 
     9   57 A N  S    S-     0   0   63  303   24   N..   NNNNNN   NN    N                                    NN      N. 
    10   58 A Q  S    S-     0   0  152  336   48   GNN   GGGGGG   NN    N                                    GG      GN 
    11   59 A G        -     0   0   16  344   17   AGG   AAAAAA   GG    G                                    AA      GG 
    12   60 A K  E     -A   23   0A 117  344   75   TTT   MMMMMM   TT    T                                    MM      RT 
    13   61 A a  E     -A   22   0A  45  344    0   CCC   CCCCCC   CC    C                                    CC      CC 
    14   62 A K  E     -A   21   0A 155  344   82   TVV   SSSSSS   EE    E                                    SS      TV 
    15   63 A X  E     +A   20   0A 120  302   29   RDD   DDDDDD   DD    D                                    DD      VD 
    16   64 A G        -     0   0   44  341   74   RKK   SSSSSS   HH    H                                    SS      EK 
    17   65 A L  S    S-     0   0  152  342   69   FYY   VVVVVV   II    I                                    VV      RY 
    18   66 A G  S    S+     0   0   67  343   62   EQQ   GGGGGG   RR    R                                    GG      GQ 
    19   67 A E        -     0   0  119  329   61   TAA   GGGGGG   SS    S                                    GG      AA 
    20   68 A Y  E     -A   15   0A  37  342    9   YYY   YYYYYY   YY    Y                                    YY      SY 
    21   69 A T  E     -A   14   0A  71  343   83   AAA   DDDDDD   SS    S                                    DD      VA 
    22   70 A b  E     -A   13   0A  20  343    0   CCC   CCCCCC   CC    C                                    CC      CC 
    23   71 A T  E     -A   12   0A  85  344   80   KSS   VVVVVV   TT    T                                    VV      LS 
    24   72 A c        -     0   0   44  344    1   CCC   CCCCCC   CC    C                                    CC      CC 
    25   73 A L    >   -     0   0   62  344   86   ANN   KKKKKK   SS    S                                    KK      PN 
    26   74 A E  T 3  S+     0   0  177  344   74   NHH   SSSSSS   PP    P                                    SS      PH 
    27   75 A G  T 3  S+     0   0   29  344   24   GGG   GGGGGG   GG    G                                    GG      QG 
    28   76 A F  E <   +B   36   0B  40  343   16   FYY   FFFFFF   YY    Y                                    FF      YY 
    29   77 A E  E     +B   35   0B  74  343   63   HEE   TTTTTT   EE    E                                    TT      GE 
    30   78 A G  S >  S-     0   0   32  343    1   GGG   GGGGGG   GG    G                                    GG      GG 
    31   79 A K  T 3  S+     0   0  156  343   72   HRR   VVVVVV   KK    K                                    VV      KR 
    32   80 A N  T 3  S-     0   0   33  343   62   NYY   HHHHHH   TT    T                                    HH      TY 
    33   81 A c  S <  S+     0   0    1  344    0   CCC   CCCCCC   CC    C                                    CC      CC 
    34   82 A E        +     0   0   87  342   30   ddd   eeeeee   aa    a                                    ee      ed 
    35   83 A L  E    S-B   29   0B  96  289   42   vll   llllll   ll    l                                    tt      vl 
    36   84 A F  E     -B   28   0B 139  292   93   PTT   CCCCCC   EE    E                                    LL      NT 
    37   85 A T        -     0   0   44   76   76   ...   ......   ..    .                                    ..      .. 
    38   86 A R        +     0   0   57  101   88   .AA   ......   ..    .                                    ..      .A 
    39   87 A K        +     0   0   96  140   78   DTT   ......   ..    .                                    ..      .T 
    40   88 A L        -     0   0   91  168   91   TNN   ......   ..    .                                    CC      AN 
    41   89 A d  S  > S+     0   0   15  238   19   CCC   VVVVVV   ..    .                                    TT      CC 
    42   90 A S  T  4 S+     0   0   98  244   86   LSS   VVVVVV   ..    .                                    WW      RS 
    43   91 A L  T >4 S-     0   0  120  274   90   LLL   DDDDDD   ..    .                                    KK      HL 
    44   92 A D  G >4 S-     0   0  107  297   62   EDD   SSSSSS   RR    R                                    NN      RD 
    45   93 A N  G >< S-     0   0    8  315   63   NNN   DDDDDD   TT    T                                    KK      NN 
    46   94 A G  G <  S-     0   0    0  316   53   GGG   KKKKKK   DD    D                                    TT      GG 
    47   95 A D  G <  S+     0   0   44  344   60   GNN   GGGGGG   GG    G                                    GG      GN 
    48   96 A e    <   -     0   0    0  344    1   CCC   CCCCCC   CC    C                                    CC      CC 
    49   97 A D  S    S-     0   0   59  344   73   EDD   SSSSSS   QQ    Q                                    SS      LD 
    50   98 A Q  S    S+     0   0    2  344   62   HHH   QQQQQQ   HH    H                                    QQ      QH 
    51   99 A F  E     -C   62   0C   4  344   77   FEE   FFFFFF   FF    F                                    FF      YE 
    52  100 A d  E     +C   61   0C  10  344    0   CCC   CCCCCC   CC    C                                    CC      CC 
    53  101 A H  E     -C   60   0C  68  344   86   HTT   KKKKKK   HH    H                                    KK      ST 
    54  102 A E  E     -C   59   0C  92  344   56   EDD   PPPPPP   PP    P                                    PP      ED 
    55  103 A E  S    S-     0   0  100  344   81   ngg   gggggg   GG    G                                    gg      Pg 
    56  104 A Q  S    S-     0   0  175  310   77   add   tttttt   QQ    Q                                    ..      pd 
    57  105 A N  S    S+     0   0  154  307   78   rlg   ......   SS    S                                    tt      gl 
    58  106 A S  S    S-     0   0   58  337   71   RTt   SSSSSS   SS    S                                    SS      AT 
    59  107 A V  E     -C   54   0C   7  343   86   GRR   FFFFFF   YY    Y                                    YY      VR 
    60  108 A V  E     -C   53   0C  45  344   87   NRR   VVVVVV   MM    M                                    EE      AR 
    61  109 A e  E     +C   52   0C   5  344    0   CCC   CCCCCC   CC    C                                    CC      CC 
    62  110 A S  E     -C   51   0C  24  344   70   SGG   SSSSSS   SS    S                                    SS      GG 
    63  111 A f        -     0   0   23  344    0   CCC   CCCCCC   CC    C                                    CC      CC 
    64  112 A A    >   -     0   0    8  344   70   AVV   AAAAAA   AA    A                                    AA      AV 
    65  113 A R  T 3  S+     0   0  149  344   83   DNN   QQQQQQ   KK    K                                    RR      DN 
    66  114 A G  T 3  S+     0   0   24  344   13   GGG   GGGGGG   GG    G                                    GG      GG 
    67  115 A Y  E <   -D   78   0D  20  344    7   YYY   WWWWWW   YY    Y                                    WW      YY 
    68  116 A T  E     -D   77   0D  72  343   81   DNN   KKKKKK   KK    K                                    KK      EN 
    69  117 A L  E     -D   76   0D  67  340   68   LLL   IIIIII   LL    L                                    LL      LL 
    70  118 A A    >   -     0   0   23  340   78   DQQ   SSSSSS   GG    G                                    SS      EQ 
    71  119 A D  T 3  S+     0   0  175  340   77   VDD   SSSSSS   KK    K                                    RR      PD 
    72  120 A N  T 3  S-     0   0   92  340   74   DDD   SSSSSS   DD    D                                    TT      DD 
    73  121 A G  S <  S+     0   0   16  340   56   GSS   DDDDDD   QQ    Q                                    TT      GS 
    74  122 A K  S    S+     0   0   71  332   83   LRR   RRRRRR   KK    K                                    RR      RR 
    75  123 A A        -     0   0   22  330   70   STT   tttttt   SS    S                                    dd      ST 
    76  124 A f  E     -D   69   0D  12  300   48   CCC   cccccc   CC    C                                    cc      CC 
    77  125 A I  E     -D   68   0D  78  304   82   KRR   VVVVVV   GG    G                                    EE      SR 
    78  126 A P  E     -D   67   0D  62  304   56   APP   PPPPPP   PP    P                                    PP      QP 
    79  127 A T  S    S+     0   0  103  304   79   KKK   TTTTTT   SS    S                                    AA      TK 
    80  128 A G  S    S-     0   0   32  305   75   EGG   GGGGGG   DD    D                                    VV      AG 
    81  129 A P  S    S+     0   0  116  311   78   SPP   RRRRRR   KK    K                                    PP      TP 
    82  130 A Y  S    S+     0   0   59  312   77   VSS   FFFFFF   CC    C                                    YY      FS 
    83  131 A P    >   -     0   0   17  312   34   ASS   PPPPPP   AA    A                                    PP      PS 
    84  132 A g  T 3  S+     0   0   16  323    2   CCC   CCCCCC   CC    C                                    CC      CC 
    85  133 A G  T 3  S+     0   0    0  295   30   GGG   GGGGGG   GG    G                                    GG      GG 
    86  134 A K    <   -     0   0   69  294   62   MQQ   KKKKKK   AA    A                                    KK      TQ 
    87  135 A Q        -     0   0   37  243   74   VLL   VVVVVV   LL    L                                    VV      NL 
    88  136 A T        +     0   0    4  220   79    LL   TTTTTT   TT    T                                            GL 
    89  137 A L        +     0   0  105  200   57    II            SS    S                                            SI 
    90  138 A E              0   0  104  120   71    GG            EE    E                                            EG 
    91  139 A R              0   0  231   97   28    RR            HH    H                                            HR 
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3  I   III      III   III III IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIII  IIIIII  I
    94   17 B V  B     -E  271   0E   7  561    9  V   VVV      VVV   VVV VVV VVVVVVVVVVVIVIIIVVVVVVVVVVVIVVVV  VIVVVV  V
    95   18 B G  S    S+     0   0   25  562    6  G   GGG      GGG   EEG GGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGG  G
    96   19 B G  S    S-     0   0   26  563    0  G   GGG      GGG   GGG GGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGG  G
    97   20 B Q  E     -F  237   0F  98  564   95  F   YYY      YKY   SSI YYV TYSRVYYYYYYRYFTEHNYYRRQYRYYYEYYY  YYSSYY  Y
    98   21 B E  E     -F  236   0F  80  565   65  E   EEE      EPT   DDA TTV NEPPEEEEEEEPEEEPADEEPPKEPTETTTEE  TTTTEE  E
    99   22 B h        -     0   0    8  565   58  C   CCC      CTC   AAV CCA ACATACCCCCCACAAATTCCTTACTCCCCCCC  CCTTCC  C
   100   23 B K    >   -     0   0  123  564   79  Q   LLL      TGK   EED PPK ARTGKKKKKKKATTTDTDKKLEKKLAA.QEKR  APTTTT  L
   101   24 B D  T 3  S+     0   0   60  565   85  K   KKK      PVE   III KKP SKAVRAAAAAARPPPIIIAAPAAPPAPEEEAK  PKIIPP  K
   102   25 B G  T 3  S+     0   0    0  565   73  N   NNN      YNG   GGS HHG GNGNNYYYYYHGHGGLESYYNYGYNNHNANYN  NNQQHH  N
   103   26 B E  S <  S+     0   0   36  565   67  S   SSS      SQS   MME SLA ASQQSSSSSSSRSSSDEDSSKDESRSSSSSSS  SSYNSS  S
   104   27 B h    >   +     0   0    4  565   91  V   VVV      QYV   SSV VVW AVAYIQQQQQQWQVFFHVQQYYCQYVKLVVQV  LLYFQQ  V
   105   28 B P  T 3   +     0   0    0  567    9  P   PPP      PPP   PPP PPP PAPPPPPAAPPPAPPPPPPPPPPPPPPPPPPP  PPPPPP  P
   106   29 B W  T 3  S+     0   0    5  568   27  Y   YYY      WWY   WWY YYW HYYWWHHHHHWWHWWWHYHHWWYHWYWYYYWY  YYYYHH  Y
   107   30 B Q  E <   -N  122   0G   7  569   24  Q   QQQ      TMQ   QQQ QQq QQQLqQQQQQQqQQMqQQQQVmQQIQQqQQQQ  QQLQQQ  Q
   108   31 B A  E     -NO 121 146G   1  559   47  V   AAA      VAV   VVV VVi VVVAaVVVVVVaVVVsVVVVAgIVAVVsVVVV  VVVVVV  A
   109   32 B L  E     -NO 120 145G   3  567   65  S   SSS      SRS   MMS SSW SSSRLSSSSSSVSSSISASSRLSSRSHLSSSS  SSSSSS  S
   110   33 B L  E     -NO 119 144G   0  570   11  L   LLL      LIL   LLL LLA LLLLFLLLLLLLLLILVVLLLLLLLLLNLLLL  LLLLLL  L
   111   34 B I  E     -NO 117 143G   0  570   81  F   FFF      NIN   FFQ NHK QNQVKNNNNNNNNQQYIFNNVYQNVNNVNNNN  NNQQNN  F
   112   35 B N  E >   - O   0 142G  30  570   88  T   TTT      SYS   rRR DDg RSQYHSSSSSVRSRQFYSSSYKSSYAYGASSG  ADYYSA  T
   113   36 B E  T 3  S+     0   0   63  113   77  .   ...      ...   sK. ..d ................................  ......  .
   114   37 B E  T 3  S-     0   0  136  242   76  .   ...      ...   PSY ..K ...........R.SN.I.........K.....  ..GG..  .
   115   38 B N  S <  S+     0   0   84  543   52  G   GGG      GDG  QQPN GGG SGSD.GGGGGGRGGGGDKGGDGSGDGG.GGGG  GGGGGG  G
   116   39 B E        -     0   0  100  561   93  Y   YYY      YGY  EEQS IIA SYRGNYYYYYYEYSYKSGYYGASYGYSYYYYY  YSSSYY  Y
   117   40 B G  E     +N  111   0G  14  572   55  N   NNN      HKH  LLEH SSQHHHHQRHHHHHHPHHHHHVHHRLHHRHFHHHHH  HHHHHH  N
   118   41 B F  E     +     0   0G  28  581   35  Y   FFF      FfF  LLlS hhFFFFFffFFFFFFFFFILYfFFfYFFfFFIFFFF  FFIIFF  F
   119   42 B i  E     -N  110   0G   0  578    1  C   CCC      CcC  CCcC ccCCCCCccCCCCCCCCCCCCcCCcCCCcCCCCCCC  CCCCCC  C
   120   43 B G  E     -N  109   0G   1  581    2  G   GGG      GGG  AGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGG  G
   121   44 B G  E     -N  108   0G   0  581    9  G   GGG      GGG  AAAG GGGAGGGAGGGGGGGGGGGGGGGGAAGGAGGGGGGG  GGGGGG  G
   122   45 B T  E     -NP 107 130G   0  581   43  T   III      SSS  SSSS SSSTSSTSSSSSSSSTSTTSSSSSSTTSSSSSSASS  SSSSSS  I
   123   46 B I  E     + P   0 129G   0  581   23  L   LLL      LLL  LLLI LLLLILILLLLLLLLLLLLIIILLLLILLLLLLLLL  LLIILL  L
   124   47 B L        -     0   0    6  581   27  L   LLL      VLI  IIII IIIIIIVLIVVVVVVVVLLLIVVVLILVLIIIIIVI  IIIIVV  L
   125   48 B S  S    S-     0   0   22  581   57  S   SSS      STS  SSSS SSDTSSSTNNNNNNNSSNNSHSNNNNDNNNANNSNS  NTSSNN  S
   126   49 B E  S    S+     0   0   99  581   62  E   EEE      EKN  DDDS DDPNDSKRSEEEEERAASSRTPEENDEENSPEEEES  EDAAEQ  E
   127   50 B F  S    S+     0   0   42  581   82  Q   EEE      YDQ  RRRN QQERRTDDRNNNNNDGNQHWRDNNDRYNDQREQQNT  QQNNNN  E
   128   51 B Y  E     - Q   0 185G   7  581   33  W   WWW      WYW  WWWY WWWWWWWYWWWWWWWWWWWWFVWWYYWWYWWWWWWW  WWYYWW  W
   129   52 B I  E     -PQ 123 184G   0  581   14  V   VVV      VVV  VVVI VVVLIVIVVVVVVVVVVVVIIIVVVVIVVVIVVVVV  VVVVVV  V
   130   53 B L  E     +PQ 122 183G   0  581   28  L   LLL      VLV  LLLL LLLILVVLLVVVVVVLVLLLLVVVIVLVIVVLVVVV  VVLLVV  L
   131   54 B T  E     - Q   0 182G   0  581   43  S   SSS      SSS  TTTT SSTTTSTTTSSSSSSTSSSTTTSSTTTSTSSSSSSS  SSTTSS  S
   132   55 B A    >>  -     0   0    0  581    2  A   AAA      AAA  AAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA  AAAAAA  A
   133   56 B A  G >4 S+     0   0    0  581    8  A   AAA      AAA  AAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGAA  AAAAAA  A
   134   57 B H  G >4 S+     0   0    7  581    0  H   HHH      HHH  HHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH  HHHHHH  H
   135   58 B i  G X4 S+     0   0    0  581    2  C   CCC      CCC  CCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCC  C
   136   59 B L  G << S+     0   0   31  581   65  E   KKK      YVY  LLLT YYFVVYVVLYYYYYYVYLQFTLYYVVVYVYYYYYYY  YYIIYY  K
   137   60 B Y  G <  S+     0   0  109  581   87  P   AAA      KKK  LLLD KKEYSKDRPKKKKKKRKVAIYHKKRDNKRKLSMKKK  KKIIKQ  A
   138   61 B Q  S <  S+     0   0   95  581   78  K   DDD      SkS  yyyq RRiggSgrsSTSSSTRSSSnqwSSrggSnSLRSPSS  SRggSS  D
   139   61AB A        -     0   0   16  352   75  .   ...      .r.  veev ..kpa.ara.........Akaf..rma.r.P.....  ..aa..  .
   140   62 B K  S    S-     0   0  172  366   75  S   ...      .S.  NNNS ..SSS.SNS.........SSEE..SES.S.KK....  ..SS..  .
   141   63 B R  S    S-     0   0  162  570   78  N   ...      RKR  DDDS RKQLQRAKSRRRRRHRRGSGDDRRKSKRKRYSRRRR  RQQQRR  .
   142   64 B F  E     -O  112   0G  36  577   54  L   LLL      VII  ILLL LLYILILILVVVVVILVMLLLVVVIILVIIVFIIVI  IFHHVV  L
   143   65 B K  E     -O  111   0G  67  577   78  E   EEE      ERQ  LLLS QQMKNQKRHAEEEEEIETRELIEERHSERQVQQQQQ  QQRREE  E
   144   66 B V  E     -OR 110 161G   0  577   16  V   VVV      VIV  VVVV VVLVIVIVVVVVVVVVVVIIVVVVVVIVVVAVVVVV  VVVVVV  V
   145   67 B R  E     -OR 109 160G  40  577   53  R   RRR      RIR  RRRR RRRRRRRVRRRRRRRLRVIIRRRRILRRVRHRRRRR  RHRRRR  R
   146   68 B V  E     +OR 108 159G   1  578   43  L   LLL      LFL  IIIA LLLLYLYLLLLLLLLALAVHAALLLLYLLLILLLML  LLVVLL  L
   147   69 B G  S    S+     0   0    9  578   14  G   GGG      GGG  GGGG GGGGNGNGGGGGGGGGGGGGGGGGGGNGGGGGGGGG  GGGGGG  G
   148   70 B D        +     0   0   11  579   58  E   EEE      EDE  KKKS EEEKTETDEEEEEEEEEEEESSEEDGSEDEMEEEEE  EDSSEE  E
   149   71 B R  S    S+     0   0   24  579   73  H   HHH      HHY  YHHS HHHHLHLHHHHHHHHHHHHRTSHHYHLHYHHNHHHH  HHTTHH  H
   150   72 B N  B >   -T  234   0H  18  579   65  D   NNN      NDN  ASSF NNNITNSDNNNNNNNSNDNRMNNNDDKNDNDNNNDN  NNNFNH  N
   151   73 B T  T 3  S+     0   0   56  579   79  I   III      IQI  RRRY IIFRHIHQLIIIIIILILFVVSIIQLHLQIVIIIII  IISSLI  I
   152   74 B E  T 3  S-     0   0  119  579   84  W   WWW      AEE  STTS DHNQNANFIKKKKKQHKSGGNRKKYEARYESREKTA  DDNNRR  W
   153   75 B Q  S <  S-     0   0  130  578   86  E   EEE      VIE  RRRR VVEKSVSISVVVVVVRVRSTSSVVVNSVVVKVVVYV  VISSVN  E
   154   76 B E        +     0   0  165  578   85  P   PPP      NtV  YYYG LLDIGNGaNTTTTTTRTNLKGGTTNvGTNLAITLSN  IIGGTN  P
   155   77 B E        -     0   0   93  438   29  E   DDD      EeE  EEE. EEEE.E.eDEEEEEEEEDEN..EETe.ETEEEEEEE  EE..ED  D
   156   78 B G  S    S+     0   0   46  547   33  G   GGG      GSG  RRRG GGGKGGGTGGGGGGNGGGGLGGGGDE.GDGGGGGGG  GGGGGG  G
   157   79 B G  S    S+     0   0   47  555   76  T   TTT      SQN  nnnV GGTTSTSTSSSSSSTSNHTRQISSgE.KgNTNNNST  GGTTKT  T
   158   80 B E        -     0   0   37  444   33  E   EEE      EAE  eee. EEEE.E.AEEEEEEEEEEE...EEpLGEpEVEEEEE  EE..EE  E
   159   81 B A  E     -R  146   0G  27  457   60  Q   QQQ      QIQ  KKK. QQQQ.Q.IQQQQQQQQQQQ...QQIEEQVQQQQQQQ  QQ..QQ  Q
   160   82 B V  E     -R  145   0G  71  557   81  H   HHH      YQF  IIIV FFDSVFLQVFFFFFFEFSS.VTFFMLKFMFIFFFFF  FFIIFF  H
   161   83 B H  E     -R  144   0G  14  567   77  I   III      IRI  SSSV IIFYVIVRIIIIIIIVIRTMRVIIRRLIRIIIIIII  IIYYII  I
   162   84 B E        -     0   0   90  569   77  M   MMM      TAN  TMMG DDYDKNQASSSSSSPRSGGKGGSSAASRADQDDHSS  DDQNRT  M
   163   85 B V  E     -S  186   0G  27  574   64  S   SSS      SVS  LLLV AAIAASAVVSSSSSSVSVVVVVSSVVVSVSVVSASS  SVVASS  S
   164   86 B E  E    S+     0   0G  70  575   73  A   SSS      ETA  EEEK EEEESAATSSSSSSTSSEQDAKSSSVASSAEAEASA  AAAASS  S
   165   87 B V  E     -S  185   0G  13  576   72  K   KKK      KAK  KKKR KKKMKKQAARRRRRVRRREKQTRRVRQRAKKKKKRK  KKQQRR  K
   166   88 B V  E     -S  184   0G  72  577   45  F   FFF      VVV  IIIV IIYYIVIIIVVVVVVTVIVLICVVVMIVVVSIVIVV  VVTVVV  F
   167   89 B I  E     +S  183   0G  27  578   45  I   VVV      III  IYYI IIYKIIIIYIIIIIIVIIIIFEIIIVYIVIFIIIII  IIIIII  V
   168   90 B K  E     -S  182   0G  68  578   82  R   RRR      RKR  IIIQ RRIIPRSRRRRRRRKLRPPTQSRRRKQRRRQLRRRR  RIVRRR  R
   169   91 B H    >   -     0   0   19  579   14  H   HHH      HHH  HHHH HHHHHHHHHHHHHHNHHHHHHHHHHHHHHHHHHHHH  HHHHHH  H
   170   92 B N  T 3  S+     0   0  156  579   60  P   PPP      PKP  PPPP PPPPTPERPPPPPPPPPPPPKPPPKPEPRPYPPPPP  PPGAPP  P
   171   93 B R  T 3  S+     0   0  150  576   74  N   QQQ      SSS  GRRL DEKHSRKSQNNNNNGDNNNYNKNNNKKENNKGGKNN  NESSES  Q
   172   94 B F    <   -     0   0   24  579    5  Y   YYY      YFY  YYYF YYYYYYYFYYYYYYYYYYFFFYYYFFYYFYYFYYYY  YYYYYY  Y
   173   95 B T     >  -     0   0   56  579   67  D   NNN      NDS  nnnN NNDSSSDDSSSSSSDDTNDDDNSSDEDSDNNNSNSS  NTSNSN  N
   174   96 B K  T  4 S+     0   0  145  525   79  P   PPP      SPS  rrrY KKEPSSSQ.SSSSSSP.DPSIRSSMPSSMSSMFNSS  S.SSSS  P
   175   97 B E  T  4 S+     0   0  174  533   92  R   RRR      WDQ  EEEN DDKDSRYN.YYYYYWE.NLWDTYYNKWYNYSNWEYY  YSRRYY  R
   176   98 B T  T  4 S-     0   0   44  561   58  T   TTT      TTT  NNNT TTTSTNNSGNNNNNTTSTTFTTNNSTTNSTSNTTNS  MITTNT  T
   177   99 B Y    ><  +     0   0   60  566   66  Q   QQQ      IYL  LLLI VLTYILIYLIIIIILVYLFLYVIIYFIIYIILLLIL  IYMLII  Q
   178  100 B D  T 3   +     0   0   25  578   38  D   DDD      DND  DDDD DDDDDDDNNDDDDDDDnDDDDDDDNNDNNDDDDDDD  DNDDDD  D
   179  101 B F  T 3  S+     0   0   21  558   68  N   SSS      SNN  RRRY NNNSYNHHRNNNNNSMnNNNYFNNHNNNHNNNNNNN  NHYYNN  S
   180  102 B D    <   +     0   0    1  577    0  D   DDD      DDD  DDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD  DDDDDD  D
   181  103 B I        +     0   0    0  579   14  I   III      III  IIIF IIMIIIIIVIIIIIILIIIIIIIIVIIIVIIIIIII  IIVIII  I
   182  104 B A  E     -QS 131 168G   0  579   60  M   MMM      MAM  AAAA MMAAAMAAGMMMMMMAMMMASAMMAAAMAMMMMMMM  MMAGMM  M
   183  105 B V  E     -QS 130 167G   0  580   15  L   LLL      LLL  LLLI LLLLLLILLLLLLLLLLLLLVVLLLILLLLLLLLLL  LLLLLL  L
   184  106 B L  E     -QS 129 166G   0  581   30  I   III      ILI  MMML IIIIIIILMIIIIIILIIILLCIILLIILIILIVII  IVLIII  I
   185  107 B R  E     -QS 128 165G  40  581   42  K   KKK      KRK  KKKE KKKRQKKKKKKKKKKRKKRLKRKKKQKKKKKKKKKK  KKRRKK  K
   186  108 B L  E     - S   0 163G   0  581   17  L   LLL      LLL  LLLL LLLLTLLLLLLLLLLLLLLLLLLLLFLLLLLLLLLL  LLTTLL  L
   187  109 B K  S    S+     0   0  101  581   69  S   SSS      SRS  KKKK KKDASSARSSSSSSSRSSSKSKSSRDQSRKAKKSSS  KKSSSS  S
   188  110 B T  S    S-     0   0   82  582   74  E   RRR      KKS  KKKS SSRQTKTKRKKKKKKSESYSETKKKESEKTETTTSK  TRTSET  R
   189  111 B P        -     0   0   48  582   39  P   PPP      APT  PPPP PPPPPPSPPPPPPPPPPPPPSPPPSPPPSPPPPPPP  PPAGPP  P
   190  112 B I        -     0   0    4  532   62  A   AAA      AIA  VVVL AAAVLALVAAAAAAALAVVFLLAAVIMAVAAAVAVA  AA..AA  A
   191  113 B T        -     0   0   95  537   72  T   TTT      TAT  AAAK IVTTTTTDTTTTTTTPTTTKVKTTKPTTKTQIIITT  TT.ITT  T
   192  114 B F        +     0   0   56  580   32  L   LLL      LFL  FFFF LLLFLLLFILLLLLLMLIILLFLLFFLLFLFLLILL  LIIVLL  L
   193  115 B R  B >   -U  196   0I  52  581   64  N   NNN      NSN  SSSS NNNTgNeTNNNNNNNGNSNDGNNNSSdNSNNNNNNN  SNsgNN  N
   194  116 B M  T 3  S+     0   0   29  564   77  S   SSS      QKS  DDDK SSKDaStKSTTTTTAAQSTASSTTKRkQKSHDDAQS  SSssQQ  S
   195  117 B N  T 3  S+     0   0   13  572   89  F   FFF      YIR  YYYN QQRYNYNTKYYYYYYFYWWTGKYYKLNYKRYQHRYY  RQGGYY  F
   196  118 B V  B <   +U  193   0I   0  574   26  V   VVV      VIV  IIIC VVVVAVAIVVVVVVVVVVVKVIVVIIAVIVVVVVVV  VVVVVV  V
   197  119 B A        -     0   0    1  576   81  R   RRR      QKS  HHHN SSNKQRKKSQQQQQQAQSSVARQQRGKQRSQALSQK  SSATQQ  R
   198  120 B P        -     0   0    8  576   54  P   PPP      PPT  PPPF TTTPKTSPTPPPPPPPPPPPVSPPPPSPPSPTPTPT  TTTSPP  P
   199  121 B A        -     0   0    2  577   39  A   AAA      VVI  VVVA VVIIIVVVVVVVVVVAVAAIIVVVIVVVIIIIIIVV  IVIIVV  A
   200  122 B g  B     -g  290   0F   1  578   67  V   VVV      ACS  CCCK SSCCASPCCAAAAAACASCCPPAACCQACTPSSSAS  SPGAAS  V
   201  123 B L        -     0   0   27  580    5  L   LLL      LLL  LLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL  LLLLLL  L
   202  124 B P        -     0   0    7  581   31  P   PPP      PPP  PPPP PPPPPPTPPPPPPPPPPPPSPAPPPPPPPPAPPPPP  PPEQPP  P
   203  124AB E     >  -     0   0   92  580   75  S   SSS      SRS  DDDK RRESASSKQSSTTSSETDAEERTTQQSTQTHEKSTS  KKSTTS  S
   204  125 B R  H  > S+     0   0  109  580   79  K   KKK      GYS  KRRQ SSAAQSQDTSSSSSGPSSAIDISSSSQSPSSSDASS  YSGASG  K
   205  126 B D  H  > S+     0   0  124  580   85  C   CCC      CNC  QEED CCDADCGRTCCCCCCGCMMTGECCGDGCGCCCCLCC  CCVNCC  C
   206  127 B W  H  >>S+     0   0    4  580   87  E   AAA      AYA  ITTE AADSSANSDAAAAAADAVVDSPAANISATAPAAAAA  APVNAA  A
   207  128 B A  I  X>S+     0   0    0  580   75  N   AAA      ADS  VAAQ SSEDDGDENPPPPPPTPSAITEPPDDDPDAIFPAPS  ASSAPP  A
   208  129 B E  I  <5S+     0   0   75  581   83  D   DDD      APT  TAAI TTFYPSPPFAAAAAALAADDVHAAPYVAPTKVAAAA  VAVAAA  D
   209  130 B S  I  <5S+     0   0   70  582   65  G   GGG      GAG  SSSP NDKASGASPGGGGGGVGGGRPNGGAAKGAGGDGGGG  GGGGGG  G
   210  131 B T  I  <5S+     0   0   18  104   77  .   ...      ...  LLL. ...Q................................  ......  .
   211  131AB L  I ><  S-     0   0  119  478   80  d   DPP      MSS  NNnQ SsELsgRSSMMMMMM.M.PISrMMSN.MSSGNSsTS  SsssMM  s
   227  146 B E  T 3  S+     0   0   47  513   76  E   ESS      SES  MVVN IIGWESEEASSSSSS.S.SPEESSEEGSESFPSFMS  SFEESS  V
   228  147 B K  T 3  S+     0   0  169  537   69  G   GDD      SGG  NGGA GGARGGGGGSSSSSS.SGGMNQSSGTSSGGFSGGSS  GGGGSP  R
   229  149 B G  S <  S-     0   0   29  548   67  S   SAA      TGS  EKKQ GGGDGSGGGTTTTTT.TSSRGGTTGGYTGSGVAASS  VGGGTA  A
   230  150 B R        -     0   0  213  557   86  R   RRR      AEN  VGGE KKSRSNATIAAAAAANANPSPHAAMNSAMNESDDVN  NVSSAD  R
   231  151 B Q  B     -V  224   0J  79  563   93  Y   YYY      DLY  QQQS YYTVLYGLLDDDDDDGDYYVLMDDLILDLYFYYYSY  YYAADD  Y
   232  152 B S        -     0   0   14  569   51  P   PPP      SPP  PPPR PPSAPPSPPGKSSGRSRPSSPASKPSPKPPPPPPGP  PPSSKG  P
   233  153 B T  S    S+     0   0   48  570   73  D   DDD      NSE  SSSD AAKNSDTGNDNNNDNDNDYPVKNNGPSNGDDDDDDD  EATTND  D
   234  154 B R  B    S-T  150   0H 102  570   86  K   KKK      KIL  VVVQ LLVRRRAIKKKKKKKLKKRQETKKKIDKKLRMLERR  LVTTKK  K
   235  155 B L        -     0   0    3  578    3  L   LLL      LVL  LLLL LLLLLLLVLLLLLLLLLLLLLLLLVLMLVLLLLLLL  LLLLLL  L
   236  156 B K  E     -FH  98 221F  31  578   51  Q   QQQ      QNQ  QQQR QQMHQRQQRQQQQQQHQQQNQQQQHAYQQQQQQQQM  QKRRQQ  Q
   237  157 B M  E     -FH  97 220F  18  579   94  C   CCC      CQC  MVVA CCQETCIHKCCCCCCQCKRKESCCEQRCECCCCCCC  CCQQCC  C
   238  158 B L  E     - H   0 219F   4  580   42  L   LLL      LVL  VVVA LLAAVLVVALLLLLLALVVVVVLLVVVLVLLLLLLL  LLVVLL  L
   239  159 B E  E     - H   0 218F 107  580   72  D   EEE      EKN  NNNK EEKTTDTDVNNNNNEQNRNNDLNNQEDDQKDSQEQD  NDIADN  E
   240  160 B V  E     - H   0 217F   0  580   46  A   AAA      IVV  LLLV AAVVVAVVKIIIIIIVIVVILLIIVVIIVALAAAIA  AVVVII  A
   241  161 B P  E     - H   0 216F  34  580   26  P   PPP      PPP  PPPP PPPPPPPPPPPPPPPPPPHNPPPPPPDPPPPPPPPP  PPPPPP  P
   242  162 B Y  E     -J  263   0F  36  581   45  L   LLL      IIV  LIIK VVLIVIIIIIIIIIIVIVTLTVIIIIIIIVVILVII  LVIIII  L
   243  163 B V  E     -J  262   0F  24  582   35  L   LLL      LML  VVVY LLVVVLVLVLLLLLLVLIIVIVLLYYVLYLLLLLLL  LLVVLL  L
   244  164 B D     >  -     0   0   88  581   58  S   SSS      SSS  EEEN SSSDASSTSSSSSSSPSSPKQESSSTASSSPSSSSS  SSSASS  S
   245  165 B R  H  > S+     0   0   51  581   79  D   DDD      DVQ  RRRD AARIRERLTYYYYYNAKRRWDRYYLNRFLDEDDQDD  DDDDFD  D
   246  166 B N  H  > S+     0   0  105  582   75  E   NNN      STA  PPPK SSDQASADSSSSSSAQEARENDSSTEEETSDAAARS  AAAAES  N
   247  167 B S  H  > S+     0   0   48  582   78  T   TTT      DEK  IVVA SSQTTSQQADDDDDDDDTQIVIDDQAQDQSSKEEDS  TASADD  T
   248  168 B j  H  X S+     0   0    1  582    2  C   CCC      CCC  CCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCC  C
   249  169 B K  H >< S+     0   0   88  582   73  F   FFF      NrE  KKKn KKsrNRnrnNNNNNQrDnnSAnNNrqnDrRKERENK  RHnnDS  F
   250  170 B L  H 3< S+     0   0  150  547   89  N   NNN      NkA  ADDy KKqaSNnkqNNNNNNvNnr.LlNNkkeNkNSTAANN  KKyyNN  N
   251  171 B S  H 3< S+     0   0   23  578   76  A   AAA      SYA  SSSK SSSHASYYSSSSSSSYAASSMLSSYYESYASASSSS  AAAASS  A
   252  172 B S    <<  -     0   0   20  581   83  Y   YYY      YKY  TTTG YYYPYYGRYYYYYYYAYYYLYPYYRGAYRYYYYYYY  YYSSYY  Y
   253  173 B S  S    S+     0   0   79  581   83  P   PPP      PSP  GRRF PPGDGPSAGPPPPPPDPANLGSPPAKGPAPGSPPPP  PPYYPP  P
   254  174 B F  S    S-     0   0  124  581   79  F   FFF      GTG  IIIG GGDYGGGSGGGGGGGYGGGTDYGGNQAGNGDEGGGG  GGGGGG  F
   255  175 B I        -     0   0  100  582   88  Q   QQQ      MRQ  RRRG QQRISQQRAMMQMMMLMARLRDMMRATMRQDKEKMQ  QRGGMM  Q
   256  176 B I        -     0   0   13  582   16  I   III      III  VIII IIIVIIIIIIIIIIIIIVVFLIIIIIIIIIIIIIII  IIVIII  I
   257  177 B T    >   -     0   0   16  582   36  T   TTT      TTT  TTTT TTTTTTTTTTTTTTTSTTTTTTTTTTTTTTTTTTTT  TSTTTT  T
   258  178 B Q  T 3  S+     0   0  133  582   68  E   EEE      SSS  DDDD SSEAASESQNNNNNDENTSKEKNNEEDDENNKDSDA  DGAADN  E
   259  179 B N  T 3  S+     0   0   24  582   61  N   NNN      TTN  NNNR NNNNRNNNYAAAAATNANNNRRAANNNANNNNNNAN  NNRRAS  N
   260  180 B M  E <   - K   0 311F   2  582   11  M   MMM      MMM  MMMM MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM  MALMMM  M
   261  181 B F  E     - K   0 310F   8  581   34  I   III      FLF  FFFI FFLFFFFLIFFFFFFLFFFLFIFFIMIFIIFIVFFF  IFIIFF  I
   262  182 B j  E     +JK 243 309F   1  582    0  C   CCC      CCC  CCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCC  C
   263  183 B A  E     +JK 242 308F   0  582   27  A   AAA      AAA  AAAA LLAAAAAAAAAAAAAAAAAAAAAAAAGAALAAAVAA  LLAAAA  A
   264  184 B G  S    S-     0   0    3  582   10  G   GGG      GGG  GGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGG  G
   265  185 B Y        -     0   0   56  561   58  Y   YYY      YRY  YYYV FFMFVFLKFYYYYYYFYYHNYVYYRYNYRYFFFFYF  YFYFYY  Y
   266  185AB D  S    S-     0   0   81  565   84  L   LLL      LPL  KKKL LLRELLAGQLLLLLLRLMPSPELLGDVLSLQLLLLL  LLTTLL  L
   267  185BB T  S    S+     0   0   76  582   62  E   EEE      ESE  pppK EEQnnEAKQEEEEEEREDNQKGEENHaENEEEEEEE  EESAEE  E
   268  186 B K  S    S-     0   0  107  532   32  G   GGG      G.G  kkkG GGGsgGG.GGGGGGGGGGGEG.GG.GgG.GGGGGGG  GGGGGG  G
   269  187 B Q  S    S+     0   0  102  537   37  G   GGG      G.G  RRRG GGGRGGG.GGGGGGGRGGGGQ.GG.EGG.GGGGGGG  GGGGGG  G
   270  188 B E        +     0   0   33  581   54  K   KKK      KMK  GGGK KKVGKKKQIKKKKKKVKKNKKKKKQLVKQKKKKKKK  KKRRKK  K
   271  189 B D  B     -E   94   0E   7  582    3  D   DDD      DDD  DDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD  DDDDDD  D
   272  190 B A        -     0   0    7  582   42  S   SSS      SSS  AAAA SSSAASASASSSSSSSSSSATTSSSASSSSSSSSSS  SSAASS  S
   273  191 B k    >   -     0   0    7  582    0  C   CCC      CCC  CCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCC  C
   274  192 B Q  T 3  S+     0   0   90  582   25  Q   QQQ      QQQ  EEEQ DDQQQQQQQQQQQQQAQQQQQQQQQQQQQQQQQQQQ  QDQQQQ  Q
   275  193 B G  T 3  S+     0   0    6  582    7  G   GGG      GGG  GGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGG  G
   276  194 B D    X   +     0   0    0  582    0  D   DDD      DDD  DDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD  DDDDDD  D
   277  195 B S  T 3  S+     0   0   14  582    1  S   SSS      SSS  SSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS  SSSSSS  S
   278  196 B G  T 3  S+     0   0    0  582    0  G   GGG      GGG  GGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGG  G
   279  197 B G    <   -     0   0    0  582    2  G   GGG      GGG  GGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGG  G
   280  198 B P  E     - L   0 294F   1  582    3  P   PPP      PPP  PPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP  PPPPPP  P
   281  199 B H  E     -IL 219 293F   0  582   49  M   MMM      VLV  FFFL VVFFVVVLLVVVVVVLVVGLYLVVLLVVLVLLVVVV  VVLLVV  M
   282  200 B V  E     -IL 218 291F   3  582   27  T   MMM      VLV  VVVT VVVSVVILMVVVVVVLVTVVEVVVLHVVLVVVAVVV  VVVVVV  M
   283  201 B T  E     - L   0 290F   0  582   67  C   CCC      CLC  MMMW CCCVDCVVCCCCCCCACRRCYVCCVLDCVCCCCSCC  CCAACC  C
   284  202 B R  E     + L   0 289F  99  582   70  D   DDD      NSS  KKKD NNTDSNNRPNNNNNNKNSSQEDNNQEVNQNDNNNNS  NNNGNN  D
   285  203 B F  E >  S- L   0 288F  22  582   70  G   GGG      NNN  nssG GGnnAGGKtGGGGGNdGGGkQGGGEgAGEGGGGGGG  GGGGGG  G
   286  204 B K  T 3  S-     0   0   85  206   71  .   ...      .G.  nnn. ..pq...Gp......h...q....Ad..A.......  ......  .
   287  205 B D  T 3  S+     0   0  108  208   57  .   ...      .V.  NNN. ..RH...DN......G...S....DR..D.......  ......  .
   288  206 B T  E <   - L   0 285F   3  218   75  .   ...      .K.  RRR. ..QR...KQ......R...I....KKS.K.......  ......  .
   289  207 B Y  E     - L   0 284F  21  227   50  .   ...      .F.  WWW. ..WHG..HW......W...W....LIN.L.......  ......  .
   290  208 B F  E     -gL 200 283F   0  582   91  E   EEE      VFK  YYYV EETVKQEETEEEEEQTETTYMTEEEDQEEEEEEQEQ  EERREQ  E
   291  209 B V  E     + L   0 282F   1  582   41  L   LLL      LIL  QQQV IILLLLLIVLLLLLLILVVQLLLLILILILLLLLLL  LLLQLL  L
   292  210 B T  E     +     0   0F   1  582   84  Q   QQQ      QVQ  MMMV QQVLVQVVVQQQQQQYQYYLIAQQAIVQAQFQQQQQ  QQDVQQ  Q
   293  211 B G  E     -ML 312 281F   0  582    0  G   GGG      GGG  GGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGG  G
   294  212 B I  E     -ML 311 280F   0  582   19  V   VVV      III  IIIV IIVVAVAIIVVVVVVVVVVIIVVVIVIVIIVIIIVV  IVVVVI  V
   295  213 B V  E     +M  310   0F   7  582   14  V   VVV      VVV  VVVV VVTIVVVVVVVVVVVTVVVVTVVVVVVVVVVVVVVV  VVVVVV  V
   296  214 B S  E     -     0   0F   1  581    0  S   SSS      SSS  SSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS  SSSSSS  S
   297  215 B W  E     -M  309   0F  45  582    8  W   WWW      WWW  WAAW WWWWWWWWWWWWWWWFWWWWWFWWWWWWWWWWWWWW  WWWWWW  W
   298  216 B G        -     0   0   26  582    0  G   GGG      GGG  GGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGG  G
   299  217 B E  S    S-     0   0   25  577   90  H   HHH      YVY  EAAY SSKDRYRVEYYYYYFEYYYEDTYYVQYYVYYIYYYY  YTVVYY  H
   300  218 B G  S    S-     0   0   19  580   15  G   GGG      GGG  GGGG VVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGG  G
   301  220 B k  S    S-     0   0    7  582    2  C   CCC      CCC  CCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCC  C
   302  221 B A  S    S+     0   0    4  581   17  A   AAA      AGA  DDDA AAAGAAAGAAAAAAAAAAGGGAAAGGAAGAAAAAAA  AAAAAA  A
   303  222 B R    >   -     0   0  105  578   74  M   QQQ      QRQ  RRRK MMRKRQRRFEEEEEEREQDQAREERRRERQTEQQEQ  QLRREE  Q
   304  223 B K  T 3  S+     0   0  152  578   65  K   RRR      KEK  DDDP RRAFPRPAPPPPPPKQKPAKAKPPPEKKPKKKKKRR  KKPPKR  R
   305  223AB G  T 3  S+     0   0   26  582   58  N   NNN      NGN  GGGR GGLGQNNGNGGGGGNGDNRKNDGGGGGDGGGEGNDN  GGNNDN  N
   306  224 B K    <   -     0   0   43  582   85  K   KKK      KYK  KKKY KKKKYKYYKNNNNNQRHYYKSKNNYYYHYKYKRRHK  KKFFHH  K
   307  225 B Y        -     0   0   33  582   49  P   PPP      PPP  YYYP PPYYPPPPYPPPPPPYPPPPPPPPPPPPPPPPPPPP  PPPPPP  P
   308  226 B G  E     -K  263   0F   4  580    2  G   GGG      GGG  GGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGG  G
   309  227 B I  E     -KM 262 297F   6  581   10  V   VVV      VVV  FFFV VVIVVVVVVVVVVVVIVVVVVVVVVVVVVVVVVVVV  VVVVVV  V
   310  228 B Y  E     -KM 261 295F   1  581    2  Y   YYY      YYY  YYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY  YYYYYY  Y
   311  229 B T  E     -KM 260 294F   2  581   40  T   TTT      ATT  TTTS TTATTATTTAAAAAAAATTTTTAATTTATTTTTTAT  TTVAAA  T
   312  230 B K  E >   - M   0 293F  21  581   40  K   KKK      KRK  HHHR KKNRRKRRRKKKKKKKRKKKRNKKRRRKRKKKKKKK  KKKKKK  K
   313  231 B V  G >  S+     0   0    1  581    8  V   VVV      VVV  VVVV VVVLVVVVVVVVVVVVVVVVVVVVVMVVVVVVVVVV  VVVVVV  V
   314  232 B T  G 3  S+     0   0    2  579   72  C   CCC      CSC  FFFS CCRFGCGATCCCCCCECKASSACCSGGCTCCCCYCC  CCSSCC  C
   315  233 B A  G <  S+     0   0   29  579   80  N   NNN      NKK  RRRA NNRNLNNRSIIIIIKNIKNNYDIIRRSLRNHNNNLN  NNANLI  N
   316  234 B F  S <> S+     0   0    7  575   36  Y   YYY      YFF  LLLV YYYFFYYYVFFFFFFAFYYYFLFFYYFFYYYYFYFY  YYVLFF  Y
   317  235 B L  H  > S+     0   0   23  573   81  V   III      TIV  KKKR LLLIRNLLLNNNNNTLNTVLI TTLLINLVIVVVNN  VLRRNS  I
   318  236 B K  H  > S+     0   0  116  572   68  S   SSS      TPD  KKKD SSHDTSTPSDNDDDTRDSGLQ NNNKDDKDDDNDDT  NDSSDD  S
   319  237 B W  H  > S+     0   0   26  572    1  W   WWW      WWW  WWWW WWWWWWWWWWWWWWWWWWWWY WWWWWWWWWWWWWW  WWWWWW  W
   320  238 B I  H  X S+     0   0    1  569   12  I   III      III  IIII IIIIIIMIVLLLLLLILIIII LLIIILIIVIIILI  IIIILL  I
   321  239 B D  H  < S+     0   0   66  541   72  K   KKK      RKK  RQQK QQNLTRKRNTTTTTQRENNDD TTHADEHKNKERTR  KQQQED  K
   322  240 B R  H >< S+     0   0  136  528   71  E   DDD      SSK  KKKE EE NTSEAKSSSSSQRR S D SSTESRATDEEDQN  KESSRS  D
   323  241 B S  H >< S+     0   0    6  495   71  T   TTT      TNT  MVVS TT ENT NITTTTTTTT Y I TTNN TNTITTTTT  TSNNTT  T
   324  242 B M  T 3< S+     0   0   25  452   39  M   MMM      ILV  VIIV MM I M MIMMMMMMIM I I MMMT MMIMIIIMM  II  MM  M
   325  243 B K  T <  S+     0   0  153  418   69  A    AA      NEA    D  AA D S DAAAAAAAAA N K AAKP AKAE AA S  AA  AA  A
   326  244 B T    <         0   0   51  369   66  S    SS      SNS       NN   S ETTTSSTSET   N SSED  END AA S  EA   S  S
   327  245 B R              0   0  197  260   47  D            N N       NN   N  K     NN    N        NH NN N  NN   N   
## ALIGNMENTS  351 -  420
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1   49 A Q              0   0  101  253   29  QQQQ         Q QQ                                                     
     2   50 A a    >   +     0   0   22  341    0  CCCC         C CC                                    C                
     3   51 A E  T 3  S+     0   0  187  342   77  LLLL         D QA                                    I                
     4   52 A T  T 3  S-     0   0  105  342   54  SSSS         P SS                                    S                
     5   53 A S    <   +     0   0   89  342   62  NNNN         M HS                                    Q                
     6   54 A P        +     0   0   10  343   18  QQQQ         P MP                                    P                
     7   55 A b        -     0   0   18  344    0  CCCC         C CC                                    C                
     8   56 A Q  S    S+     0   0   92  343   70  VVVV         V VL                                    L                
     9   57 A N  S    S-     0   0   63  303   24  ....         . .N                                    N                
    10   58 A Q  S    S-     0   0  152  336   48  NNNN         N HQ                                    N                
    11   59 A G        -     0   0   16  344   17  GGGG         G GG                                    G                
    12   60 A K  E     -A   23   0A 117  344   75  TTTT         T DS                                    T                
    13   61 A a  E     -A   22   0A  45  344    0  CCCC         C CC                                    C                
    14   62 A K  E     -A   21   0A 155  344   82  VVVV         M VK                                    K                
    15   63 A X  E     +A   20   0A 120  302   29  DDDD         D D.                                    D                
    16   64 A G        -     0   0   44  341   74  LLLL         Q Q.                                    H                
    17   65 A L  S    S-     0   0  152  342   69  YYYY         I H.                                    I                
    18   66 A G  S    S+     0   0   67  343   62  QQQQ         G Q.                                    R                
    19   67 A E        -     0   0  119  329   61  SSSS         G D.                                    S                
    20   68 A Y  E     -A   15   0A  37  342    9  YYYY         F Y.                                    F                
    21   69 A T  E     -A   14   0A  71  343   83  AAAA         N K.                                    S                
    22   70 A b  E     -A   13   0A  20  343    0  CCCC         C C.                                    C                
    23   71 A T  E     -A   12   0A  85  344   80  RRRR         I LV                                    T                
    24   72 A c        -     0   0   44  344    1  CCCC         C CF                                    C                
    25   73 A L    >   -     0   0   62  344   86  NNNN         N YL                                    A                
    26   74 A E  T 3  S+     0   0  177  344   74  HHHH         L HG                                    P                
    27   75 A G  T 3  S+     0   0   29  344   24  GGGG         G Gg                                    G                
    28   76 A F  E <   +B   36   0B  40  343   16  YYYY         W Yq                                    Y                
    29   77 A E  E     +B   35   0B  74  343   63  EEEE         E EF                                    E                
    30   78 A G  S >  S-     0   0   32  343    1  GGGG         G GM                                    G                
    31   79 A K  T 3  S+     0   0  156  343   72  RRRR         N RP                                    K                
    32   80 A N  T 3  S-     0   0   33  343   62  YYYY         N YH                                    T                
    33   81 A c  S <  S+     0   0    1  344    0  CCCC         C CC                                    C                
    34   82 A E        +     0   0   87  342   30  dddd         e qt                                    a                
    35   83 A L  E    S-B   29   0B  96  289   42  pppp         i vl                                    l                
    36   84 A F  E     -B   28   0B 139  292   93  QQQQ         I TQ                                    E                
    37   85 A T        -     0   0   44   76   76  TTTT         . ..                                    .                
    38   86 A R        +     0   0   57  101   88  AAAA         D A.                                    .                
    39   87 A K        +     0   0   96  140   78  TTTT         A SK                                    .                
    40   88 A L        -     0   0   91  168   91  SSSS         N NR                                    .                
    41   89 A d  S  > S+     0   0   15  238   19  CCCC         C CC                                    .                
    42   90 A S  T  4 S+     0   0   98  244   86  AAAA         S SD                                    .                
    43   91 A L  T >4 S-     0   0  120  274   90  EEEE         I VV                                    .                
    44   92 A D  G >4 S-     0   0  107  297   62  DDDD         N DN                                    R                
    45   93 A N  G >< S-     0   0    8  315   63  NNNN         N NN                                    T                
    46   94 A G  G <  S-     0   0    0  316   53  GGGG         G GG                                    D                
    47   95 A D  G <  S+     0   0   44  344   60  HHHH         G DD                                    G                
    48   96 A e    <   -     0   0    0  344    1  CCCC         C CC                                    C                
    49   97 A D  S    S-     0   0   59  344   73  DDDD         E DK                                    Q                
    50   98 A Q  S    S+     0   0    2  344   62  HHHH         H HH                                    H                
    51   99 A F  E     -C   62   0C   4  344   77  EEEE         F EF                                    F                
    52  100 A d  E     +C   61   0C  10  344    0  CCCC         C CC                                    C                
    53  101 A H  E     -C   60   0C  68  344   86  SSSS         Y SG                                    H                
    54  102 A E  E     -C   59   0C  92  344   56  DDDD         H ET                                    P                
    55  103 A E  S    S-     0   0  100  344   81  ssss         p sI                                    G                
    56  104 A Q  S    S-     0   0  175  310   77  dddd         e gg                                    Q                
    57  105 A N  S    S+     0   0  154  307   78  llll         q af                                    S                
    58  106 A S  S    S-     0   0   58  337   71  AAAA         N RG                                    S                
    59  107 A V  E     -C   54   0C   7  343   86  RRRR         R RA                                    Y                
    60  108 A V  E     -C   53   0C  45  344   87  SSSS         Y SK                                    M                
    61  109 A e  E     +C   52   0C   5  344    0  CCCC         C CC                                    C                
    62  110 A S  E     -C   51   0C  24  344   70  SSSS         S SF                                    S                
    63  111 A f        -     0   0   23  344    0  CCCC         C CC                                    C                
    64  112 A A    >   -     0   0    8  344   70  IIII         V LA                                    A                
    65  113 A R  T 3  S+     0   0  149  344   83  HHHH         S NT                                    K                
    66  114 A G  T 3  S+     0   0   24  344   13  GGGG         G GG                                    G                
    67  115 A Y  E <   -D   78   0D  20  344    7  YYYY         F YY                                    Y                
    68  116 A T  E     -D   77   0D  72  343   81  NNNN         Q KE                                    K                
    69  117 A L  E     -D   76   0D  67  340   68  LLLL         L LL                                    L                
    70  118 A A    >   -     0   0   23  340   78  QQQQ         D DM                                    G                
    71  119 A D  T 3  S+     0   0  175  340   77  DDDD         I DS                                    E                
    72  120 A N  T 3  S-     0   0   92  340   74  DDDD         N DD                                    D                
    73  121 A G  S <  S+     0   0   16  340   56  SSSS         H SG                                    H                
    74  122 A K  S    S+     0   0   71  332   83  RRRR         H RV                                    R                
    75  123 A A        -     0   0   22  330   70  TTTT         S KS                                    S                
    76  124 A f  E     -D   69   0D  12  300   48  CCCC         C CC                                    C                
    77  125 A I  E     -D   68   0D  78  304   82  QQQQ         E SE                                    S                
    78  126 A P  E     -D   67   0D  62  304   56  PPPP         P PA                                    P                
    79  127 A T  S    S+     0   0  103  304   79  KKKK         T KT                                    S                
    80  128 A G  S    S-     0   0   32  305   75  GGGG         A SV                                    D                
    81  129 A P  S    S+     0   0  116  311   78  PPPP         D TE                                    K                
    82  130 A Y  S    S+     0   0   59  312   77  AAAA         F SF                                    C                
    83  131 A P    >   -     0   0   17  312   34  SSSS         P SP                                    A                
    84  132 A g  T 3  S+     0   0   16  323    2  CCCC         C CC                                    C                
    85  133 A G  T 3  S+     0   0    0  295   30  GGGG         G GG                                    G                
    86  134 A K    <   -     0   0   69  294   62  QQQQ         V QK                                    A                
    87  135 A Q        -     0   0   37  243   74  LLLL         L IT                                    L                
    88  136 A T        +     0   0    4  220   79  LLLL         Q LG                                    T                
    89  137 A L        +     0   0  105  200   57  IIII         V IL                                    S                
    90  138 A E              0   0  104  120   71  GGGG         G DT                                    Q                
    91  139 A R              0   0  231   97   28  RRRR           R                                     H                
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3      IIIIIIIII I  IIIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIII IIIIIIII IIIIIII
    94   17 B V  B     -E  271   0E   7  561    9      VVVVVVVVV V  VVVVVVVVVVVV VVVVVVVVVVVVVVVVVVVVVVV VVVVVVVV VVVVVVV
    95   18 B G  S    S+     0   0   25  562    6      GGGGGGGGG G  GGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGG GGGGGGGG GGGGGGG
    96   19 B G  S    S-     0   0   26  563    0      GGGGGGGGG G  GGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGG GGGGGGGG GGGGGGG
    97   20 B Q  E     -F  237   0F  98  564   95      YYYTRREDY Y  YQRSYYTKYYYY YTEHDQYYYVKYFYTATTEEEVF YQYYVVYY WSTYYYY
    98   21 B E  E     -F  236   0F  80  565   65      EETEEEFYT T  DPPPEEDNETEE ESDDEEEETKPEEETAQAEKEKE EEEEKKEE PQEETEE
    99   22 B h        -     0   0    8  565   58      CCCATTVVC C  DTTACCATCCCC CVVTSTCCCAVCCCAAAAIAIAI CACCAACC AAVCCCC
   100   23 B K    >   -     0   0  123  564   79      LKASSSNPE E  TGGKRLTSTPKE QKDSTRKKEKSTTKQNKPSLSQD QTTQKKKT RSETART
   101   24 B D  T 3  S+     0   0   60  565   85      KAKNIIIIE E  IIVEKKLIPKAP PIIIPRAAEAIPRPQPPKIAIAI HPAAAAKK KAPKAKK
   102   25 B G  T 3  S+     0   0    0  565   73      NHNDEEETN H  ENNNNNGSYHYH YESDHGYYNGEHNYGGGNNGNGL HHHHGGNH GGGHNNH
   103   26 B E  S <  S+     0   0   36  565   67      SSSEEEEES S  NEQASSEESSSS SNTKSSSSSDDSGSGDDAKEKDE SSSSDDAS EEASSSS
   104   27 B h    >   +     0   0    4  565   91      VQLFHHVAI I  VFYYVVFVQVQQ QFCHWWQQVCIQVQWWWWVCVCV QLQQCCLQ FFFQVVQ
   105   28 B P  T 3   +     0   0    0  567    9      PPPPPPPPP P  PPPPPPPPPPPP PGGPPPTPPPPPPPPPPPPPPPP PPPPPPPA PPPSPAS
   106   29 B W  T 3  S+     0   0    5  568   27      YWYWWWYYY Y  YWWWYYYYWYHW HWWHWWHHYYYHYHWWWWYYYYY HWHHYYYH WYWHYYY
   107   30 B Q  E <   -N  122   0G   7  569   24      QQQMQQQQQ Q  TMLMQQqlQQQQ QQQQqqQQQQqQQQQQQQqQqQQ QqQQQQQQ qQqQQQQ
   108   31 B A  E     -NO 121 146G   1  559   47      VVVAVVAAV V  VAAAVVeaVVVA VVVVlaVVVIvVVVAAVAlIlII VtVVIIVVAaVmVVVV
   109   32 B L  E     -NO 120 145G   3  567   65      SSSKSSTQS S  SRRASSTMSSSS SSSSRISSSSNSSSQQQQLSLSS SYSSSSSSMISLSSSS
   110   33 B L  E     -NO 119 144G   0  570   11      LLLLLLLLL L  LLLLLLFLLLLL LLFLFLLLLLFLLLLLLLLLLLL LFLLLLLLLLLWLLLL
   111   34 B I  E     -NO 117 143G   0  570   81      FNNIQQHLN N  NSVYNFINNNNN NFHIRTNNNQFNNNRRRRQQQQQ NNNNQQSNHEQDNNNN
   112   35 B N  E >   - O   0 142G  30  570   88      TAVYVAWQS S  KYYYSTGNVDSA SDNYyKSSASGASSTTSSKSKSS AgSSSSSSRDDiSSSA
   113   36 B E  T 3  S+     0   0   63  113   77      ......F.. .  I........... ....e.........STRA..... .v......T..p....
   114   37 B E  T 3  S-     0   0  136  242   76      ....SYNL. .  G.....F..... .RR.NW........TTESD.G.. .S......PGNT....
   115   38 B N  S <  S+     0   0   84  543   52      GGGIGGAGG G  FFDNGGSGGGGGQGKKTFHGGGS.GGGGGGGNSNSY GEGGSSGGRKIRGGGG
   116   39 B E        -     0   0  100  561   93      YYYKFFVSY Y  GNGNYYFNYIYYEYGGNGEYYYSQYYYYFYFESESG YHYYSSYYGYGNYSYY
   117   40 B G  E     +N  111   0G  14  572   55      NHHRHHVAH H  HRQRHNHFHSHHLHHHHHQHHHHHHHHPPPPYHYHH HAHHHHHHPHHRHHHH
   118   41 B F  E     +     0   0G  28  581   35      FFLfFFLIF F  FfffFFFFFhFFLFFFNWYFFFFLFFFYYYFfFfFF FYFFFFFFFSFyFFFF
   119   42 B i  E     -N  110   0G   0  578    1      CCCcCCCCC C  CcccCCCCCcCCCCCCCCCCCCCCCCCCCCCcCcCC CCCCCCCCCCCcCCCC
   120   43 B G  E     -N  109   0G   1  581    2      GGGGGGGGG G  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGSGGGG
   121   44 B G  E     -N  108   0G   0  581    9      GGGGGGAAG G  GGAGGGAGGGGGAGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGG
   122   45 B T  E     -NP 107 130G   0  581   43      ISSMSSATS S  TMSSSISSSSSSSSSSSSVSSSSSSSSTSTTSTSSS SSSSSSSSTVTSSSSS
   123   46 B I  E     + P   0 129G   0  581   23      LLLLIIIIL L  LLLLLLIVLLLLLLIILILLLLIILLLLLLLIIIII LLLLIILLLLLLLLLL
   124   47 B L        -     0   0    6  581   27      LVIIIIIII I  IILVILYVIIVVIVIIIILVVILLVIVIIIVILILI VIVVLLIVLILIVIIV
   125   48 B S  S    S-     0   0   22  581   57      SNSNSSDSS S  SNTTSSNANNNNSSSGAATNNSDSNSNHHHHSDSDG SSNSDDSSGDNNSNSS
   126   49 B E  S    S+     0   0   99  581   62      AEDDEEKED D  FDRDSAEPQDEEDDDKKRPEEDEEQNEPSPPKEKEE EREEEESKDNSKKSSK
   127   50 B F  S    S+     0   0   42  581   82      ENQRDSSYQ Q  ERDRSENNNQNNQSEENNSNNQYRNLNENQRRYRYN NENSYYYDQCRRDQTD
   128   51 B Y  E     - Q   0 185G   7  581   33      WWWYTIWWW W  WYYYWWYLWWWWWWWWWWWWWWWFWWWWWWFHWHWW WWWWRWWWWWWWWWWW
   129   52 B I  E     -PQ 123 184G   0  581   14      VVVVIIILV V  VVVIVVAVVVVVIVVIVVVVVVIIVVVVVIVIIIIV VIVVIIVVVVVVVVVV
   130   53 B L  E     +PQ 122 183G   0  581   28      LVLLLLLVV V  LLLLVLIVVLVVLVLLLVLVVVLLVVVLLLVLLLLL VAVVLLVVLLLIVVVV
   131   54 B T  E     - Q   0 182G   0  581   43      SSTSTTTSS S  TTTTSSTTSSSSTSTTTTTSSSTTSSSTTTTTTTTT STSSTTSSTTSTSSSS
   132   55 B A    >>  -     0   0    0  581    2      AAAAAAAAA A  AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAA
   133   56 B A  G >4 S+     0   0    0  581    8      AAAAGGAAA A  AAAAAAGAAAAAAAAAAAAAAAAAAAATATSAAAAG AAAAAAAAAAAAAAAA
   134   57 B H  G >4 S+     0   0    7  581    0      HHHHHHHHH H  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHH
   135   58 B i  G X4 S+     0   0    0  581    2      CCCCCCCCC C  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCC
   136   59 B L  G << S+     0   0   31  581   65      KYYVTATFY Y  LVVVYKAVYYYYIYVVIVLYYYVIYYYLILIIVIVA YAYYVVYYLFQIYYYY
   137   60 B Y  G <  S+     0   0  109  581   87      PKKKVSYEK K  VKRFKPYYQKKKLKYTSFRKQKNIQKKKSKVEAEND KKKTNNKKVEERKKKK
   138   61 B Q  S <  S+     0   0   95  581   78      KSSgnyKDS S  ggrrSKgeSRSSySdkSgrSSSggSSSgsnkGgGgd SdSSggSSnqSeSSSS
   139   61AB A        -     0   0   16  352   75      ...wapK.. .  pwrp..ph...Pa.pi.rr...at...apppIaIad .a..aa..knPe....
   140   62 B K  S    S-     0   0  172  366   75      S..FSDS.. .  DFNA.SSK...SN.KETAR...KP...SAQSSSSKV .E..KK..DKNQ....
   141   63 B R  S    S-     0   0  162  570   78      DRRMMLHTR R  DMKRRDGSR.RRDRQGYNRRRRKDRRRREDSKKKKG RDRRKKRRSTRDRRRR
   142   64 B F  E     -O  112   0G  36  577   54      VILIMVLYI I  LIIFIVLLILVLIVYLYFVVVILFVVVVVILVLVLL IMVVLLIIFYLFIIII
   143   65 B K  E     -O  111   0G  67  577   78      EEQKSTTGQ Q  YKRRQEQAEQEELEGKRKIEEQSTEQEHVVRTSTSN ERQESSQESSSIEQQE
   144   66 B V  E     -OR 110 161G   0  577   16      VVVVVIVMV V  VVVVVVIFVVVVVVVVVVIVVVIVVVVIVIIVIVIV VIVVIIVVVIIVVVVV
   145   67 B R  E     -OR 109 160G  40  577   53      RRRTRRRSR R  RTIQRRVRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RWRRRRRRKVVRRRRR
   146   68 B V  E     +OR 108 159G   1  578   43      LLLFVVTIL L  AFLLLLAALLLLVMVVVVTLLLYTLLMLLLLIYINV LLLLYYLLLVALLLLL
   147   69 B G  S    S+     0   0    9  578   14      GGGGGGGLG G  GGGLGGGGGGGGGGGGGGGGGGNGGGGGGGGGNGNG GGGGNNGGGGGGGGGG
   148   70 B D        +     0   0   11  579   58      EEEESTATE E  SEDVEEESEEEEKESSSDEEEETSEEEAAAASSSTS ESEETTEEKDEKEEEE
   149   71 B R  S    S+     0   0   24  579   73      HHHHSSRGH H  THHYHHLSHHHHHHSNSHWHHYLNHHHHHQHSLSLS HHHHLLHHHLWHHHHH
   150   72 B N  B >   -T  234   0H  18  579   65      DNDNKIYSN N  YNDNNDDKNNNHYHLEISDNNNKYHNNRSRRNKNKL HDDDKKNHKSDTHNNH
   151   73 B T  T 3  S+     0   0   56  579   79      IIIRTMSTI I  KRQRIIMAIIIIRIRHKQLIIIHSIILRRRRSHSHH ILIIHHIIAKLSIIII
   152   74 B E  T 3  S-     0   0  119  579   84      WQDCSESYE E  NCFTAWSNQDKGAGNNNMTKQDASRDRTLLANSNAG RTYYAAARRRSVRDAR
   153   75 B Q  S <  S-     0   0  130  578   86      EVVNSSERV V  KDLQVEVVIVVLKMKKSIYVVVSTNAVKGEDKLKSS VKRRSSVVDVRRVVVE
   154   76 B E        +     0   0  165  578   85      PTLAGGESL N  GdTpHPNGNLTNFTGGGTDTTLGDNTNGsSSGGGGG TQNSGGNNKENgNLTN
   155   77 B E        -     0   0   93  438   29      DEE...GKE E  .vTtEDE.EEEEEE.G.EEEEE..DEEStVG..... EEEE..EEDEEeEEEE
   156   78 B G  S    S+     0   0   46  547   33      GNG.GGHGG G  GRENGGGGGGGGKGGRGPGGGG..GGGGTGEGGG.G GSGG..NGTGGAGGGG
   157   79 B G  S    S+     0   0   47  555   76      TTDtASRGD N  TPtSTTSVTGSTqNVLVSSSSN..TTTNDEsTET.Q SSTT..TTTTHNTNST
   158   80 B E        -     0   0   37  444   33      EEEr....E E  .Ea.EEE.EEEEeE...EEEEEGGEEEEMEv...G. EREEGGEEEEEEEEEE
   159   81 B A  E     -R  146   0G  27  457   60      QQQP...QQ Q  .TI.QQQ.QQQQKQ...IFQQQEEQQQQQQQ...E. QVQQEEQQQQQRQQQQ
   160   82 B V  E     -R  145   0G  71  557   81      HFFELV.KF F  IRQVFHIVFFFFIFL.VTDFFFKVFFFDDDDVKVKL FKFFKKFYTETSFFFF
   161   83 B H  E     -R  144   0G  14  567   77      IIITHHHHI I  RFREIIIVIIIIVIHYHVQIIIIHIIIFIIFYIYIV IRIIIIIIVFRYIIII
   162   84 B E        -     0   0   90  569   77      MPQREQKQN N  KVARDMTKSDSGADRDSDRSSNQKTNRRKNRTSTQP SSDDQQNSQESISNNS
   163   85 B V  E     -S  186   0G  27  574   64      SSAFVVIIS S  VLVSSSVASASALSIIVLPSSSVVSSSVVVVAVAVV AVSSVVSSVIVVSASS
   164   86 B E  E    S+     0   0G  70  575   73      SAAVQAAEA A  QRTVASSKSESSDSSKKAVSSAARSAAISTKKAKAK SISSAAASALAESAAS
   165   87 B V  E     -S  185   0G  13  576   72      QLKIKQKKK K  RAAKKQKKRKRHERRENEHRRKEQRKRRARRSKSER RKRREEKSRVRRSKKM
   166   88 B V  E     -S  184   0G  72  577   45      FVIRVIIVV V  VIIAVFIVVIVVIVVIQLEVVVIIVVELIIIKIKIV IKVVIIVVIVVIVIVV
   167   89 B I  E     +S  183   0G  27  578   45      IIIVVVIII I  IAIIIIIHIIIIIIHKIQFIIIYIIIIVIIIVFVYI IIIIYYIIVHIIIIII
   168   90 B K  E     -S  182   0G  68  578   82      RRQIRREIR R  PQRRTRLVRRRRLRIKKIVRRRQSRRRTTKKAAAQQ RQRRQQKRVVVVRTSR
   169   91 B H    >   -     0   0   19  579   14      HNHSHHHHH H  HKHTHHHHHHHNHHHHHHHHHHHHHHHHHHHHHHHH HNHHHHHHHHHHHHHH
   170   92 B N  T 3  S+     0   0  156  579   60      PPPNEEPRP P  EFRFPPEPPPPPPPPPPPPPPPEEPPPPSPEPEPEP PPPPEEPPPEPPPPPP
   171   93 B R  T 3  S+     0   0  150  576   74      DNNKNKEGR K  RSSFRDNKNDNNKQDRKEDNNNNLSRNNNSRKKKNQ SHNNNNRNANNDSNRT
   172   94 B F    <   -     0   0   24  579    5      YYFFYFYYF Y  YFFYYYFYYYYYYYYYFYFYYYYYYYYYYYYYYYYY FYYYYYYYFYYFYFYY
   173   95 B T     >  -     0   0   56  579   67      NDHSreDDN S  sLDSNNDDNNSNnDDngNDSSNDDNNShnssNDNDN NNNNDDSSNtNNSNSS
   174   96 B K  T  4 S+     0   0  145  525   79      PSKLfkDES S  e.Q.SPYDSKSSkSTrsKMSSSSESS.prppSSSSP RASSSSD.FvDG.GS.
   175   97 B E  T  4 S+     0   0  174  533   92      RWDTYRKYW W  I.N.YRNQWDYWEYVTATTYYWMEYN.VTVVKYKMS YPWWMMR.TTND.NY.
   176   98 B T  T  4 S-     0   0   44  561   58      TTTNGGTTT S  NNSGNTLFTTNDNNSRTTTNNITTTNSGMRNTQTTT TTNDTTNSTDTTSTNS
   177   99 B Y    ><  +     0   0   60  566   66      QILFAIVNL L  LFYLLQLVIVILLIYYLFIIILITILYYYYLKIKII LTILIILYFSLYYLLY
   178  100 B D  T 3   +     0   0   25  578   38      DDNDppDDD D  DDNtDDDDDDDDDDDDDSDDDDDDDDnANAANDNDD EDDDDDDnLnNEnDDn
   179  101 B F  T 3  S+     0   0   21  558   68      SNNNnnNNY N  FNHnNSNYNNNSRNNFFNSNNNNYNNnN.YNNNNNF NYNNNSNnSyHSnNNn
   180  102 B D    <   +     0   0    1  577    0      DDDDDDDDD D  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDDDDD
   181  103 B I        +     0   0    0  579   14      IIIIVVIII I  IIIIIIIVIIIIIIVVFLIIIIVFIIIIIIIFIFVF IIIIVVIIIIIVIIII
   182  104 B A  E     -QS 131 168G   0  579   60      MMMAAAASM M  GAAAMMSAMMMMAMAAAAAMMMASMMMAAAAAAAAA MAMMAAMMAAMAMMMM
   183  105 B V  E     -QS 130 167G   0  580   15      LLLLVVLLL L  LLLLLLLVLLLLLLLLLVLLLLLILLLLLLVILILL LLLLLLLLLLLLLLLL
   184  106 B L  E     -QS 129 166G   0  581   30      IIILLLIII I  VLLMIILVIIIILILLLLVIIIIFIIILLLIVIVIL LLIIIIIILLILIIII
   185  107 B R  E     -QS 128 165G  40  581   42      KKKRKKKKK K  QRKEKKKEKKKKHKKRERKKKKKEKKKKKKETKTKE KQKKKKKKKREQKKKK
   186  108 B L  E     - S   0 163G   0  581   17      LLLLLLLLL L  LLLLLLLLLLLLLLVILLLLLLLLLLLLLLLVLVLL LLLLLLLLLLVLLLLL
   187  109 B K  S    S+     0   0  101  581   69      SSANKKEVS S  KNRTSSSQSKSSRSEADNQSSSKESSSDARENKNKE SDSSKKSSERSASSSS
   188  110 B T  S    S-     0   0   82  582   74      RRSESTTKS S  RDKFSRGQQSKKKKTKETKKKSTDTQERTKQKSKTQ QKKKTTQKSKSLKSSK
   189  111 B P        -     0   0   48  582   39      PPPRSPPSP P  PRPPPPSDSPPPPPKPPKPPPPPPPPPPPPPDPDPP PAPPPPPPPkPpPPPP
   190  112 B I        -     0   0    4  532   62      AAAVIIIIA A  .VVVAALLAAAALAFIVLVAAAMIAAAAAAAMMMTV AVAAMMAAAa.vAAAA
   191  113 B T        -     0   0   95  537   72      TTTPVQEKA V  .PDTRTTESITTTTKATQNTTVTTTTSKQERAKATQ TETTTTTTRQ.TTTKT
   192  114 B F        +     0   0   56  580   32      LLFMLLFFL L  LIFILLFFVLLLFLLYVYRLLLLFLLLLTLLILILL LFLLLLILLLFFLLLL
   193  115 B R  B >   -U  196   0I  52  581   64      NNSSGGSNT N  pTSsDNNNNNNNTNntTTSNNNdSNNNDNNNdnddS NNNNddNNNTnTNNNN
   194  116 B M  T 3  S+     0   0   29  564   77      SEADKK.EG A  dDKdSSDKNSTSEQrcKRSTTAtDQSQRSKRkkktE QESSttNQPDsEQSSQ
   195  117 B N  T 3  S+     0   0   13  572   89      FYRATTERQ R  YFTRYFNNYQYYNYSTDESYYRNTYYYYKFATNTNE YYYYNNYYYHWYYRYY
   196  118 B V  B <   +U  193   0I   0  574   26      VVVISSKQV V  IIILVVVVVVVVIVVVVVVVVVARVVVVVIVTATAF VVVVAAVVVVVIVVVV
   197  119 B A        -     0   0    1  576   81      SQSKRQDKS S  DRKVRSAQQSQQVQRVNRDQQAKRQQQNGNNKKKKF QRQRKKRQSRSLQARQ
   198  120 B P        -     0   0    8  576   54      PPTPPPRAT T  WPPPTPPPPTPPPTKPIPFPPTPAPTPFFLLIAIPA PPPPPPTPPTPPPTTP
   199  121 B A        -     0   0    2  577   39      AVVIIVPVI I  IIVVVAIVVVVVIVVVIVAVVIVVVIVAVVAIVIVV VIVVVVVVIAVIVVVV
   200  122 B g  B     -g  290   0F   1  578   67      AASCPPISS S  PCCCSAAEASAACAKAKCCAASPQSAACCCCTGTPE ACAAPPSACCSCASSA
   201  123 B L        -     0   0   27  580    5      LLLLLLGLL L  LLLLLLLVLLLLLLLLLLILLLLLLLLLLLLLLLLL LLLLLLLLLLVLLLLL
   202  124 B P        -     0   0    7  581   31      PPPPFFIAP P  IPPPPPPTPPPPPPVAVAPPPPPPPPPPPPPAPAPP PPPPPPPPLPPPPPPP
   203  124AB E     >  -     0   0   92  580   75      SKTTDEARS S  MTKQSSEKSRSTTSDEDKRTTRPDSSTDEHTKAKAE TETTPPSTSTTETRST
   204  125 B R  H  > S+     0   0  109  580   79      RDSDAKKVA A  YDDPSRQTSSSRKSETQSKSSAQAGSSQTGQEKEQQ SASGQQSEESSIESGE
   205  126 B D  H  > S+     0   0  124  580   85      CCCKKGSAC C  DPRNCCGECCCCKCDGDDECCCGDCCCVEMSGGGGD CQCCGGCCEAMPCCCC
   206  127 B W  H  >>S+     0   0    4  580   87      AAPTEEYPA A  TASDAAHPPAAAVAHKVVDAAASEAAAPAQNSSSSQ AKAASSAAANVEAAAA
   207  128 B A  I  X>S+     0   0    0  580   75      APSLNEDKP A  TKESGATTPSPPAPEEEKTPPADDPGPESIESDSDE PRPSDDGAAQSAAASA
   208  129 B E  I  <5S+     0   0   75  581   83      DATLAAETA A  RTPIADAEATAAKAVVLELAAPVIAAAPPPIVVVVV AAAAVVTDTFVRDAAD
   209  130 B S  I  <5S+     0   0   70  582   65      GGGYpIPGG G  PYAYGGTNGNGGTGDPTMPGGGKAGGGKSAQPKPKE GIGGKKGGTPGRGGGG
   210  131 B T  I  <5S+     0   0   18  104   77      ....g.... .  ............L....................... ........T.TL....
   211  131AB L  I ><  S-     0   0  119  478   80      DMssqiSGs s  kKS.sDSAMSMMS.SMGQDMMSeKMA.SsSSs.se. MS..eeSM.NsVMSGM
   227  146 B E  T 3  S+     0   0   47  513   76      ESFEEEEES S  QEEASEEESISNSMEVSGTSSSGNSSMSSPEE.EG. SFMMGGSSDTSGSSSS
   228  147 B K  T 3  S+     0   0  169  537   69      GSGEGNNYG G  KDGLGGGNSGSPPSSGGTHSSGSHPGSHGGGGSGS. SRSSSSGSQDGGSGGS
   229  149 B G  S <  S-     0   0   29  548   67      STVGGGGQT I  EGGGVSGGTGTAQNGGGALTTTYQASSGGGGGYGYS TGSSYYTVGDTRVSSV
   230  150 B R        -     0   0  213  557   86      RAKKNDDRN N  TKTGNRNRAKAVSVPPPQFAANSEDNTSSWSSSSSE ANVVSSNAFFNTDSYD
   231  151 B Q  B     -V  224   0J  79  563   93      YDYVAHTAY Y  QPLLFYTLDYDSLSKAINGDDYLSDYDAPASSLSLS DTSSLLYDISYSDYYD
   232  152 B S        -     0   0   14  569   51      PRPSPPSSP P  FSPSPPPARPKGPGPSTDTSKPPNGPSPPPPSPSPN SSGGPPPGAPPEGPPG
   233  153 B T  S    S+     0   0   48  570   73      DNSCAESTE E  QCGADDDTNANDQDVTNNDNNESYDSNDDITTSTSE NPDDSSDDNNDKDSDD
   234  154 B R  B    S-T  150   0H 102  570   86      KKLTVVITL L  LIITNKVTKLKKVKNHVVIKKLEHKRRIINVTETEA RTQQEERKETKLKLRK
   235  155 B L        -     0   0    3  578    3      LLLLLLLLL L  LLVLLLLLLLLLLLLLLLLLLLLVLLLLLLLLLLLL LLLLLLLLLLLMLLLL
   236  156 B K  E     -FH  98 221F  31  578   51      QQQQHQKKQ Q  KQQQMQQQQQQQQQQKQQRQQQQRQMQQQRMRRRQR QQQQQQRQRMQKQQMQ
   237  157 B M  E     -FH  97 220F  18  579   94      CCCETTSVC C  SEHECCKSCCCCQCGGEEECCCRACCCQEQQARARA CVCCRRCCEKKVCCCC
   238  158 B L  E     - H   0 219F   4  580   42      LLLVVVAAL L  AVVLLLVVVLLLILVVVVALLLVVLLLAAAVVVVVT LALLVVLLVAVVLLLL
   239  159 B E  E     - H   0 218F 107  580   72      EEDEDDYTD D  VEDMDETYEENEHQKKERPNNDDSNWDTSSEHDHDN DVNEDDDSFRDSNKDN
   240  160 B V  E     - H   0 217F   0  580   46      AIAVVVVVA A  VVVVAAVVVAIILIVVVVVIIAIVIALVVVVVIVIV IVIIIIALLVVLLAAL
   241  161 B P  E     - H   0 216F  34  580   26      PPPPPPPPP P  QPPPPPPPPPPPPPPPPPPPPPDPPPPPPPPQAQDP PPPPDDPPPPPPPPPP
   242  162 B Y  E     -J  263   0F  36  581   45      LIVVIIIVL L  IVIIILLVIVIIIIYIFIIIIIVKIIIVVIIAVAVA IIIIVVIILLYVIVII
   243  163 B V  E     -J  262   0F  24  582   35      LLLLVVMVL L  VILLLLVVLLLLVLVVIIVLLLVVLLLVVVVHVHVV LVLLVVLLVLIVLLLL
   244  164 B D     >  -     0   0   88  581   58      SSSSSTNDS S  SSTTSSSDSSSSQSDSDATSSTSNSSSGSSSSSSSS SSSSSSSSDPSSSSSS
   245  165 B R  H  > S+     0   0   51  581   79      DKDNKKQQQ Q  KNLNDDDRDAYEQDQNFRDYYQRQDDERRRADRDRQ DRTTRRDHTHRLHDDH
   246  166 B N  H  > S+     0   0  105  582   75      DKTETSEKD A  NDDATDEEESSSERDENETSSAELSSRAAASDKDEE EERREESANASRASSA
   247  167 B S  H  > S+     0   0   48  582   78      TDAEDIKTQ Q  AVQKSTDTDSDDTDTETTKDDQQEDSDRRRTEEEQE DTDDQQSDTDDRDSSD
   248  168 B j  H  X S+     0   0    1  582    2      CCCCCCCCC C  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCC
   249  169 B K  H >< S+     0   0   88  582   73      FQHrsneaK E  qsrrRFrdNKNSRKsnRnQNNEdqSKDMeESKnKdr NnEEddRANSnrDKRE
   250  170 B L  H 3< S+     0   0  150  547   89      NNNkyearA A  ankgNNdlNKNNDNvgKtDNNAsyNNNKyV..s.ss SrNNssNNKRspNSNN
   251  171 B S  H 3< S+     0   0   23  578   76      ASSYEDYYA S  LYYYSAYKSSSSSSFGSWASSSKISASATTRKKKKY SSSAKKASTRAQSSSS
   252  172 B S    <<  -     0   0   20  581   83      YYYTPMFIY Y  YTRWYYGPYYYYTYALYYFYYYAFYYYYDYAYAYAG YYYYAAYYYYYYYYYY
   253  173 B S  S    S+     0   0   79  581   83      PPPPWFLRP P  RSAPPPAVPPPPKPGDSGEPPPGGPPPRPPYFNFGG PHPPGGPPDRDAPPPP
   254  174 B F  S    S-     0   0  124  581   79      FGGSGGDDG G  KSSFGFDVGGGGIGKDTGYGGGAAGGGGNKGRARAY GGGGAAGGFNGQGGGG
   255  175 B I        -     0   0  100  582   88      QMKMGGPPQ Q  VMRQGQEGMQMMRMDKSKEMMQDIMQMQQRRSESDQ MQMMDDQMTKEEMQKM
   256  176 B I        -     0   0   13  582   16      IIVIIIIII I  IIIIIIILIIIIVIIILVIIIIVIIIIIILLLVLVI IIIIVVIIVMIIIIII
   257  177 B T    >   -     0   0   16  582   36      TTTTPPTTT T  TTTTTTLTTTTTTTTSTTTTTTSSTSTHHHHTTTST ETTTSSTTTTTSTTTT
   258  178 B Q  T 3  S+     0   0  133  582   68      KNDNQDKNE E  RDSGAKDPKSNSDEEDDNTNNEEENSNEDDESDSED NTDDEESQSPAQQGSP
   259  179 B N  T 3  S+     0   0   24  582   61      NSNNGGNNN N  NNNRNNSRANATNSNSRNNAANNQSNASSSSNNNNR TRAANNNSDRNNSNNS
   260  180 B M  E <   - K   0 311F   2  582   11      MMMMQQMMM M  MMMMMMMMMMMMMMMMMMQMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMM
   261  181 B F  E     - K   0 310F   8  581   34      IFFLIIFFV V  MMLLFIIFFFFFFFLFFIMFFIIFFFFLLLVFIFII FLFFIIFFILFFFIFF
   262  182 B j  E     +JK 243 309F   1  582    0      CCCCCCCCC C  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCC
   263  183 B A  E     +JK 242 308F   0  582   27      AALAAAAAA A  AAAAAAAAALAAAAAAAAAAAAGAAAAAAAAAGAGA AAAAGGAAAAAAAVAA
   264  184 B G  S    S-     0   0    3  582   10      GGGGAAGGG G  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGG
   265  185 B Y        -     0   0   56  561   58      YYFYFFDKF F  AYKYFYVLFFYYFYVFFYYYYFDYYFYLLYRPDPDY YYYYDDFYFYYRYFFY
   266  185AB D  S    S-     0   0   81  565   84      LLLPPPGGL L  QLGILLPELLLLSLRPLPRLLLVQLLLDDDAPVPVQ LTLLVVLLQLMRLLLL
   267  185BB T  S    S+     0   0   76  582   62      EEEkAAKPE E  KgKEEEEGEEEEpEREgEREEEaEEEEANQSEaEaA EEEEaaEEAqSEEEEE
   268  186 B K  S    S-     0   0  107  532   32      GGGgGG..G G  .g.GGGG.GGGGiGGGgGGGGGgGGGGGGGGGgGgG GGGGggGGGgGGGGGG
   269  187 B Q  S    S+     0   0  102  537   37      GGGQGG..G G  .K.GGGG.GGGGSGGGGRGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGG
   270  188 B E        +     0   0   33  581   54      KKKKKKTTK K  HKQRKKKKKKKKGKKKKKVKKKVKKKKVVIIKKKVK KVKKVVKKKVKKKKKK
   271  189 B D  B     -E   94   0E   7  582    3      DDDDDDDDD D  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDDDDD
   272  190 B A        -     0   0    7  582   42      SSSSTTAAS S  ASSSSSSSSSSSSSSSASTSSSSSSSSATSSSSSSA STSSSSSSATSASSSS
   273  191 B k    >   -     0   0    7  582    0      CCCCCCCCC C  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCC
   274  192 B Q  T 3  S+     0   0   90  582   25      QQQQQQQQQ Q  QQQQQQQQQDQQEQQQQQAQQQQQQQQQQQQQQQQQ QQQQQQQQRNQEQQQQ
   275  193 B G  T 3  S+     0   0    6  582    7      GGGGGGGGG G  GGGGVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGG
   276  194 B D    X   +     0   0    0  582    0      DDDDDDDDD D  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDDDDD
   277  195 B S  T 3  S+     0   0   14  582    1      SSSSSSSSS S  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSSSS
   278  196 B G  T 3  S+     0   0    0  582    0      GGGGGGGGG G  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGG
   279  197 B G    <   -     0   0    0  582    2      GGGGGGGGG G  GGGGGGGGGGGGGGGGGGGGGGGGGGSGGGGGGGGG GGGGGGGGGGGGGGGG
   280  198 B P  E     - L   0 294F   1  582    3      PPPPPPPPP P  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPPPPPPPPPPPPPP
   281  199 B H  E     -IL 219 293F   0  582   49      LVVLLLAGV V  MLLLVLLLVVVVFVLVVLLVVVVVVLVMLMMAVAVL VLVVVVVVLLVFVVVV
   282  200 B V  E     -IL 218 291F   3  582   27      MVVVVVVVV V  IVLQVMAVVVVVVVVVVVMVVVVVVVVVVVVVVVVV VAVVVVVVAVVAVVVV
   283  201 B T  E     - L   0 290F   0  582   67      CCCTIIVIC C  CAVVCCADCCCCMCDDVCCCCCDDCCCCCCCKDKDE CTCCDDCCFCRACCCC
   284  202 B R  E     + L   0 289F  99  582   70      NNNEAAGDR N  TERYNNSDNNNNKNEEDHENNNIENNNEEEEGVGIG NQNNIIGNFEGFNNNN
   285  203 B F  E >  S- L   0 288F  22  582   70      GNGrGGKGG G  GrHnGGDGGGGGnGNNGEiGGGANGNGNSSYNKNAK GvGGAAGGqRGDGGGG
   286  204 B K  T 3  S-     0   0   85  206   71      ...d..... .  .dGt..T.....d....Dr........AGGN..... .s......eD.N....
   287  205 B D  T 3  S+     0   0  108  208   57      ...Q..... .  .KDH..G.....D....GR........GGGG..... .D......EG.G....
   288  206 B T  E <   - L   0 285F   3  218   75      ...R..... .  .RKR..S.....R....VR...T....RKRK.N.T. .K..TT..TR.R....
   289  207 B Y  E     - L   0 284F  21  227   50      ...Y..... .  .YHY..T.....W.KR.YW...KN...FFFF.N.K. .F..KK..WW.W....
   290  208 B F  E     -gL 200 283F   0  582   91      EQEERRKKE E  REEEQEYKEEEEYENVVRHEEEQVQQEYVFNVQVQT EEQQQQRVITRHVQQV
   291  209 B V  E     + L   0 282F   1  582   41      LLLLQQILL L  LLILLLLLLILLQLLQLLVLLLIQLLLILLLQVQIL LLLLIILLQVVLLLLL
   292  210 B T  E     +     0   0F   1  582   84      QQQIAAYVQ Q  TIVVQQAAQQQQIQVVHQYQQQVHQQQQHHELVLVV QTQQVVQQGWYLQQQQ
   293  211 B G  E     -ML 312 281F   0  582    0      GGGGGGGGG G  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGG
   294  212 B I  E     -ML 311 280F   0  582   19      VVIVIIIVI I  VVIIVVIVIIVVIIVIIVVVVIIVILVAAVVVIVIV VVVVIIVVVIVVVIVV
   295  213 B V  E     +M  310   0F   7  582   14      VVVVVVVVV V  VVVVVVVVVVVVVVVVVVTVVVVVVVVTTTVVVVVV VVVVVVVVVTVVVVVV
   296  214 B S  E     -     0   0F   1  581    0      SSSSSSSSS S  SSSSSSSSSSSSSSSXSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSSSS
   297  215 B W  E     -M  309   0F  45  582    8      WWWWWWTSW W  WWWWWWWFWWWWWWWWWWFWWWWWWWWWWWWFWFWW WWWWWWWWWFWWWWWW
   298  216 B G        -     0   0   26  582    0      GGGGGGGGG G  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGG
   299  217 B E  S    S-     0   0   25  577   90      HYLNNNMMY Y  ENVREHYMYSYYEYNERFEYYYYKYYYNYVKVYVYI YAYYYYYYWFYDYYYY
   300  218 B G  S    S-     0   0   19  580   15      GGGGGGKEG G  GGGAGGGGGVGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGG
   301  220 B k  S    S-     0   0    7  582    2      CCCCCCCCC C  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCC
   302  221 B A  S    S+     0   0    4  581   17      AAAAAAGGA A  AAGAAAAAAAAADAAAXAGAAAAAAAAAAGAAAAAA AAAAAAAAGAAAAAAA
   303  222 B R    >   -     0   0  105  578   74      QELRRRSSQ Q  TRRQQQRREMEERERLLRDEEQRLEQEAAFRRRRRE EREERRQERSELEQQE
   304  223 B K  T 3  S+     0   0  152  578   65      RKKVKKSTK K  IPAKKRPRKRPQSRPAPPKPPKKPRRRPKRPKKKKP KQRRKKRRKPRRRKRR
   305  223AB G  T 3  S+     0   0   26  582   58      NDGGGGFYN N  GYGNNNGGNGGNGDNGDRGGGNGSNNDGGGGNGNGG NYDDGGNDNGNGDNND
   306  224 B K    <   -     0   0   43  582   85      KHKYYYYYK K  KYYYKKYKHKNHKHMKYQKNNKYYHKHKKNKNYNYY HKHHYYKHRFFKHKKH
   307  225 B Y        -     0   0   33  582   49      PPPPPPPPP P  PPPPPPPPPPPPYPPPPPFPPPPPPPPFFFYPPPPP PYPPPPPPYPPYPPPP
   308  226 B G  E     -K  263   0F   4  580    2      GGGGGGGGG G  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGG
   309  227 B I  E     -KM 262 297F   6  581   10      VVVVVVVIV V  VVVVVVVVVVVVFVVVVVIVVVVVVVVVVVVIVIVV VVVVVVVVVIVVVVVV
   310  228 B Y  E     -KM 261 295F   1  581    2      YYYYYYYYY Y  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYYYYYYYYY
   311  229 B T  E     -KM 260 294F   2  581   40      TATTTTTTT T  TTTTATTTTTAPTAAASATAATTAATAAASAATATS STAATTAATSTTATTA
   312  230 B K  E >   - M   0 293F  21  581   40      KKKREERRK K  SRRRKKENKKKKHKKKKKKKKKRKKKKRNKKKRKRR KDKKRRKKNRKRKKKK
   313  231 B V  G >  S+     0   0    1  581    8      VVVVIIVVV V  VVVVVVVLVVVVLVVVIVVVVVVVVVVVVVVVVVVV VVVVVVVVIVVLVVVV
   314  232 B T  G 3  S+     0   0    2  579   72      CCCTAAYDC C  FTANCCSACCCCFC SSTTCCCGSCCCKKTRSGSGA CSCCGGCCIVNHCCCC
   315  233 B A  G <  S+     0   0   29  579   80      NKNNASKKN N  EQRKNNYNINIMRL HYRNIINNAINLYYHHANANA VYIINNNVHNRRVNNV
   316  234 B F  S <> S+     0   0    7  575   36      YFYYVVYYF F  LYYFYYH FYFFMF  AYFFFFFVFYFVLSLAFAFV QFFFFFYLYFHFLYFL
   317  235 B L  H  > S+     0   0   23  573   81      IILIRRYYT V  RLLLNIV TLNSRN  RLSNNVVRSTNLLLRAIAVR SRTTVVVSLLARSVNS
   318  236 B K  H  > S+     0   0  116  572   68      SPDDEDDED D  SDPRSSD DSDDKD  DRQDDDDNDTDDTGAKDKDD EDDDDDSGPPSDGNSG
   319  237 B W  H  > S+     0   0   26  572    1      WWWWWWWWW W  WWWWWWW WWWWWW  WWWWWWWWWWWWWWWWWWWW WWWWWWWWWWWWWWWW
   320  238 B I  H  X S+     0   0    1  569   12      ILIIIIIII I  IIIIIII IILLMI  IIILLIIILILIVILIIIII LILLIIIVIIIIVIIV
   321  239 B D  H  < S+     0   0   66  541   72      KQQKRK  K K   KRKRKK AQTRLD  KETTTQERDRTKKLDKEKEK HDKEEEQRHNNTLQRR
   322  240 B R  H >< S+     0   0  136  528   71      DQEEEE  E T   EANDD  QESTKS  EEKSSSSESNNSTKGSSSSE SKNTSSSDDNGEDQDD
   323  241 B S  H >< S+     0   0    6  495   71      TTTN H  T T   NNNTT  TTTTTT  NQITTT  TTTEQEHT T   TMTT  TTVIY TTTT
   324  242 B M  T 3< S+     0   0   25  452   39      MMIT V  I I    MVMM  IMMMIM   TLMMI  MIMMMMI      MVMM  MMMII MIMM
   325  243 B K  T <  S+     0   0  153  418   69      AAAQ N  A A    DKAA  AAAA A   GKAAA  ANSAAAR      SNAA  SAS N AAAA
   326  244 B T    <         0   0   51  369   66      SSAD    A A    DDSS  SNTS     GNSTA  SSS TS       N SS  SNG   SAST
   327  245 B R              0   0  197  260   47       NN     N N     SN   NN       DN  N  NN  R              N      NN 
## ALIGNMENTS  421 -  490
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1   49 A Q              0   0  101  253   29              Q                                      R  Q     QQ    QQ  
     2   50 A a    >   +     0   0   22  341    0       C      C                            C         C  C     CC    CC  
     3   51 A E  T 3  S+     0   0  187  342   77       I      A                            I         S  A     AA    LS  
     4   52 A T  T 3  S-     0   0  105  342   54       S      D                            S         S  E     EE    SS  
     5   53 A S    <   +     0   0   89  342   62       Q      Q                            Q         N  K     KK    NN  
     6   54 A P        +     0   0   10  343   18       P      P                            P         P  P     PP    PP  
     7   55 A b        -     0   0   18  344    0       C      C                            C         C  C     CC    CC  
     8   56 A Q  S    S+     0   0   92  343   70       L      K                            L         Q  K     KK    FQ  
     9   57 A N  S    S-     0   0   63  303   24       N      N                            N         H  N     NN    .H  
    10   58 A Q  S    S-     0   0  152  336   48       N      G                            N         N  G     GG    NN  
    11   59 A G        -     0   0   16  344   17       G      A                            G         G  A     AA    GG  
    12   60 A K  E     -A   23   0A 117  344   75       T      M                            T         V  M     MM    TA  
    13   61 A a  E     -A   22   0A  45  344    0       C      C                            C         C  C     CC    CC  
    14   62 A K  E     -A   21   0A 155  344   82       K      S                            K         E  L     SS    LQ  
    15   63 A X  E     +A   20   0A 120  302   29       D      D                            D         D  D     DD    DD  
    16   64 A G        -     0   0   44  341   74       H      S                            H         S  S     SS    NS  
    17   65 A L  S    S-     0   0  152  342   69       I      V                            I         I  V     VV    II  
    18   66 A G  S    S+     0   0   67  343   62       R      G                            R         R  G     GG    GR  
    19   67 A E        -     0   0  119  329   61       S      G                            S         G  G     GG    RS  
    20   68 A Y  E     -A   15   0A  37  342    9       F      Y                            F         Y  Y     YY    FY  
    21   69 A T  E     -A   14   0A  71  343   83       S      D                            S         T  D     DD    NT  
    22   70 A b  E     -A   13   0A  20  343    0       C      C                            C         C  C     CC    CC  
    23   71 A T  E     -A   12   0A  85  344   80       T      I                            T         T  V     VV    IT  
    24   72 A c        -     0   0   44  344    1       C      C                            C         C  C     CC    CC  
    25   73 A L    >   -     0   0   62  344   86       A      K                            A         A  K     KK    NT  
    26   74 A E  T 3  S+     0   0  177  344   74       P      S                            P         E  S     SS    QD  
    27   75 A G  T 3  S+     0   0   29  344   24       G      G                            G         G  G     GG    GG  
    28   76 A F  E <   +B   36   0B  40  343   16       Y      F                            Y         Y  F     FF    WY  
    29   77 A E  E     +B   35   0B  74  343   63       E      T                            E         E  S     TT    EE  
    30   78 A G  S >  S-     0   0   32  343    1       G      G                            G         G  G     GG    GG  
    31   79 A K  T 3  S+     0   0  156  343   72       K      T                            K         E  Q     VV    RE  
    32   80 A N  T 3  S-     0   0   33  343   62       T      H                            T         N  N     HH    LN  
    33   81 A c  S <  S+     0   0    1  344    0       C      C                            C         C  C     CC    CC  
    34   82 A E        +     0   0   87  342   30       a      e                            a         a  q     ee    qn  
    35   83 A L  E    S-B   29   0B  96  289   42       l      l                            l         h  l     ll    nq  
    36   84 A F  E     -B   28   0B 139  292   93       E      I                            E         H  C     CC    YY  
    37   85 A T        -     0   0   44   76   76       .      .                            .         .  .     ..    ..  
    38   86 A R        +     0   0   57  101   88       .      .                            .         .  .     ..    ..  
    39   87 A K        +     0   0   96  140   78       .      .                            .         .  .     ..    T.  
    40   88 A L        -     0   0   91  168   91       .      .                            .         .  .     ..    D.  
    41   89 A d  S  > S+     0   0   15  238   19       .      .                            .         .  V     VV    C.  
    42   90 A S  T  4 S+     0   0   98  244   86       .      .                            .         .  M     VV    S.  
    43   91 A L  T >4 S-     0   0  120  274   90       .      D                            .         Q  E     DD    TK  
    44   92 A D  G >4 S-     0   0  107  297   62       R      K                            R         A  K     SS    YT  
    45   93 A N  G >< S-     0   0    8  315   63       T      S                            T         K  D     DD    NR  
    46   94 A G  G <  S-     0   0    0  316   53       D      K                            D         V  K     KK    GE  
    47   95 A D  G <  S+     0   0   44  344   60       G      G                            G         G  G     GG    GG  
    48   96 A e    <   -     0   0    0  344    1       C      C                            C         C  C     CC    CC  
    49   97 A D  S    S-     0   0   59  344   73       Q      S                            Q         D  S     SS    EQ  
    50   98 A Q  S    S+     0   0    2  344   62       H      Q                            H         H  Q     QQ    HH  
    51   99 A F  E     -C   62   0C   4  344   77       F      F                            F         F  F     FF    FF  
    52  100 A d  E     +C   61   0C  10  344    0       C      C                            C         C  C     CC    CC  
    53  101 A H  E     -C   60   0C  68  344   86       H      K                            H         Y  K     KK    NY  
    54  102 A E  E     -C   59   0C  92  344   56       P      P                            P         P  P     PP    EP  
    55  103 A E  S    S-     0   0  100  344   81       G      g                            G         g  g     gg    dg  
    56  104 A Q  S    S-     0   0  175  310   77       Q      h                            Q         .  v     ..    te  
    57  105 A N  S    S+     0   0  154  307   78       S      .                            S         d  .     tt    q.  
    58  106 A S  S    S-     0   0   58  337   71       S      S                            S         S  S     SS    RS  
    59  107 A V  E     -C   54   0C   7  343   86       Y      Y                            Y         Y  Y     HH    RY  
    60  108 A V  E     -C   53   0C  45  344   87       M      E                            M         R  E     EE    YH  
    61  109 A e  E     +C   52   0C   5  344    0       C      C                            C         C  C     CC    CC  
    62  110 A S  E     -C   51   0C  24  344   70       S      S                            S         S  S     SS    SS  
    63  111 A f        -     0   0   23  344    0       C      C                            C         C  C     CC    CC  
    64  112 A A    >   -     0   0    8  344   70       A      A                            A         A  A     AA    SA  
    65  113 A R  T 3  S+     0   0  149  344   83       K      Y                            K         D  P     QQ    PK  
    66  114 A G  T 3  S+     0   0   24  344   13       G      G                            G         G  G     GG    GG  
    67  115 A Y  E <   -D   78   0D  20  344    7       Y      W                            Y         Y  W     WW    YY  
    68  116 A T  E     -D   77   0D  72  343   81       K      K                            K         K  K     KK    RE  
    69  117 A L  E     -D   76   0D  67  340   68       L      L                            L         L  L     II    LL  
    70  118 A A    >   -     0   0   23  340   78       G      Q                            G         G  S     NS    MG  
    71  119 A D  T 3  S+     0   0  175  340   77       E      Q                            E         K  T     NG    DE  
    72  120 A N  T 3  S-     0   0   92  340   74       D      K                            D         D  T     SS    DD  
    73  121 A G  S <  S+     0   0   16  340   56       H      E                            H         K  D     DD    HK  
    74  122 A K  S    S+     0   0   71  332   83       R      K                            R         R  R     TK    AK  
    75  123 A A        -     0   0   22  330   70       S      C                            S         R  n     tt    KS  
    76  124 A f  E     -D   69   0D  12  300   48       C      .                            C         C  c     cc    CC  
    77  125 A I  E     -D   68   0D  78  304   82       S      V                            S         I  M     VV    EI  
    78  126 A P  E     -D   67   0D  62  304   56       P      P                            P         A  P     PP    PP  
    79  127 A T  S    S+     0   0  103  304   79       S      A                            S         L  A     TT    AR  
    80  128 A G  S    S-     0   0   32  305   75       D      V                            D         D  V     GG    VD  
    81  129 A P  S    S+     0   0  116  311   78       K      T                            K         A  P     RR    EQ  
    82  130 A Y  S    S+     0   0   59  312   77       C      F                            C         C  K     FF    FC  
    83  131 A P    >   -     0   0   17  312   34       A      P                            A         A  P     PS    AA  
    84  132 A g  T 3  S+     0   0   16  323    2       C      C                            C         C  C     CC    CC  
    85  133 A G  T 3  S+     0   0    0  295   30       G      G                            G         G  G     GG    GG  
    86  134 A K    <   -     0   0   69  294   62       A      K                            A         R  R     RR    KR  
    87  135 A Q        -     0   0   37  243   74       L      V                            L         L  L     VV    VR  
    88  136 A T        +     0   0    4  220   79       T                                   T            S     SS    KD  
    89  137 A L        +     0   0  105  200   57       S                                   S                  S     AD  
    90  138 A E              0   0  104  120   71       Q                                   Q                  V     NG  
    91  139 A R              0   0  231   97   28       H                                   H                  R     RK  
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3  IIIII IIIII  IIIIIIIIIIIVIIIIIIIIII IIIII IIIIIIIII II IIIII  IIII  II
    94   17 B V  B     -E  271   0E   7  561    9  VVVVV VVVVI  VVVVVVVVVVVVVVVVIVVVVI VIVVV VVVVVVVVV VV VVVVV  VVVV  VV
    95   18 B G  S    S+     0   0   25  562    6  GGGGG GGGGG  GGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGG GG GGGGG  GGGG  GG
    96   19 B G  S    S-     0   0   26  563    0  GGGGG GGGGG  GGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGG GG GGGGG  GGGG  GG
    97   20 B Q  E     -F  237   0F  98  564   95  SYYYQ YYVEI  YKKQKKKDYTYEYYRYEYFYYQYYEYYY SESSSYYYT YQ YYYYY  RYSY  RR
    98   21 B E  E     -F  236   0F  80  565   65  SEEEI ESKKS  TEEEEEEPTDMTTTPTPTTEEEQQETTT TDTTTETTD TD EETEE  PEST  EE
    99   22 B h        -     0   0    8  565   58  VCCCT CVAAT  CCCCCCCVCACACCTCACCCCCCCVCCC TITTTCCCS CA CCCCC  TCAC  TT
   100   23 B K    >   -     0   0  123  564   79  NESTN RTQLT  ATAVTATNQAPSQQGEDQARTEEEQEQQ TDTTTRAAS GE TRETL  IAAE  TS
   101   24 B D  T 3  S+     0   0   60  565   85  IPKPI KIAAI  APPPPPPIAVKVAQVEIEEPPPAAPEKK IIIIIKEEP KL PKEPK  PALK  II
   102   25 B G  T 3  S+     0   0    0  565   73  EYNHS NDGGD  NYYHYYYENGNDNNNNLNNHHHHHFNNN QTQQQNNNG NG HNNYN  NHGN  EE
   103   26 B E  S <  S+     0   0   36  565   67  NSSSN SKDEK  SSSSSSSESESSSSQSDSSSSSSSSSSS NGNNNSSSE AE SSSSS  KSDS  EE
   104   27 B h    >   +     0   0    4  565   91  FQVQF VACCY  IMMQMMMIVFVWVLYVFVVQQRQQIVIL FAFFFVVVW VW QVVQV  YQWL  HH
   105   28 B P  T 3   +     0   0    0  567    9  GPPAP APPPPP PPPPPPPPPPPPPPPPPPPPAPPPKPPP PPPPPAPPP PP PPPPP  PPPP  PP
   106   29 B W  T 3  S+     0   0    5  568   27  WWYHW YYYYYW YHYHHYHYYWYWYYWYWYYHHFWWYYYY YYYYYYYYW YW HYYHY  WWWY  WW
   107   30 B Q  E <   -N  122   0G   7  569   24  QQQQQ QqQQQm QQQQQQQQQqQQQQLQqQQQQMQQqQQQ QQQQQQQQQ QQ QQQQQ  VQQQ  QQ
   108   31 B A  E     -NO 121 146G   1  559   47  VAVVV VlIIVa VVVVVVVVViVVVVAVsVVVVAVViVVV VVVVVVVVV VV VVVVA  AVVV  VV
   109   32 B L  E     -NO 120 145G   3  567   65  SSSSS SLSSSL SSSSSSSSSQSSSSRSISSSSSSSLSSS SSSSSSSSS SS SSSSS  RSSS  SS
   110   33 B L  E     -NO 119 144G   0  570   11  LLLLI LLLLLL LLLLLLLLLFLILLLLLLLLLLLLFLLL LLLLLLLLL LL LLLLL  LLLL  LL
   111   34 B I  E     -NO 117 143G   0  570   81  FNDNQ NEQQHA NNNNNNNNNHNQNNVNYNNNNNNNLNNN QLQQQNNNH NH NNNNF  VNHN  QQ
   112   35 B N  E >   - O   0 142G  30  570   88  DAASR SKSSYs SSSSSSSYVRVYVSYVFASASYVVNSSA YNYYYSSSA SF AVSST  YEVI  VF
   113   36 B E  T 3  S+     0   0   63  113   77  ..... .....q ............................ ......... .K .....  ....  ..
   114   37 B E  T 3  S-     0   0  136  242   76  R...S .G..NN .......R..GN................ GRGGG.... .T .....  ..Q.  LL
   115   38 B N  S <  S+     0   0   84  543   52  MGGGG GKSSGN GGGGGGGGG.GKGGDGGGGGGGGG.GGG GGGGGGGGR GQ GGGGG  EGGG  GG
   116   39 B E        -     0   0  100  561   93  GYYYS YESSKR SYYYYYYRYAMQYYGYKYYYYYYYYSYY SRSSSYYYL YG YYYYY  GYIF  FF
   117   40 B G  E     +N  111   0G  14  572   55  HHHHH HYHHLL HHHHHHHHHHHHHHQHHHHHHHHHHHHH HHHHHHHHH HH HHHHN  RHHH  HH
   118   41 B F  E     +     0   0G  28  581   35  FFFFF FyFFIF FFFFFFFRIFLIIFfFLFFFFFFFFFFF IFIIIFFFL FV FFFFF  fFIN  FF
   119   42 B i  E     -N  110   0G   0  578    1  CCCCC CcCCCC CCCCCCCCCCCCCCcCCCCCCCCCCCCC CCCCCCCCC CC CCCCC  cCCC  CC
   120   43 B G  E     -N  109   0G   1  581    2  GGGGG GGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGG GG GGGGG  GGGG  GG
   121   44 B G  E     -N  108   0G   0  581    9  GGGGG GGGGGG GGGGGGGGGGGGGGAGGGGGGGGGGGGG GGGGGGGGG GA GGGGG  AGGG  GG
   122   45 B T  E     -NP 107 130G   0  581   43  SSSSS SSSTSV SSSTSSSSSSTSSSSSSSSSSVSSTSAS SSSSSSSSS SS SSSSI  SVSS  SS
   123   46 B I  E     + P   0 129G   0  581   23  ILLLV LIIIIL LLLLLLLILILILLLLILLLLLLLLLLL IIIIILLLI LI LLLLL  LLIL  II
   124   47 B L        -     0   0    6  581   27  IVIVY IILLII IVVVVVVLILVLIILILIILVVIIIIII IIIIIIIII II VIIVL  VLII  II
   125   48 B S  S    S-     0   0   22  581   57  SNSSS SSDDSN NNNNNNNNSSNDSNTSSNNSNNNNHSSN SDSSSSNNS SS NSSNS  TNTS  SS
   126   49 B E  S    S+     0   0   99  581   62  DESAK SKEEKE SEEEEEEENNHPNSKDRDDDEKDDKEDS ANAAASEDN SN QSEEE  NDPD  EQ
   127   50 B F  S    S+     0   0   42  581   82  ENTND TRYYQW QNNNNNNKQWQHQEDQWQQSNQRRQQQQ NDNNNTEEQ QK NTQNE  DQDQ  DD
   128   51 B Y  E     - Q   0 185G   7  581   33  WWWWT WHWWWF WWWWWWWFWWWWWWYWWWWWWWWWWWWW YLYYYWWWW WW WWWWW  YWWW  TT
   129   52 B I  E     -PQ 123 184G   0  581   14  VVVVI VIIIIV VVVVVVVVVVVIVVVVIVVVVVIIVVVV VIVVVVVVV VL VVVVV  VVIV  II
   130   53 B L  E     +PQ 122 183G   0  581   28  LVVVI VLLLLL VVVVVVVLVILLVVLVLVVVVLVVVVLV LLLLLVVVL VL VVVVL  IIVL  LL
   131   54 B T  E     - Q   0 182G   0  581   43  TSSST STTTTT SSSSSSSTSTSTSSTSTSSSSSSSTSSS TTTTTSSST SS SSSSS  TSTS  TT
   132   55 B A    >>  -     0   0    0  581    2  AAAAA AAAAAA AAAAAAAAAAAAAAAAAAAAAVAAAAAA AAAAAAAAA AA AAAAA  AAAA  AA
   133   56 B A  G >4 S+     0   0    0  581    8  AAAAA AAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAGAA AAAAAAAAA AS AAGAA  AAAA  GG
   134   57 B H  G >4 S+     0   0    7  581    0  HHHHH HHHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHH HH HHHHH  HHHH  HH
   135   58 B i  G X4 S+     0   0    0  581    2  CCCCC CCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCC CC CCCCC  CCCC  CC
   136   59 B L  G << S+     0   0   31  581   65  VYYYV YLVVVL YYYYYYYTYFYFYYVYFYYSYWWWWYYY ILIIIYYYV YF YYYYK  VWVY  TT
   137   60 B Y  G <  S+     0   0  109  581   87  FKKKR KVNAYN KKKKKKKDQTNRQMRMIKKKKYQQRKKK ILIIIKKKT KK QQKKA  RKER  VV
   138   61 B Q  S <  S+     0   0   95  581   78  dSSSg Sdgggd SSSSSSSlSrTkSSrYnSYPSNNNPPSS gggggSSSs Sy SSSSD  rIeP  ss
   139   61AB A        -     0   0   16  352   75  pP..i .iaalt .......l.k.v..r.r....PPPS... akaaa...p .v .....  rPw.  aa
   140   62 B K  S    S-     0   0  172  366   75  KS..S .SKSSE .......A.S.S..N.S....YFFH... SRSSS...N .R .....  SST.  SS
   141   63 B R  S    S-     0   0  162  570   78  QSRRT RQKKLE RRRKRRRNRNRNRRKRGRRRRASSLHQR QNQQQRRRI RT RRRR.  KTAN  MM
   142   64 B F  E     -O  112   0G  36  577   54  YLIVL IVLLFV IVVMVVVFFLIWFIIILIIIIMQQIIII HLHHHIIIW IF VIIVL  IHFI  MM
   143   65 B K  E     -O  111   0G  67  577   78  AEQEK QHSSKT QEEDEEERQNQKQQRQEQQEEQIIQQQQ RQRRRQQQR QI EQQEE  RVAQ  AS
   144   66 B V  E     -OR 110 161G   0  577   16  VVVVV VAIIVV VVVIVVVVVIVVVVVVIVVVVIAAVVVV IVIIIVVVI VY VVVVV  IAGV  VV
   145   67 B R  E     -OR 109 160G  40  577   53  RRRRR RRRRRR RHRVHRRRRARRRRIRIRRRRMIIVRRR RRRRRRRRY QH RRRRR  IIIR  RR
   146   68 B V  E     +OR 108 159G   1  578   43  VLLLA LVYYVL LLMLLMMTLVLALLLLHLLLLLLLLLLL VAVVVLLLA LL LLLLL  LVLL  LV
   147   69 B G  S    S+     0   0    9  578   14  GGGGG GGNNAG GGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGG GY GGGGG  GGRG  GG
   148   70 B D        +     0   0   11  579   58  SEEES ESTSSE EEEDEEESETDSEEDVEEEEEEDDDEEE SSSSSEEEI KC EEEEE  DEQE  SS
   149   71 B R  S    S+     0   0   24  579   73  SHHHS HTLLSF HHHHHHHNHTHDHHYYRHHHHHHHHHHH TSTTTHHHL HN HHHHH  YHSH  SS
   150   72 B N  B >   -T  234   0H  18  579   65  LHNNN NNKKYH NNNNNHHHNHNKNDDNRNNNNNHHDNNN FSFFFNNNR NQ HNNNN  DTFN  RR
   151   73 B T  T 3  S+     0   0   56  579   79  HIIIW INHHHF ILIRLIISILLLIIQIVIILLVIIIIII SNSSSIIIQ LL IIIII  QIMI  TT
   152   74 B E  T 3  S-     0   0  119  579   84  NRAKY ADASDR DRRWRRREADRGAEFDGEERRRWWTEED NRNNNAEES ET RAERW  YWFN  DA
   153   75 B Q  S <  S-     0   0  130  578   86  KVVVE VKSLEW VVVFVVVSVSVNVVVVTVVVVVMMKVVV SESSSVVVE TF NVVAE  VYYV  RD
   154   76 B E        +     0   0  165  578   85  GNSTG NGGGGp LKTMKTTNTPLFTLaMKEENNFQQQLLV GGGGGNDVi TN NNLNP  nTGI  GG
   155   77 B E        -     0   0   93  438   29  .EEE. E....l EEEDEEE.E.E.EEeE.EEEEEEEEEEE .....EEEe ET DEEED  dESE  ..
   156   78 B G  S    S+     0   0   46  547   33  GGGGG GG.GGS GGGGGGGGG.GPGGTG.GGGGGGGGGGG GGGG.GGGD SA GGGGG  GGGG  GG
   157   79 B G  S    S+     0   0   47  555   76  FTTNV TK.EIR NNNNNNNQNKSSNTPN.NGSSTPPPNNG TVTT.TNNT TQ TTNTT  KTYD  VA
   158   80 B E        -     0   0   37  444   33  .EEE. E.G... EEEEEEE.EMELEEAENEEEEEEEEEEE ....DEEE. Q. EEEEE  AE.E  ..
   159   81 B A  E     -R  146   0G  27  457   60  .QQQ. Q.E.LR QQQQQQQ.QEQPQQIQLQQQQQQQQQQQ ....TQQQP Q. QQQQQ  IQ.Q  ..
   160   82 B V  E     -R  145   0G  71  557   81  IFFFV FVKKID FYFIYFFVFRFVFFMFRFFYYLYYRFFF IVIIIFFFF LR FFFFH  MY.F  LL
   161   83 B H  E     -R  144   0G  14  567   77  HIIIV IYIITH IIIIIIIHIRIAIIRIMIIIIMMMFIII YVYYYIIIF IR IIIII  RM.I  HH
   162   84 B E        -     0   0   90  569   77  KRDSD NSQSNE NSSSSSSRNRSKNDANKSNSSKSSKNKD NPNNNNNNK NR TDNSM  ASRD  ED
   163   85 B V  E     -S  186   0G  27  574   64  IASSP STVVIV ASSASSSISLAISSVSVSSSSTVVVAAA AVAAASSSV SV SSASS  VIVA  VV
   164   86 B E  E    S+     0   0G  70  575   73  ASAST AKAASE ASSESSSGADTFAATADAASSEDDAAAA AGAAAAAAE AK SVASS  SDAA  RH
   165   87 B V  E     -S  185   0G  13  576   72  KKKRD RSEKSR KRRRRRRKKREVKSAKKKKRRNAALKKK QEQQQRKKE KR RKKRK  AAKK  EE
   166   88 B V  E     -S  184   0G  72  577   45  VVVVI VMIIII IVVVVVVIVLVTVVIVLVVVVIIIVIII VYVVVVVVI VI VIIVF  IIVI  II
   167   89 B I  E     +S  183   0G  27  578   45  YLIIK ITYFID IIIIIIIHIVVEIIIIIIIIIIYYIIII IVIIIIIII II IIIIV  IYII  VV
   168   90 B K  E     -S  182   0G  68  578   82  IRRRI RIQAPI TRRPRRRKRMRLRRRRTRRRRWWWSRRR RYRRRRRRV RT RRRRR  RTSL  RR
   169   91 B H    >   -     0   0   19  579   14  HNHHH HHHHHH HHHHHHHHHHHNHHHHHHHHHHHHHHHH HNHHHHHHH HH HHHHH  HHHH  HH
   170   92 B N  T 3  S+     0   0  156  579   60  PPPPE PPEEEE PPPPPPPKPPPIPPRPPPPPPPEESPPP ARAAAPPPS ST PPPPP  KEPP  EE
   171   93 B R  T 3  S+     0   0  150  576   74  DNSNS SNNKWK NNNNNNNLSQDTSNSRYRKQQSRRQKNS SDSSSSKNQ GG SSKNQ  NSNN  NN
   172   94 B F    <   -     0   0   24  579    5  YYYYY YYYYYF FYYYYYYFYFYYYYFYFYYYYYYYYYYY YFYYYYYYY YY YYYYY  FFYY  YF
   173   95 B T     >  -     0   0   56  579   67  DNNTN NNDDDN NNSENNNNNSNPNNDSDNNSSDDDKNNN NTNNNNNNK SN NSNSN  DDDS  kk
   174   96 B K  T  4 S+     0   0  145  525   79  ESSSA SSSSEP GSSSSSSRSQR.S.QSSSSSSYYYYRSA SFSSSSSSY PD SSSSP  MYPK  ii
   175   97 B E  T  4 S+     0   0  174  533   92  VWGYQ RRMYDK NYYWYYYNREQ.R.NWWWWYYQQQWIGN RHGRRRWWA YI YWWYR  NFKD  LY
   176   98 B T  T  4 S-     0   0   44  561   58  SDNNT NTTQTT TNNLNNNTTTT.TSSTFTTNNTTTTTTT TNTTTNTTR TT TNTNT  STTT  GG
   177   99 B Y    ><  +     0   0   60  566   66  YLLIM LYIIYF LIIVIIIYYMVKYFYLLLLIILLLFLYF LMLLLLILI LY ILLIQ  YLKS  II
   178  100 B D  T 3   +     0   0   25  578   38  DDNNM DDDDDD DDDNDDDDDDDEDnNNDDDDDDDDDNDD DDDDDDDDG DD DDDDD  NDND  pp
   179  101 B F  T 3  S+     0   0   21  558   68  NSNNN NYNNYY NNNNNNNYNHNNNnHNNNNNNFYYNNNN YSYYYNNNY NY NNNNS  HYNN  nn
   180  102 B D    <   +     0   0    1  577    0  DDDDD DDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDD DD DDDDD  DDDD  DD
   181  103 B I        +     0   0    0  579   14  VIIII IVVIVI IIIIIIIFIIIIIIIIIIIIIIIIIIII IVIIIIIII II IIIII  VIII  VV
   182  104 B A  E     -QS 131 168G   0  579   60  AMMMA MAAAAA MMMMMMMSLAMALMAMAMLMMMMMMMLM GGGGGMMMA MA MMLMM  AMAM  AA
   183  105 B V  E     -QS 130 167G   0  580   15  VLLLV LILLLV LLLLLLLILLLLLLLLLLLLLLLLLLLL LLLLLLLLL LL LLLLL  LLLL  VL
   184  106 B L  E     -QS 129 166G   0  581   30  LIIII ILIIII IIIIIIILIVIVIILILIIIIIMMLIII IIIIIIIIM IM IIIII  LMML  LL
   185  107 B R  E     -QS 128 165G  40  581   42  KKKKR KTKKKK KKKKKKKEKLKKKKKKLKKKKKKKKKKK RWRRRKKKK KE KKKKK  KKKK  KK
   186  108 B L  E     - S   0 163G   0  581   17  VLLLL LFLLLL LLLLLLLLLLLLLLLLLLLLLLLLLLLL TLTTTLLLL LL LLLLL  LLLL  LL
   187  109 B K  S    S+     0   0  101  581   69  ESSSK SSKKIS SSSSSSSVSDAQSERSKSSSSFAADSSN SQSSSSAAA AM SSSSS  RKQK  KK
   188  110 B T  S    S-     0   0   82  582   74  KKKEL KQTSTE SKKQKKKDSTTFSTKSSSSEEHHHRTSS SKSSSESSE TE TTSKR  KYTS  AS
   189  111 B P        -     0   0   48  582   39  RPPPS PDPPPk PPPPPPPLPPPPPPPPPPPPPPPPPPAP GPGGGPPPP PP PPPPP  SPPP  SS
   190  112 B I        -     0   0    4  532   62  FAAAL AIMMLd AAAAAAAIA.ALAAVAFAAAAVVVAAAA .L...AAAM AL AAAAA  VVMA  II
   191  113 B T        -     0   0   95  537   72  RTSTP TATKSK TTTTTTTKS.TTSEEVKVTVVETTDVST .E...TTTN TE TSVTT  KTTT  KD
   192  114 B F        +     0   0   56  580   32  LLLLF LILLLA LLLLLLLFIFLFILFLLIILLVVVILIL IFIIILLLF LF LLILL  FLFI  LL
   193  115 B R  B >   -U  196   0I  52  581   64  nNNNG NddnGg NNNNNNNDNhdSNSTNDSSNNTNNNNNN aGaaaNNNT NS NNNNN  SNNS  DS
   194  116 B M  T 3  S+     0   0   29  564   77  kGSQT NvtkRg SQQKQQQNSkhGSSKKASSQQSQQGASS sPsssQTTD KK QSSQS  KEDS  NK
   195  117 B N  T 3  S+     0   0   13  572   89  SYYYT YNNNNN RYYYYYYTKDTTKRTRTRRRNAHHIHRR GSGGGYRRL AT YYRYF  RYKR  TT
   196  118 B V  B <   +U  193   0I   0  574   26  VVVVI VTAAAI VVVVVVVRVTVVVVIVKVVVVVVVVVVV VIVVVVVVQ VV VVVVV  VVVV  RT
   197  119 B A        -     0   0    1  576   81  RQRQK RKKKKW AQKQQKKRSGDRSARAVSAVVAQQQSAS AAAAAQAAQ QQ QSSQR  KKKS  QQ
   198  120 B P        -     0   0    8  576   54  TPIPS TIPAIP TAPPAPPSAPTPATPTPTTPPPPPPTTT SPSSSPAAP TP PTAPP  PPPT  PP
   199  121 B A        -     0   0    2  577   39  VVVVI VVVVII VVVVVVVVIIVIIVVVIVIVVIVVAIVV IIIIIVIII II VVIVA  IIVI  VI
   200  122 B g  B     -g  290   0F   1  578   67  KASAA STPGIC SAAAAAARSCTCSSCSCSSAAPAASSSS AIAAAASSC PC SSSAV  CACS  PP
   201  123 B L        -     0   0   27  580    5  LLLLL LLLLLL LLLLLLLLLMLLLLLLLLLLLLLLLLLL LMLLLLLLL LL LLLLL  LLLL  LL
   202  124 B P        -     0   0    7  581   31  VPPPA PPPPAP PPPPPPPLPPPPPPPPSPPPPPPPPPPP QSQQQPPPP PP PPPPP  PPPP  FF
   203  124AB E     >  -     0   0   92  580   75  DTSTK SSAATP RSRSSRRSALTFASKSETSTTTEEDTRR SDSSSTSSS TA SSTSS  QKNR  DD
   204  125 B R  H  > S+     0   0  109  580   79  ERSSK SEQKPP SSSSSSSASLTSSDEAISSSSRAAPASS AEAAASAAK RS GSASK  KAPS  LL
   205  126 B D  H  > S+     0   0  124  580   85  DCCCD CNGGPG CCCCCCCRFRCDFCRCTCCCCCCCDPVC NDNNNCCCE CT CCPCC  GCGC  NK
   206  127 B W  H  >>S+     0   0    4  580   87  HAAAP ANSSIV AAAAAAAEPDAEPASADAAAAPPPSPAA IEIIIAAAD VH AAPAA  SPMP  EE
   207  128 B A  I  X>S+     0   0    0  580   75  EPSPA GGDDNQ APPPPPPEAPLKAPEAIPPPPTAAPAAS AEAAAPPPT AI PAAAA  DTMT  VE
   208  129 B E  I  <5S+     0   0   75  581   83  VASAD SAVVIL AAAAAAAIALPLAAPADAAAAGPPPAVS AIAAAAAAN TF AAAAD  PPLV  AV
   209  130 B S  I  <5S+     0   0   70  582   65  DGGGG GVKKKE GGGGGGGPGTGAGGAGRGGGGGGGLGGG GdGGGGGGI GP GGGGG  AGEG  pt
   210  131 B T  I  <5S+     0   0   18  104   77  ..... ...... ..............G.........A... .g....... .. .....  ....  gg
   211  131AB L  I ><  S-     0   0  119  478   80  SMsMy sse.SS SQQMQQQ.SGsQSsSsVsSMMdT.lssS srsssMSs. sR MAsMs  AFYS  er
   227  146 B E  T 3  S+     0   0   47  513   76  ENSSG SEG.TH SSSSSSS.SEFDSSESPSSSSGD.YSSS EEEEESNSE SE SSSSS  EPES  EE
   228  147 B K  T 3  S+     0   0  169  537   69  SPGSS GGSSNG GSSSSSSIGEGGGGGGMGGSSAQ.SGGG GNGGGSGGK GQ PGGSP  GGKG  AG
   229  149 B G  S <  S-     0   0   29  548   67  GASTP SGYYGG SSTASTSVSHEGSSGSRIVSSAV.YATT GGGGGTVVG SG ASATA  GQGV  GG
   230  150 B R        -     0   0  213  557   86  PVYAD YDSSEF SAAVAAAENPKKNNTNSNNAANFFEDNN SGSSSANNR NL DNDAR  MEKK  AN
   231  151 B Q  B     -V  224   0J  79  563   93  NSYDI YSLLSP YDDDDDDTYVLMYYLYVYYDDANNLYYY ATAAADYYV YL DYYDY  LFTY  SA
   232  152 B S        -     0   0   14  569   51  PGPRS PSPPSS PKGSKGGSPSPSPPPPSPPSSPPPSPPP SPSSSSPPQ PA GPPRP  ASSP  PP
   233  153 B T  S    S+     0   0   48  570   73  VDDNA DKSSKE SNNNNNNFNRADNDAEPEDNNTFFPDDS TKTTTNDDD DK DDDND  GYED  DA
   234  154 B R  B    S-T  150   0H 102  570   86  KKRKT RTEEVV LKKRKKKHLTQTLLLLQLLKKRYYVELL TTTTTRLLI QT KREKK  QEVL  VV
   235  155 B L        -     0   0    3  578    3  LLLLL LLLLLL LLLLLLLVLLLLLLVLLLLLLLLLLLLL LLLLLLLLL LL LLLLL  VLLL  LL
   236  156 B K  E     -FH  98 221F  31  578   51  QQRQQ RLQRQL QQQQQQQRQQQLQQQQNQQQQQQQKQQQ RQRRRQQQQ QQ QMQQQ  HHNQ  HR
   237  157 B M  E     -FH  97 220F  18  579   94  GCCCY CARRTD CCCCCCCACKCQCCHCKCCCCCCCSCCC QMRQQCCCK CK CCCCC  ECAC  TT
   238  158 B L  E     - H   0 219F   4  580   42  VLLLV LVVVLA LLLLLLLVLVLALLVLVLLLLLLLVLLL VVVVVLLLA LA LLLLL  VVAL  VV
   239  159 B E  E     - H   0 218F 107  580   72  KEDND DNDDTN KNNNNNNSNEDSNDDDNDYNNDEENDND ALAAADNNP NS NDDNE  QEMD  DD
   240  160 B V  E     - H   0 217F   0  580   46  VIAIV AVIIIL AIIIIIIVAMAVAAVAIAAIIVVVVAAA VVVVVIAAV AV IAAIA  VVVA  VV
   241  161 B P  E     - H   0 216F  34  580   26  PPPPY PPDAPP PPPPPPPPPKPQPPPPNPPPPPPPDPPP PPPPPPPPP PK PPPPP  PPRP  PP
   242  162 B Y  E     -J  263   0F  36  581   45  FIIII ITVVII VIIIIIIVIVVVIIILLLLIIIIIIVIV IKIIIILLF VM IIVIL  IILV  II
   243  163 B V  E     -J  262   0F  24  582   35  VLLLV LLVVIW LLLLLLLVLIIILLLLVLLLLVLLFLLL VVVVVLLLM LI LLLLL  LLIL  VV
   244  164 B D     >  -     0   0   88  581   58  DSSSS SSSSDR SSSSSSSNSPSDSDTSKASSSDSSNTSS ASAATSSSS SN SSSSS  SSES  TT
   245  165 B R  H  > S+     0   0   51  581   79  HDDKR DVRRQR DDDRDDDKDWESDDLQWQQTTENNNQDD DADDDDDDK AD DDQDD  LDPD  KK
   246  166 B N  H  > S+     0   0  105  582   75  DNSEK SAEKEN SRRERRRSSDRASADAEEAKKQKKCASS ATAAAEAAE AT STARN  IIWP  TA
   247  167 B S  H  > S+     0   0   48  582   78  TDSDT SEQEVE SDDDDDDESRKRSQQQIQDDDDDDQKVS AAAAADEEE EV DNEDT  QDSA  EE
   248  168 B j  H  X S+     0   0    1  582    2  CCCCC CCCCCC CCCCCCCCCCCCCCCCCCCCCCCCYCCC CCCCCCCCC CC CCCCC  CCCC  CC
   249  169 B K  H >< S+     0   0   88  582   73  sSRDa RKdnqe KDDDDDDIRARnRHrESEENNEEEYKHK nsnnnEKKq SQ SREEF  rEnH  ns
   250  170 B L  H 3< S+     0   0  150  547   89  vNSNy S.ssfi SNNNNNN.S.DdSNkA.AANNDGG.ASS yyyyyRAAr DK NNANN  kNqK  yy
   251  171 B S  H 3< S+     0   0   23  578   76  FSSAA SKKKAR SSSSSSSRSASASAYSSASSSASS.SAS AAAAASSSY AY SSSSA  YSVA  EE
   252  172 B S    <<  -     0   0   20  581   83  TYYYY YSAARS YYYYYYYSYRYYYYRYLYYYYYYYYYYY SPSSSYYYW YL YYYYY  RYYY  SS
   253  173 B S  S    S+     0   0   79  581   83  GPPPG PVGNYD PPPPPPPYPFPQPPAPLPPPPPPPYPPP YSYYYPPPK PS PPPPP  APNP  WW
   254  174 B F  S    S-     0   0  124  581   79  KGGGD GSAARP GGGDGGGPNPGGNGSGTGGGGGGGFLGG GYGGGGGGH GN GGGGF  NGNG  GG
   255  175 B I        -     0   0  100  582   88  QMQMD QNDEII QQMMQMQIQQKEQQRQLQEMMMRRRKKK GNGGGIEER ES MEKMQ  RRLM  GG
   256  176 B I        -     0   0   13  582   16  IIIII IFVVVD IIIIIIILIVIVIIIIFIIIIIIIVIII IIIIIIIII IL IIIII  IIII  II
   257  177 B T    >   -     0   0   16  582   36  TTTTK TSSTTY TTTTTTTTTTTTTTTTTTTTTSTTTTTT TTTTTDTTG TT TTTTT  TTTT  PP
   258  178 B Q  T 3  S+     0   0  133  582   68  DSSNP SDEDAR GDDDDDDDSHDESNSDKDSDDRDDDSSS APAAAYSSD NT NSNDE  DEPS  EE
   259  179 B N  T 3  S+     0   0   24  582   61  NTNAS NRNNNY NAAAAAARNNNENNNSNNNAARRRNNNN RRRRRTNNK NR SNNAN  NSAN  GG
   260  180 B M  E <   - K   0 311F   2  582   11  MMMMM MMMMMQ MMMMMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMV MM MMMMM  MMMM  QQ
   261  181 B F  E     - K   0 310F   8  581   34  LFFFI FLIILF IFFFFFFLFLFLFMLVLVIFFVVVIFIF ILIIIFIII ML FFFFI  IMIF  II
   262  182 B j  E     +JK 243 309F   1  582    0  CCCCC CCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCC CC CCCCC  CCCC  CC
   263  183 B A  E     +JK 242 308F   0  582   27  AAAAA AAGGAA VAAAAAAAAAVAALAAAAAAAAAAAVLL AAAAAAAAA VS AAVAA  AAAL  AA
   264  184 B G  S    S-     0   0    3  582   10  GGGGH GGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGG GG GGGGG  GGGG  AA
   265  185 B Y        -     0   0   56  561   58  VYFYA FVDDDP FYYDYYYYFFFIFFKFNFFYYYYYSFFF FTFFFYFFY FY YFFYY  RYYF  FY
   266  185AB D  S    S-     0   0   81  565   84  KLLLS LSVVTK LLLLLLLRLELMLLGLSLLLLMLLLLLL TPTTTLLLD ML LLLLL  GLLL  PP
   267  185BB T  S    S+     0   0   76  582   62  KEEEG EQaaTD EEEEEEENEEDEEEKEQEEEEDEESEEE AESSAEEEE ES EEEEE  SDQE  AT
   268  186 B K  S    S-     0   0  107  532   32  GGGG. GGggGG GGGGGGGGGGGGGG.GEGGGGGGGGGGG GGGGGGGGG GG GGGGG  .GGG  GG
   269  187 B Q  S    S+     0   0  102  537   37  GGGG. GGGGGE GGGGGGGGGGGGGG.GGGGGGGGGGGGG GGGGGGGGG GG GGGGG  .GSG  GG
   270  188 B E        +     0   0   33  581   54  KKKKK KKVKKE KKKKKKKKKRKVKKQKKKKKKRKKRKKK RKRRRKKKR KI KKKKK  QKVK  RK
   271  189 B D  B     -E   94   0E   7  582    3  DDDDD DDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDD DD DDDDD  DDDD  DD
   272  190 B A        -     0   0    7  582   42  SSSSA SASSTA SSSSSSSASSSTSSSSASSSSASSSSSS AAAAASSSA SA SSSSS  SASS  TT
   273  191 B k    >   -     0   0    7  582    0  CCCCC CCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCC CC CCCCC  CCCC  CC
   274  192 B Q  T 3  S+     0   0   90  582   25  QQQQQ QQQQHD QQQQQQQQQQQQQQQQQQQQQNQQQQQQ QQQQQQQQK QQ QQQQQ  QQQQ  QQ
   275  193 B G  T 3  S+     0   0    6  582    7  GGGGG GGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGG GG GGGGG  GGGC  GG
   276  194 B D    X   +     0   0    0  582    0  DDDDD DDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDD DD DDDDD  DDDD  DD
   277  195 B S  T 3  S+     0   0   14  582    1  SSSSS SSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSS SS SSSSS  SSSS  SS
   278  196 B G  T 3  S+     0   0    0  582    0  GGGGG GGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGG GG GGGGG  GGGG  GG
   279  197 B G    <   -     0   0    0  582    2  GGGGG GGGGGG GGGGGGGGGGGGGGGGGGGGSSGGGGGG GGGGGGGGG GG GGGGG  GGGG  GG
   280  198 B P  E     - L   0 294F   1  582    3  PPPPP PPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPPPPPPP PP PPPPP  PPPP  PP
   281  199 B H  E     -IL 219 293F   0  582   49  LVVVL VAVVLL VVVVVVVIVLLLVVLVLVVVLLLLLVVV LLLLLVVVL VL VVVVM  LLLV  LL
   282  200 B V  E     -IL 218 291F   3  582   27  VVVVV VVVVVM VVVVVVVVAVVMAVLVVVVVVVVVMVVV VVVVVVVVS VS VVVVM  LVVA  VV
   283  201 B T  E     - L   0 290F   0  582   67  DCCCS CSDDYY CCCCCCCRCCCYCCVCCCCCCCCCCCCC AYAAACCCC CC CCSCC  VCTC  LV
   284  202 B R  E     + L   0 289F  99  582   70  ANNNG NNVVNK NNNDNNNVSSNQSNRNQNNNAANNNNNN GNGGGNNNR NF NNNND  QNLN  AA
   285  203 B F  E >  S- L   0 288F  22  582   70  NGGGG GNAKNm GGGGGGGSGsGSGGNGkGGGGGGGGGGG GEGGGGGGH Ge GNGNG  EGKG  GG
   286  204 B K  T 3  S-     0   0   85  206   71  ..... .....s .........g....G.q........... ........E .s .....  G.S.  ..
   287  205 B D  T 3  S+     0   0  108  208   57  ..... .....G .........E.G..D.S........... ........E .G .....  D.S.  ..
   288  206 B T  E <   - L   0 285F   3  218   75  ..... ..TN.R .......D.K.Q..K.I........... ........V .K .....  R.I.  ..
   289  207 B Y  E     - L   0 284F  21  227   50  K.... ..KN.W .......G.W.W..H.W........... ........W .W .....  L.W.  ..
   290  208 B F  E     -gL 200 283F   0  582   91  KEQEL QVQQVA QEEEEEEVVSQQVEEEYEEEEEEEKQAQ RKRRREEEY EF QQEEE  EEWE  RR
   291  209 B V  E     + L   0 282F   1  582   41  LLLLL LQIVQV LLLLLLLLLQLVLLILQLLLVVLLFLLL LLLLLLLLL LQ LLLLL  ILLL  QQ
   292  210 B T  E     +     0   0F   1  582   84  VQQQV QLVVIV QQQQQQQVQLQVQQVQLQQQQQHHMQQQ VAVVVQQQV QA QQQQQ  VQIQ  AA
   293  211 B G  E     -ML 312 281F   0  582    0  GGGGG GGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGG GG GGGGG  GGGG  GG
   294  212 B I  E     -ML 311 280F   0  582   19  VVVVI VVIIII IVVVVVVVIIIIIIIIIVIVLLVVIIIV VVVVVVIII II IIIVV  IIDI  II
   295  213 B V  E     +M  310   0F   7  582   14  VVVVV VVVVVV VVVVVVVVVVIVVVVVVVVVVVVVVVVV VVVVVVVVT VV VVVVV  VITV  VV
   296  214 B S  E     -     0   0F   1  581    0  SSSSS SSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSS SS SSSSS  SSSS  SS
   297  215 B W  E     -M  309   0F  45  582    8  WWWWW WFWWWW WWWWWWWGWWWWWWWWWWWWWWWWWWWW WWWWWWWWW WW WWWWW  WWWW  WW
   298  216 B G        -     0   0   26  582    0  GGGGG GGGGGg GGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGG GG GGGGG  GGGG  GG
   299  217 B E  S    S-     0   0   25  577   90  NYYYY YSYYAg YYYFYYYKYEYHYYVYEYYYQQQQIYYY VLVVVYYYE LE YYYYH  VVSA  NN
   300  218 B G  S    S-     0   0   19  580   15  GGGGG GGGGQK GGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGG GG GGGGG  GGGG  GG
   301  220 B k  S    S-     0   0    7  582    2  CCCCC CCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCC CC CCCCC  CCCC  CC
   302  221 B A  S    S+     0   0    4  581   17  AAAAA AAAAAA AAAAAAAAAAAGAAGAGAAAAAAAAAAA AAAAAAAAA AA AAAAA  GAAA  AA
   303  222 B R    >   -     0   0  105  578   74  REQEI QRRRSV QQEEQEQRQRLGQMREQQQEQQQQNQLQ RRRRREQQR QR EQQEQ  REKL  RR
   304  223 B K  T 3  S+     0   0  152  578   65  PQRKP RPKKPA KRRKRRRPRPKPRKAKKKKRPPPPPKEK PPPPPKKKP EQ RKKRR  PPAK  KQ
   305  223AB G  T 3  S+     0   0   26  582   58  NNNDG NGGGGG NDDNDDDGNGGGNGGDKNNDNNNNYRGG NKNNNDDDR GN NNNDN  GNYG  GG
   306  224 B K    <   -     0   0   43  582   85  KRKHY KNYYYQ KNNQNNNYKKKTKKYSKKKHYYYYYRKK FYFFFHRRQ YK HRRHK  YLRK  YY
   307  225 B Y        -     0   0   33  582   49  PPPPP PPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPPPPPPP PP PPPPP  PPPP  PP
   308  226 B G  E     -K  263   0F   4  580    2  GGGGG GGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGG GG GGGGG  GGGG  GG
   309  227 B I  E     -KM 262 297F   6  581   10  VVVVV VVVVVV VVVVVVVVVIVVVVVVVVVVVVVVVVVV VVVVVVVVV VV VVVVV  VVVV  VV
   310  228 B Y  E     -KM 261 295F   1  581    2  YYYYY YYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYY YY YYYYY  YYYY  YY
   311  229 B T  E     -KM 260 294F   2  581   40  ANTAV AATTTT TAAAAAAATTTTTTTTTTTAVVTTTTTT AAAAASTTT TT ATTAT  TTAT  TT
   312  230 B K  E >   - M   0 293F  21  581   40  KKKRN KNRRRR KKKKKKKKKFKKKKRKKRKRKKKKKKKK KKKKKKKKK KR KKKKK  RKNK  EE
   313  231 B V  G >  S+     0   0    1  581    8  VVVVV VVVVIV VVVTVVVIVVVVVVVVVVVVVVVVVVVV VVVVVVVVV VV VVVVV  VVVV  II
   314  232 B T  G 3  S+     0   0    2  579   72   CCCA CTGGSS CCCCCCCSYFCTYCACSCCCCCCCRYYC SSSSSCCCA CT CCYCC  SCTC  AA
   315  233 B A  G <  S+     0   0   29  579   80   MNID NANNTA NLLILLLSNNNANNRNNNNLEESSNNNN NANNNVNND NS INNLN  RSLK  SA
   316  234 B F  S <> S+     0   0    7  575   36   FYFF YLFFIF YFFFFFFVYYYFYYYFYFYFFFLLYYYY LLLLLQYYY YL FYYFY  YLFY  FV
   317  235 B L  H  > S+     0   0   23  573   81   SNNN NRVIRS VNNTNNNRVLLLVILVLVVTLLTTLVLV RRRGRTVVA VR SNVNI  LVTL  RR
   318  236 B K  H  > S+     0   0  116  572   68   DSDS SGDDSD NDDDDDDENNDNN PDLDDSPPPPGDSN SESSSDDDD SD DTDDS  NSDD  DE
   319  237 B W  H  > S+     0   0   26  572    1   WWWW WWWWWW WWWWWWWWWWWWW WWWWWWWWWWWWWW WWWWWWWWW WW WWWWW  WWWW  WW
   320  238 B I  H  X S+     0   0    1  569   12   LILI IIIIII ILLLLLLIIIIII LIIIILIIIIIIII IIIIILIII II LIILI  IIII  II
   321  239 B D  H  < S+     0   0   66  541   72   RRED RREETY QEEQEEE RKQ R RKDQQEQQNNNKQQ QDQQQLQQ  QK DRKEK  NNYQ  KN
   322  240 B R  H >< S+     0   0  136  528   71   TNRA NKSSKH QTTSTTT Q Q Q AQTEQSDDDD DQQ SESSSEEE  S  SNDSD  TDRE  EE
   323  241 B S  H >< S+     0   0    6  495   71   TTTA TT   K TTTTTTT T T T NT TTTTTII TTT N NNNTTT  T  TTTTT  NTQT    
   324  242 B M  T 3< S+     0   0   25  452   39   MMM  M    I IMMMMMM I I I LI MIMLLLL IIV      MII  I  MMIMM  MIMI    
   325  243 B K  T <  S+     0   0  153  418   69   ASA  A    S AAAAAAA   E A DA AAAEESS AAA      AAA  A  ASAAA  KSRA    
   326  244 B T    <         0   0   51  369   66   SST  S    S ANSSSSN   A A DK AASAATT AAA      SAA  S  SSASS    AA    
   327  245 B R              0   0  197  260   47   NN   N      N         N N  H NNNNN   NNN       NN  H  NNN      NN    
## ALIGNMENTS  491 -  560
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....0....:....1....:....2....:....3....:....4....:....5....:....6
     1   49 A Q              0   0  101  253   29                   QQ                              H    R          E    
     2   50 A a    >   +     0   0   22  341    0                   CC                              C    C          C    
     3   51 A E  T 3  S+     0   0  187  342   77                   AL                              Q    R          K    
     4   52 A T  T 3  S-     0   0  105  342   54                   ES                              S    Y          S    
     5   53 A S    <   +     0   0   89  342   62                   KN                              E    S          g    
     6   54 A P        +     0   0   10  343   18                   PQ                              P    P          g    
     7   55 A b        -     0   0   18  344    0                   CC                              C    C          C    
     8   56 A Q  S    S+     0   0   92  343   70                   KV                              Q    Q          Q    
     9   57 A N  S    S-     0   0   63  303   24                   N.                              N    N          .    
    10   58 A Q  S    S-     0   0  152  336   48                   GN                              G    G          .    
    11   59 A G        -     0   0   16  344   17                   AG                              A    G          H    
    12   60 A K  E     -A   23   0A 117  344   75                   MT                              T    M          G    
    13   61 A a  E     -A   22   0A  45  344    0                   CC                              C    C          C    
    14   62 A K  E     -A   21   0A 155  344   82                   SV                              V    K          N    
    15   63 A X  E     +A   20   0A 120  302   29                   DD                              D    D          .    
    16   64 A G        -     0   0   44  341   74                   SL                              Q    L          N    
    17   65 A L  S    S-     0   0  152  342   69                   VY                              I    F          L    
    18   66 A G  S    S+     0   0   67  343   62                   GQ                              N    N          p    
    19   67 A E        -     0   0  119  329   61                   GS                              T    D          t    
    20   68 A Y  E     -A   15   0A  37  342    9                   YY                              Y    F          Y    
    21   69 A T  E     -A   14   0A  71  343   83                   DA                              I    N          E    
    22   70 A b  E     -A   13   0A  20  343    0                   CC                              C    C          C    
    23   71 A T  E     -A   12   0A  85  344   80                   VR                              I    T          T    
    24   72 A c        -     0   0   44  344    1                   CC                              C    C          C    
    25   73 A L    >   -     0   0   62  344   86                   KN                              P    P          P    
    26   74 A E  T 3  S+     0   0  177  344   74                   SH                              V    T          D    
    27   75 A G  T 3  S+     0   0   29  344   24                   GG                              N    G          g    
    28   76 A F  E <   +B   36   0B  40  343   16                   FY                              L    F          l    
    29   77 A E  E     +B   35   0B  74  343   63                   TE                              E    T          I    
    30   78 A G  S >  S-     0   0   32  343    1                   GG                              G    G          G    
    31   79 A K  T 3  S+     0   0  156  343   72                   VR                              R    K          E    
    32   80 A N  T 3  S-     0   0   33  343   62                   HY                              H    K          D    
    33   81 A c  S <  S+     0   0    1  344    0                   CC                              C    C          C    
    34   82 A E        +     0   0   87  342   30                   ed                              d    E          L    
    35   83 A L  E    S-B   29   0B  96  289   42                   la                              s    H          D    
    36   84 A F  E     -B   28   0B 139  292   93                   CQ                              F    N          V    
    37   85 A T        -     0   0   44   76   76                   .T                              .    .          .    
    38   86 A R        +     0   0   57  101   88                   .A                              .    .          .    
    39   87 A K        +     0   0   96  140   78                   .T                              .    .          D    
    40   88 A L        -     0   0   91  168   91                   .S                              G    .          E    
    41   89 A d  S  > S+     0   0   15  238   19                   VC                              C    .          C    
    42   90 A S  T  4 S+     0   0   98  244   86                   VA                              L    .          S    
    43   91 A L  T >4 S-     0   0  120  274   90                   DE                              Y    .          L    
    44   92 A D  G >4 S-     0   0  107  297   62                   SD                              R    .          D    
    45   93 A N  G >< S-     0   0    8  315   63                   DN                              N    I          L    
    46   94 A G  G <  S-     0   0    0  316   53                   KG                              G    G          D    
    47   95 A D  G <  S+     0   0   44  344   60                   GH                              G    D          D    
    48   96 A e    <   -     0   0    0  344    1                   CC                              C    C          C    
    49   97 A D  S    S-     0   0   59  344   73                   SD                              E    F          S    
    50   98 A Q  S    S+     0   0    2  344   62                   QH                              H    d          Q    
    51   99 A F  E     -C   62   0C   4  344   77                   FE                              F    t          S    
    52  100 A d  E     +C   61   0C  10  344    0                   CC                              C    C          C    
    53  101 A H  E     -C   60   0C  68  344   86                   KS                              V    V          T    
    54  102 A E  E     -C   59   0C  92  344   56                   PD                              E    D          N    
    55  103 A E  S    S-     0   0  100  344   81                   gs                              t    G          t    
    56  104 A Q  S    S-     0   0  175  310   77                   .d                              e    V          .    
    57  105 A N  S    S+     0   0  154  307   78                   tg                              .    N          g    
    58  106 A S  S    S-     0   0   58  337   71                   Sa                              t    R          S    
    59  107 A V  E     -C   54   0C   7  343   86                   HR                              H    Y          Y    
    60  108 A V  E     -C   53   0C  45  344   87                   ES                              S    T          T    
    61  109 A e  E     +C   52   0C   5  344    0                   CC                              C    C          C    
    62  110 A S  E     -C   51   0C  24  344   70                   SS                              D    S          G    
    63  111 A f        -     0   0   23  344    0                   CC                              C    C          C    
    64  112 A A    >   -     0   0    8  344   70                   AI                              A    P          P    
    65  113 A R  T 3  S+     0   0  149  344   83                   QH                              P    A          T    
    66  114 A G  T 3  S+     0   0   24  344   13                   GG                              G    G          G    
    67  115 A Y  E <   -D   78   0D  20  344    7                   WY                              Y    F          Y    
    68  116 A T  E     -D   77   0D  72  343   81                   KN                              T    S          E    
    69  117 A L  E     -D   76   0D  67  340   68                   IL                              L    G          L    
    70  118 A A    >   -     0   0   23  340   78                   SQ                              H    R          N    
    71  119 A D  T 3  S+     0   0  175  340   77                   GD                              S    A          P    
    72  120 A N  T 3  S-     0   0   92  340   74                   SD                              D    C          D    
    73  121 A G  S <  S+     0   0   16  340   56                   DS                              N    E          G    
    74  122 A K  S    S+     0   0   71  332   83                   KR                              S               R    
    75  123 A A        -     0   0   22  330   70                   tT                              S               T    
    76  124 A f  E     -D   69   0D  12  300   48                   cC                              C               C    
    77  125 A I  E     -D   68   0D  78  304   82                   VQ                              V                    
    78  126 A P  E     -D   67   0D  62  304   56                   PP                              P                    
    79  127 A T  S    S+     0   0  103  304   79                   TK                              T                    
    80  128 A G  S    S-     0   0   32  305   75                   GG                              A                    
    81  129 A P  S    S+     0   0  116  311   78                   RP                              D                    
    82  130 A Y  S    S+     0   0   59  312   77                   FA                              F                    
    83  131 A P    >   -     0   0   17  312   34                   SS                              S                    
    84  132 A g  T 3  S+     0   0   16  323    2                   CC                              C                    
    85  133 A G  T 3  S+     0   0    0  295   30                   GG                              G                    
    86  134 A K    <   -     0   0   69  294   62                   RQ                              R                    
    87  135 A Q        -     0   0   37  243   74                   VL                                                   
    88  136 A T        +     0   0    4  220   79                   SL                                                   
    89  137 A L        +     0   0  105  200   57                    I                                                   
    90  138 A E              0   0  104  120   71                    G                                                   
    91  139 A R              0   0  231   97   28                    R                                                   
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3  IIIIIIIIIIIIIIIII  IIIIIIIII  III IIIIIIIIIIIIII  IIII IIIIIIIIII IIII
    94   17 B V  B     -E  271   0E   7  561    9  IVVVIVVVVVVVVVVVV  VVVVVVIVV  VVVVVVVVVVVVVVVVVV  VVVV VVVVVVVVVV VVVV
    95   18 B G  S    S+     0   0   25  562    6  GGGGGGGGGGGGGGGGG  GGGGGGGGG  GGGGGGGGGGGGGGGGGG  GGGG GGGGGGGGGG GGGG
    96   19 B G  S    S-     0   0   26  563    0  GGGGGGGGGGGGGGGGG  GGGGGGGGG  GGGGGGGGGGGGGGGGGG  GGGG GGGGGGGGGG GGGG
    97   20 B Q  E     -F  237   0F  98  564   95  VYYYYFYYYRKSYYYYY  YNYYYYQYY  YKYYYYYYETYYYYYTYY  FYHY TYYHYQEMYE KFYY
    98   21 B E  E     -F  236   0F  80  565   65  PTTTEEEEEPETITTEE  TTTEEIEET  EETTEEEEDATITTTDTT  ETPP ATTNEDVDEP DETT
    99   22 B h        -     0   0    8  565   58  ACCCCICCCTCTCCCCC  CCCCCCCCC  CCCCCCCCVACCCCCACC  VCVV ACCATAISCA TCCC
   100   23 B K    >   -     0   0  123  564   79  NQQERDAAQGTTEQQTQ  GEETTEEAQ  RSQQSATTDSEEQQQVAE  DALP KAEDSDSTES TTQE
   101   24 B D  T 3  S+     0   0   60  565   85  IKREKIAAAVPIEEEAA  KEEPPEPPE  KPRRPQPPIAEEKEELAE  VEII QEELIIAKAP IKKE
   102   25 B G  T 3  S+     0   0    0  565   73  RNNNNLHHHNYQNNNHH  NNNHHNHHN  NYNNHHYYSGNNNHHGNN  RNSS NNNGERYGHG QNNN
   103   26 B E  S <  S+     0   0   36  565   67  DSSSSESSSQSNSSSSS  SSSSSSSSS  SSAASSSSTESSSSSESS  HSEE SSSEDSYASS EGAS
   104   27 B h    >   +     0   0    4  565   91  FLVVVVQQQYMFVVVQQ  LVVQQVRKV  VQLLRQQQCFVVLVVFIL  VVVV WVLWHYLYQW HIIV
   105   28 B P  T 3   +     0   0    0  567    9  PPPPPPPPPPPPPPPPP  PPPPPPPPP  APPPPPPPGPPPPPPPPPP PPPP PPPPPPPPPP PQPP
   106   29 B W  T 3  S+     0   0    5  568   27  WYYYYYWWHWHYYYYHH  YYYWWYYWY  YHYYYWHHWFYYYYYYYYY YYWW WYYWYHYWWW YYYY
   107   30 B Q  E <   -N  122   0G   7  569   24  qQQQMQQQQLQQQQQQQ  QQQQQQMQQ  QQQQMQQQQIQQQQQqQQq QQQq QQQIQQqqQQ qQQQ
   108   31 B A  E     -NO 121 146G   1  559   47  hVVVVIVVVAVVVVVVV  VVVVVVAVV  VVVVAVVVIAVVVVVtVVy VVAl AVVAVIntAV sVVV
   109   32 B L  E     -NO 120 145G   3  567   65  ISSSSSSSSRSSSSSSS  SSSYYSSHS  SSSSSSSSSSSSSSSFSSL SSAY QSSASSSDSS ISSS
   110   33 B L  E     -NO 119 144G   0  570   11  LLLLLLLLLLLLLLLLL  LLLFFLLLL  LLLLLLLLFLLLLLLLLLL LLLL LLLLLMALLL LLLL
   111   34 B I  E     -NO 117 143G   0  570   81  ENNNNQNNNVNQNNNNN  NNNTTNNNN  NNNNNNNNQQNNNNNGNNL QNMG RNNFQRRRNQ YNNN
   112   35 B N  E >   - O   0 142G  30  570   88  NASSVSIISYSYSSSSS  SSSQQSYYS  SSSSYLSSSVASAAAFSSQ TAYK TASNRYSKIL NSSV
   113   36 B E  T 3  S+     0   0   63  113   77  .................  .........  ..................K .... T......... ....
   114   37 B E  T 3  S-     0   0  136  242   76  ...........G.....  ...NE..K.  ........ES........D .... S..SNR...R D...
   115   38 B N  S <  S+     0   0   84  543   52  GGGGGYGGGDGGGGGGG  GGGSNGGGG  GGGGGGGGNGGGGGGSGGN SGS. GGGGGGA.GG EGGG
   116   39 B E        -     0   0  100  561   93  SYYYYGYYYGYSYYYYY  YYYQQYYSYQQYYYYYYYYLRYYYSSFSSE GYE. FYSRANY.YG YYYY
   117   40 B G  E     +N  111   0G  14  572   55  HHHHHHHHHQHRHHHHH  HHHVVHHFHEEHHHHHHHHHHHHHHHHHHY HHK. HHHQHHAGHH HHHH
   118   41 B F  E     +     0   0G  28  581   35  LFFFFFFFFfFIFFFFF  FFFFFFFFFllFFFFFFFFFIFFFIIFFFf FFyf YFFFFRhFFT SFFF
   119   42 B i  E     -N  110   0G   0  578    1  CCCCCCCCCcCCCCCCC  CCCCCCCCCccCCCCCCCCCCCCCCCCCCc CCcc CCCCCCcCCC CCCC
   120   43 B G  E     -N  109   0G   1  581    2  GGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GRGG GGGGGGGGGG GGGG
   121   44 B G  E     -N  108   0G   0  581    9  GGGGGGGGGAGGGGGGG  GGGGGGGGGAAGGGGGGGGGGGGGGGAGGG GGAA SGGGGGGGAG GGGG
   122   45 B T  E     -NP 107 130G   0  581   43  SSSSSSSSSSSSSSSSS  SSSSSSVSSSSSSSSVSSSSTSSSSSSSSS SSVV SSSSSSASSS SSSS
   123   46 B I  E     + P   0 129G   0  581   23  ILLLLILLLLLILLLLL  LLLLLLLLLILLLLLLLLLILLLLLLILLI ILII LLLLIILLLL LLLL
   124   47 B L        -     0   0    6  581   27  LIIIIIIIVLVIIIIVV  IIIVVIIIIIIVVIIIIVVIIIIIIIYIII VIYY IIIIYILLII IIII
   125   48 B S  S    S-     0   0   22  581   57  SSNSSGSSNTNSSNNNN  NSRTTSNANSSNNNNNNNNANSSNTTNNSS SNSS HNSDSADNNS SSNS
   126   49 B E  S    S+     0   0   99  581   62  EDSESESSEKAAEDDEE  NEEPPEKPDDDEESSNDEEPSDESDDESEK HDDE PDETDSEDDS ENSD
   127   50 B F  S    S+     0   0   42  581   82  WQQQSNEENDDNQQQNN  QQQRRQQRQRENNQQQQNNKNQQQQQNQQR NQKK QQQTDNRQQR KLQQ
   128   51 B Y  E     - Q   0 185G   7  581   33  WWWWWWWWWYWYWWWWW  WWWWWWWWWWWWWWWWWWWWTWWWWWYWWH FWII WWWHIITWWW WWWW
   129   52 B I  E     -PQ 123 184G   0  581   14  IVVVVVVVVVVVVVVVV  VVVIIVVIVVIVVVVVIVVIIVVVVVAVVI VVII IVVIVIVVIV VVVV
   130   53 B L  E     +PQ 122 183G   0  581   28  LVVVVLVVVLVLVVVVV  VVVIIVLVVLLVVVVLIVVLVVVVLLIVVL FVII LVVLVVLLIV LVVV
   131   54 B T  E     - Q   0 182G   0  581   43  TSSSSTSSSTSTSSSSS  SSSSSSSSSTTSSSSSSSSTTSSSSSTSST TSTT TSSTTSTTSS TSSS
   132   55 B A    >>  -     0   0    0  581    2  AAAAAAAAAAAAAAAAA  AAAAAAVAAAAAAAAVAAAAAAAAAAAAAA AAAA AAAAAAAAAA AAAA
   133   56 B A  G >4 S+     0   0    0  581    8  AAAAAGAAAAAAGAAAA  GGGAAGAAAAAAAAAAAAAASAGAAAGAAA AAAA TAAAAAAAAA GAAA
   134   57 B H  G >4 S+     0   0    7  581    0  HHHHHHHHHHHHHHHHH  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HHHH HHHHHHHHHH HHHH
   135   58 B i  G X4 S+     0   0    0  581    2  CCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCC CCCCCCCCCC CCCC
   136   59 B L  G << S+     0   0   31  581   65  FYYYYAYYYVYIYYYYY  YYWYYYWYYIIYYYYWWYYVSYYYYYVYYI TYVV VYYVLVVFWF IYYY
   137   60 B Y  G <  S+     0   0  109  581   87  KKKKQDQQKRKIKKKKK  KKKRRKYLKFLKKKKYQKKEVKKKHHYKKE DQED EQKAQNYKIA DKKM
   138   61 B Q  S <  S+     0   0   95  581   78  sSSSSdTTSrTgSTTSS  TPLPTSNLTyySSSSNNSSwrSSSPPgSTG gYrn qYThstnrNd SSSY
   139   61AB A        -     0   0   16  352   75  a....dAA.r.a.....  ...PP.PP.ti....PP..lp.....p..I a.dd a..vavevPa ....
   140   62 B K  S    S-     0   0  172  366   75  S....VSS.N.S.....  ..GKK.YK.EN....YY..KS.....S..S S.TT S..AEAEEFG F...
   141   63 B R  S    S-     0   0  162  570   78  TRRRRGRRRKRQRRRRR  RHRTTRAYRDDRRRRYARRDNRRRQQGRRK HHLL SHRRQDNEAD KRRR
   142   64 B F  E     -O  112   0G  36  577   54  LIIIILIIVIVHIIIVV  IIILLIMVIIIVVIIMQVVILIIILLLIIV LIYY IIIVLLFVQW FVII
   143   65 B K  E     -O  111   0G  67  577   78  EQQQNNSSERERQQQQE  QEQVVQQVQLLVEQQQIEETRQQQQQQQQT KQSS VQQTKTLEIK YQQQ
   144   66 B V  E     -OR 110 161G   0  577   16  VVVVVVVVVVVIVVVVV  VVVAAVVAVVVVVVVVAVVVVVVVVVIVVV VVVV IVVVVIVLAA IVVV
   145   67 B R  E     -OR 109 160G  40  577   53  TRRRRRRRRIQRRRRRR  RRRHHRMHRRRRRRRIVRRRRRRRRRVRRR RRRK RRRRRIVRIV RRRR
   146   68 B V  E     +OR 108 159G   1  578   43  HLLLLVIILLLVLLLLL  LLLLLLLILILLMLLLVIMIVLLLLLALLI VLVV LLLLVAALLV VLLL
   147   69 B G  S    S+     0   0    9  578   14  GGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG GGGGGGGGGG GGGG
   148   70 B D        +     0   0   11  579   58  GEEEESEEEDESEEEEE  EEEDDEEMEKKEEEEDDEESSEEEEEEEES SESS AEEDSTTKDN SEKV
   149   71 B R  S    S+     0   0   24  579   73  EHHHHSHHHYHTHHHHH  HHHHHHHHHHHHHHHHHHHSLYHHHHLHHS NYVV HYHYTTEYHH SHHY
   150   72 B N  B >   -T  234   0H  18  579   65  NNNNNLNNDDNFNNNDD  NNNDDNDDNYNNHNNNHNHISNNNNNDNNN ENWW KNNNYQLDHE LNNN
   151   73 B T  T 3  S+     0   0   56  579   79  LIIIIHIIIQFSIIIII  IIILLIVVIRRIIIILILIRTIIIIIMIIS HIKK RIIIWTRQIL EIII
   152   74 B E  T 3  S-     0   0  119  579   84  DDAEAGFFYFRNENNYY  EEETTERSNTARRDDRWRKNTDEDYYSDKN GDDT TDKRRIAMWN GDAD
   153   75 B Q  S <  S-     0   0  130  578   86  TVVVVSVVRVVSVVVRR  VVVKKVVKVKKAVAAVMVIKSVVVEEVVVK AVLL SVVISWGEQA EVVV
   154   76 B E        +     0   0  165  578   85  QLSLSGTTNaTGLLLNN  LLLEELFALYFNTLLFYYNGGLLVIINLLG GLGG NLLNGPMEHw GTSM
   155   77 B E        -     0   0   93  438   29  .EEEE.EEEeE.EEEEE  EEEEEEEEEEEEEEEEEEE..EEEEEEEEG .E.. IEET.EDEEs .EEE
   156   78 B G  S    S+     0   0   46  547   33  .GGGGGGGGTGGGGGGG  GGGGGGGGGRKGGGGGGEGGGGGGGGGGGT GGGG GGGEGGGPGG GGGG
   157   79 B G  S    S+     0   0   47  555   76  NDGNTQTTTPNTNNNTT  TNNTTNTTNqgTKGGTTTTRTNNGAASNNV DGQQ TGNtSQGQTs ATGN
   158   80 B E        -     0   0   37  444   33  LEEEE.EEEAE.EEEEE  EEEEEEEVEeeEEEEEEEE..EEEEEEEE. .E.. EEEh...QEe .EEE
   159   81 B A  E     -R  146   0G  27  457   60  TQQQQ.QQQIQ.QQQQQ  QQQQQQQQQKKQQQQQQQQ..QQQQQQQQ. .Q.. QQQI..VFQQ .QQQ
   160   82 B V  E     -R  145   0G  71  557   81  KFFFFLRRFMYIFFFFF  FFFHHFLIFIIFFFFLYFFVLFFFFFTFF. FFHH DFFEVEVVYT VFFF
   161   83 B H  E     -R  144   0G  14  567   77  IIIIIVIIIRIYIVVII  IIIIIIMIVRVIIIIMMIIHVIIIIIIIIY FIAA IIIKHLSSMR HIII
   162   84 B E        -     0   0   90  569   77  KNNNDPQQSASNNNNDX  NNNQQNKQNMASSDDKSSSKGNNDDDTNNT KDRR KDNKSARKSN RDNN
   163   85 B V  E     -S  186   0G  27  574   64  VSSASVAASVSAAAASS  AAAVVATVALISSAATVSSVVSAAAAVAAA VAVV VAAVVVVIVI ASSS
   164   86 B E  E    S+     0   0G  70  575   73  DAAASKSSSTSAAAASS  ATAEEADEAEDSSAADESEISAAAAASAAK KSAA SSAKRREADK LSAA
   165   87 B V  E     -S  185   0G  13  576   72  KKKKTPKKRARQKKKRR  KKKANKTKKRERRKKTARRDAKKKKKKKKS KKVV KKKRAERDAR KKKK
   166   88 B V  E     -S  184   0G  72  577   45  LVIIVVAAVIVVIIIVV  IIKAIIISIIIVVIIIIVVFVVIIMMIIIK VIII VIIVFILIII QVVV
   167   89 B I  E     +S  183   0G  27  578   45  IIIIIIIIIIIIIIIII  IIIYYIIFIIIIIIIIYIIHYIIIIIIIIV HIRR IIIVRIVHYI YIII
   168   90 B K  E     -S  182   0G  68  578   82  IRRRRQRRRRRRRKKRR  RRRKKRWQKIVRRRRWWRRMTRRRLLLTRA QRKK LRRRNIPFWV RRRR
   169   91 B H    >   -     0   0   19  579   14  HHHHHHHHHHHHHHHHH  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HHHH HHHHHHHHHH HHHH
   170   92 B N  T 3  S+     0   0  156  579   60  NPPPPPPPPRPAPPPPP  PSPSFPPYPPPPPPPPQPPPPPPPPPEPPP PPEE PPPREEEPQQ EPPP
   171   93 B R  T 3  S+     0   0  150  576   74  YKRKSQQQNSNSKNNNN  NKKSSKDKNKKNNNNSSNNSNNKSDDNNQK LKDD SKKGGKLNSQ KSSR
   172   94 B F    <   -     0   0   24  579    5  FYYYYYYYYFYYYFFYY  YYYYYYYYFYYYYYYYYYYYYYYYYYFFYY FYYY YYYFYYYFYY FYYY
   173   95 B T     >  -     0   0   56  579   67  DNNNNNSNNDNNNNNNN  NNNKKNDNNnnSSNNDDSSnNNNNDDDNDN NSvl gSNDNKNNNn DNNS
   174   96 B K  T  4 S+     0   0  145  525   79  SSQSSPSSSQSSSRRSS  RGRDDSYSRrkSSAAYYS.rASSAKKYGRS YSta pSRAP.AGYg ASSS
   175   97 B E  T  4 S+     0   0  174  533   92  WANWFSAAWNYRRKKWW  NNKENRQSKEEYYNNQTY.AAWRNWWDNKK QWII VWDRRSSQQV KYNW
   176   98 B T  T  4 S-     0   0   44  561   58  FTTTTTTTNSNTTTTNN  TTTADTTNTNNNNTTTTNSDTITTTTLTTT TTLL TTTTTLITTR TTNT
   177   99 B Y    ><  +     0   0   60  566   66  YIMLLIIIIYILLLLII  LLLYVLLILLLIIYYLLIYYYLLFVVLLLK VLFF LLLLMYTFMH VLFL
   178  100 B D  T 3   +     0   0   25  578   38  LDDDDDDDDNDDDNNDD  NNDDDDDDNDNDDNNDDNnDDDDDDDDDNN DDNN ADDYIqDDDD DDNN
   179  101 B F  T 3  S+     0   0   21  558   68  NNNNNFNNNHNYNNNNN  NNNHHNHNNRRNNNNFYNnFYNNNNNNNNN YN.. HNNNNyNNHY YNNN
   180  102 B D    <   +     0   0    1  577    0  DDDDDDDDDDDDDDDDD  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDD DDDDDDDDDD DDDD
   181  103 B I        +     0   0    0  579   14  IIIIIFIIIIIIIIIII  IIIIIIIIIIIIIIIIIIIVVIIIIIIIIF FIII IIIVVAIIII YIII
   182  104 B A  E     -QS 131 168G   0  579   60  AMMLMAMMMAMGLMMMM  LMLMMLMMMAAMMMMMMMMAAMLMMMSMMA SLAA ALMAAAAAMA GMMM
   183  105 B V  E     -QS 130 167G   0  580   15  LLLLMLLLLLLLLLLLL  LLLLLLLLLLLLLLLLLLLVILLLLLLLLI LLVV LLLIVVLLLL LLLL
   184  106 B L  E     -QS 129 166G   0  581   30  LIIIILIIILIVILLII  IIIVVIIILILIIIIIMIILWIIIIILIIV LIIM LIILILIVMM IIII
   185  107 B R  E     -QS 128 165G  40  581   42  LKKKKEKKKKKRKKKKK  KKKKKKKKKQHKKKKKKKKEKKKKKKKKKT EKRR KKKTRVFQKE EKKK
   186  108 B L  E     - S   0 163G   0  581   17  LLLLLLLLLLLTLLLLL  LLLLLLLLLLMLLLLLLLLLLLLLLLLLLV LLLL LLLLMLVLLL LLLL
   187  109 B K  S    S+     0   0  101  581   69  KSSSNESSSRSSSSSSS  SSSAASFASKRSSKKYASRESSSNKKSSSN ESVV ESSDSDTMAS DSSS
   188  110 B T  S    S-     0   0   82  582   74  SSSSSQSSKKKSSSSKK  STTKKSHESRRKKTTHHEEKTSSSSSGSSK ETDD KTSSSGPDHS TRSS
   189  111 B P        -     0   0   48  582   39  PPPRPPPPPPPGPPPPP  PPPPPPPPPPPPPAAPPPPPPPPPPPSPRD SPSS SPPPPDPRPA PAPP
   190  112 B I        -     0   0    4  532   62  LAAAAVAAAVA.AVVAA  AAAAAAVAVIIAAAAVVAAV.AAAAALAAM IALL AAAVIFFAVV VAAA
   191  113 B T        -     0   0   95  537   72  STTVGQTTTETIVTTST  VVVQQVEQTGTTTTTETTTS.VVTTTTTVA TVII TVVTSEPSTV QSTV
   192  114 B F        +     0   0   56  580   32  LILILLLLLFLVILLLL  IIIYYIVFLFFLLLLVVLLYVLILLLFLII FIFF VIIFYFLFLL LLLL
   193  115 B R  B >   -U  196   0I  52  581   64  GSNNNSNNNTNgNNNNN  NNNNNNTNNTTNNNNTNNNtsNNNNNNNNd NNNN NNNSRNdTNS SNNN
   194  116 B M  T 3  S+     0   0   29  564   77  VSSASEQQSKQsSAASS  ADDQQSEHANDQQSSEEQQcgASSSSNSAk SAAA NAAKSErDKT ESSK
   195  117 B N  T 3  S+     0   0   13  572   89  RRRRYEYYYTYGRRRYY  RYHYYRSHRYEYYRRAYYYTNRRRKKNRRT VRDD NRRMSSKYFR NYRR
   196  118 B V  B <   +U  193   0I   0  574   26  KVVVVFAAVIVVVVVVV  VVVVVVVVVIIVVVVVVVVVIVVVVVVVVT RVVV VVVIVVIIVV VVVV
   197  119 B A        -     0   0    1  576   81  VSSSNFQQQRQASAAQQ  SSSQQSAQAHHQQSSARQQVAASSSSAASK YSRR HSSRRHALQK KQSA
   198  120 B P        -     0   0    8  576   54  PTSTTPAAPPPSATTPP  TTTPPAPPTPPPATTPPPPSFTATTTPTTI PTPP TTTPAPTPPP LTAT
   199  121 B A        -     0   0    2  577   39  IVIIVVVIVVVIIVVVV  IIIIIIIIVVVVVVVIVVVVAIIVIIIVII VLII VLIVIIIVIV VIVV
   200  122 B g  B     -g  290   0F   1  578   67  CSSSSEPPACAASAAAA  SPPPPSSPACCAAAAPAAADSSSSPPASST RAPP CASCREECAC KASS
   201  123 B L        -     0   0   27  580    5  LLLLLLLLLLLLLLLLL  LLLVVLLLLLLLLLLLLLLLLLLLLLLLLL LLLL LLLLILVLLL LLLL
   202  124 B P        -     0   0    7  581   31  SPPPPPPPPPPQPPPPP  PPPAAPPAPPPPPPPPPPPAPPPPPPPPPA PPAA PPPPAAGGPP APPP
   203  124AB E     >  -     0   0   92  580   75  ERKTSESSTKSSTSSTT  TNTRRTTHSTTSSRRTKTTEARTRQQARTK ESDD FSTTDKPDKE ESTS
   204  125 B R  H  > S+     0   0  109  580   79  VSSATQSSSESAASSSS  AAASSAGSSKKSSSSRASSSSAASYYQSAE KASS NAAGSEESAA PSSA
   205  126 B D  H  > S+     0   0  124  580   85  TCCPCDCCCRCNPCCCC  PPPCCPCCCEQCCCCCCCCGGCPCCCGCPG DCAA GCPSNRLVCG GCCC
   206  127 B W  H  >>S+     0   0    4  580   87  AAAPAQVVASAIPAAAA  PPPPPPPPAIVAAPPPPAATSAPGPPHAPS DAPP PAPAPPPLPQ VAAA
   207  128 B A  I  X>S+     0   0    0  580   75  IAAASEGGPEPAAPPPP  AAARRAYMPVAAPSSYVPPEDAASTTTAAS DSAA ASAKREPLKE ESAA
   208  129 B E  I  <5S+     0   0   75  581   83  EAAAAVTTAPAAAAAAA  AAAEEAGKAQKAAAAGAAAVPPASAAAATV VAAA PAAYNHVEAV LSAA
   209  130 B S  I  <5S+     0   0   70  582   65  RGGGGEGGGAGGGGGGG  GGGGGGGGGTTGGGGGGGGKAGGGGGTGGP yGGG SGGDGGGrGP EGGG
   210  131 B T  I  <5S+     0   0   18  104   77  .................  .........LL................... g... ......Tf.. ....
   211  131AB L  I ><  S-     0   0  119  478   80  .ssst.QQ.SMssss..  sSs.DssGsSSMQssg.TMk.SsSkkSSsS QsGG ASsR.sTeT. .aSS
   227  146 B E  T 3  S+     0   0   47  513   76  .STSS.TTMESESFFMM  SSS.NSGFFGSSSSSG.MSE.SSSFFESSE NSII SSFE.EESDG .STS
   228  147 B K  T 3  S+     0   0  169  537   69  .GGGG.SSSGSGGGGSS  GGG.IGDFGGPSSGGE.SSGGGGGGGGGGG SGLL GGGSGGDASS SGRG
   229  149 B G  S <  S-     0   0   29  548   67  .TQASSVVSGTGAVVSS  AAAGGAAGVQKTSTTV.STGGTATFFGSAG QVWW GVAGGGGNVG RSES
   230  150 B R        -     0   0  213  557   86  .NRDNEGGVTASDSSVV  DDDEEDIESASAANNYFTAGSNDNEENSDS ENLL DNDPSVFTFA RNKN
   231  151 B Q  B     -V  224   0J  79  563   93  TYYYYSSSSLDAYEESS  YYYFFYMFELLDDYYMNDNGGYYYSSTYYS SYQQ TYYQIIGLNI SYYY
   232  152 B S        -     0   0   14  569   51  EPPPPNPPGPKSPTPGG  PPPPPPPPPPPRGPPPPSRTSPPPPPPPPS NPPP PPPPPSSPPS SPPP
   233  153 B T  S    S+     0   0   48  570   73  TEDDDEDDDANTDDDDD  DDDDDDNDDQTNNSSTFSDLAEDSSSDSDT KDAL DDDADNTRFD ASDE
   234  154 B R  B    S-T  150   0H 102  570   86  GLVEKAVVQLKTELLQQ  EEERRERRLVVKKLLLNRMQSLELVVVLET HLSS LLEVHIQFNT ARVL
   235  155 B L        -     0   0    3  578    3  LLLLLLLLLVLLLLLLL  LLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLL LLLLLLLLLL LLLL
   236  156 B K  E     -FH  98 221F  31  578   51  QQQQMRMMQQQRQQQQQ  QQQQQQQQQQQQQQQQQQQQLQQQQQQQQR RQLL QQKQLQRQQQ QMQQ
   237  157 B M  E     -FH  97 220F  18  579   94  KCCCCACCCHCQCCCCC  CCCCCCCCCQQCCCCCCCCGKCCCCCKCCA ACKK QCCEAQQECQ ICCC
   238  158 B L  E     - H   0 219F   4  580   42  VLLLLTVVLVLVLLLLL  LLLVVLLLLVILLLLLVLLVVLLLLLVLLV TLTT ALLVVVVIVA VLLL
   239  159 B E  E     - H   0 218F 107  580   72  NKQDDNQQEDNADDDNE  EDDDDDDDDNHNNDDNKDDKSDDDDDTKDH VESS SEDTREQRDK TWQD
   240  160 B V  E     - H   0 217F   0  580   46  IAAAAVAAIVIVAAAII  AAAVVAVLALLIIAAVVLLVVAAAAAVAAV VAVV VAAILVVLVV VAAA
   241  161 B P  E     - H   0 216F  34  580   26  QPPPPPPPPPPPPPPPP  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPQ PPKK PPPPRNPPPP PPPP
   242  162 B Y  E     -J  263   0F  36  581   45  LIIVIAVVIIIIVLLII  VVVVVVAVLIIIIVVIIIIAVIVVVVLVVA KLII ILVIILLIIT YIIL
   243  163 B V  E     -J  262   0F  24  582   35  ILLLLVLLLLLVLLLLL  LLLLLLVLLVVLLLLVLLLIVLLLLLVLLH YLLL VLLWVVVVVV VLLL
   244  164 B D     >  -     0   0   88  581   58  KSSTSSSSSTSASPPSS  TTSSSSSPPDESSSSDSSSSATSSSSSSSS NSDD SSTTDEDDSA SSPS
   245  165 B R  H  > S+     0   0   51  581   79  WADQDQDDTLDDQQQTT  QQQDDQNEQQQDDDDLNEDPRQQDDDDDQD DHPP RHQNRNRHKL EDDQ
   246  166 B N  H  > S+     0   0  105  582   75  ESSATETTRDRAAAARR  ATASSAEDAEDRRSSQVRRKAAASSSASAD EANN SAAREAEKES ESSA
   247  167 B S  H  > S+     0   0   48  582   78  TVTESESSDQDAEDDDD  KKESSEDSDTIDDSSVEDDDTQESVVESKE QDVV RDEEEQVTDT VTSQ
   248  168 B j  H  X S+     0   0    1  582    2  CCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCC CCCCCCCCCC CCCC
   249  169 B K  H >< S+     0   0   88  582   73  FSRERrRRErDnEEEEE  EKEKKEEKEKREDTTEEEEaqEEKHHrKEK nEKK DEKkaKqQDs kKRE
   250  170 B L  H 3< S+     0   0  150  547   89  .NNANsNNNkNyAAANN  ALAAAAKSAADNNSSNGNNssAASKKdSA. yA.. KAAnySaKIq sGNA
   251  171 B S  H 3< S+     0   0   23  578   76  EAASSYSSSYSASSSSS  SSSSSSASSSSSSSSASSSGYSSSAAYSSK TSRR ASSASSYANM HAAS
   252  172 B S    <<  -     0   0   20  581   83  LYYYYGYYYRYSYYYYY  YYYCYYYYYTTYYYYYYYYGPYYYYYGYYY QYSS YYYAYYNTYR SYYY
   253  173 B S  S    S+     0   0   79  581   83  MPPPPGPPPAPYPPPPP  PPPRRPPGPKSPPPPPPPPKQPPPPPAPPF YPYY PPPPGSWPPP DPPP
   254  174 B F  S    S-     0   0  124  581   79  PGGGGYGGGSGGGGGGG  GFGGGGGDGIIGGGGGGGGDEGGGRRDGGR GGQQ GGGGRIRYGA RGGG
   255  175 B I        -     0   0  100  582   88  LQQKEQDDMRMGKKKMM  RRKLLKMDKKRMMKKMMMMKTQKKQQEQKS GEYY KEKGQMPPQT LQQQ
   256  176 B I        -     0   0   13  582   16  LIIIIIIIIIIIIIIII  IIIFFIIIIVIIIIIIIIIIIIIIIIIIIL IIII IIIIILIVII IIII
   257  177 B T    >   -     0   0   16  582   36  TTSTTTTTTTTTTTTTT  TTTTTTTTTTTTTTTSTTTTSTTTTTFTTT TTTT DTTVKTTTST STTT
   258  178 B Q  T 3  S+     0   0  133  582   68  KSSSNDNNDSDANGGDD  SSSEENRNGSDDDSSPDNPDTENSNNDGSS KNKE SNNEDGERDA PSGD
   259  179 B N  T 3  S+     0   0   24  582   61  SNNNNRNNANSRNNNAA  NNNNNNRNNNNAANNRRAASRNNNNNSNNN TNTT SNSHTRGNTR YNNS
   260  180 B M  E <   - K   0 311F   2  582   11  MMMMMMMMMMMMMMMMM  MMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MMMM MMMFMMMMMM MMMM
   261  181 B F  E     - K   0 310F   8  581   34  LIIFFIIIFLFIFVVFF  FFFFFFVFVFFFFFFVVFFLFIFFFFIIFF IIII LIFLILLFLL FFIV
   262  182 B j  E     +JK 243 309F   1  582    0  CCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCC CCCCCCCCCC CCCC
   263  183 B A  E     +JK 242 308F   0  582   27  ALLVAALLAAAAVAAAA  AVVAAVAAAAAAALLAAAAAAAVLLLAVVA AAAA AAVAAAAAAA AALA
   264  184 B G  S    S-     0   0    3  582   10  GGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGAA GGGGYGAGGG GGGG
   265  185 B Y        -     0   0   56  561   58  DFYFFYYYYKYFFFFYY  FFFFFFYFFYFYYFFYYYYLVFFFFFVFFP FFAA LFFQAVAYYY KFYF
   266  185AB D  S    S-     0   0   81  565   84  LLMLLQLLLGLTLLLLL  LLLLLLMQLKKLLLLMLLLPTLLLLLPLLP ELLL DLLAEDSSPN MMLL
   267  185BB T  S    S+     0   0   76  582   62  EEQEEAEEEKEAEEEEE  EEEEEEDEEppEQEEEEEEESEEEEEEEEE EELG KEEGHGGqEE SEQE
   268  186 B K  S    S-     0   0  107  532   32  GGGGGGGGG.GGGGGGG  GGGGGGGGGnkGGGGGGGGGGGGGGGGGGG GG.. GGG..GGiGG GGGG
   269  187 B Q  S    S+     0   0  102  537   37  GGGGGGGGG.GGGGGGG  GGGGGGGGGRTGGGGGGGGGGGGGGGGGGG GG.. GGG..GGIGG GGGG
   270  188 B E        +     0   0   33  581   54  KKKKKKKKKQKRKKKKK  KKKKKKRKKGGKKKKKKKKKRKKKKKKKKK KKKR IKKRKKKGKI EKKK
   271  189 B D  B     -E   94   0E   7  582    3  DDDDDDDDDDDDDDDDD  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDD DDDDDDDDDD GDDD
   272  190 B A        -     0   0    7  582   42  ASSSSASSSSSASSSSS  SSSSSSASSAASSSSAASSSSSSSSSSSSS ASSA ASSSAAAASA PSSS
   273  191 B k    >   -     0   0    7  582    0  CCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCC CCCCCCCCCC CCCC
   274  192 B Q  T 3  S+     0   0   90  582   25  QQQQQQQQQQQQQQQQQ  QQQQQQNQQEEQQQQNQQQQQQQQQQQQQQ QQHR QQQSQQQKQQ NQQQ
   275  193 B G  T 3  S+     0   0    6  582    7  GGGGGGGGGGGGGGGGG  GGGVVGGGGGGGGGGGGGGGGGGGYYGGGG GGGG RGRGGGGGGG GGGG
   276  194 B D    X   +     0   0    0  582    0  DDDDDDDDDDDDDDDDD  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDD DDDDDDDDDD DDDD
   277  195 B S  T 3  S+     0   0   14  582    1  SSSSSSSSSSSSSSSSS  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSS SSSSSSNSSS SSSS
   278  196 B G  T 3  S+     0   0    0  582    0  GGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG GGGGGGGGGG GGGG
   279  197 B G    <   -     0   0    0  582    2  GGGGGGGGGGGGGGGGG  GGGGGGSGGGGGGGGSGGGGGGGGGGGGGG GGGG GGGGGGGGGG GGGG
   280  198 B P  E     - L   0 294F   1  582    3  PPPPPPPPPPPPPPPPP  PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPP PPPPPPPPPP PPPP
   281  199 B H  E     -IL 219 293F   0  582   49  LVVVVLVVVLVLVVVVV  VVVLLVLLVFFVVVVLLVVLIVVVVVLVVA LVLL LVVLLLLFLL VVVV
   282  200 B V  E     -IL 218 291F   3  582   27  VVVVAVVVVLVVVVVVV  VVVVVVVVVVVVVVVVVVVVVVVVVVAVVV TAVV VAVMVIVVVV VVVV
   283  201 B T  E     - L   0 290F   0  582   67  CCCSCECCCVCASCCCC  SCSCCSCCCMMCCCCCCCCDNCSCCCACCK HCSS SCCISYVVCC SCCC
   284  202 B R  E     + L   0 289F  99  582   70  QNNNNGNNNRNGNNNNN  NNNNNNFDNKKNNNNDNNNESNNNNNSNNG GNGG KNNNGNDQNE NNNN
   285  203 B F  E >  S- L   0 288F  22  582   70  kGRGGKGGGNGGGRRGG  GGGGGGGGRssNGGGGGGGNAGGGGGDGGN DGGG TGGNDNNRGL GNGG
   286  204 B K  T 3  S-     0   0   85  206   71  k........G.......  .........dd...............T... .... G......K.D ....
   287  205 B D  T 3  S+     0   0  108  208   57  S........D.......  .........NN...............G... .... E..G...N.G ....
   288  206 B T  E <   - L   0 285F   3  218   75  K........K.......  .........RR...............S... .... R..R...R.R ....
   289  207 B Y  E     - L   0 284F  21  227   50  W........H.......  .........WW........RK.....T... .... F..W...W.Y ....
   290  208 B F  E     -gL 200 283F   0  582   91  YEEQETQQQEEREEEQQ  QQEEEEEEEYYEEQQEEQEKGEEQEEYQQV VQQQ YQQTREKYEV IQAE
   291  209 B V  E     + L   0 282F   1  582   41  QLLLLLLLLILLLLLLL  LLLLLLVLLQQLLLLVLLLQFLLLVVLLLQ LLLL ILLQLLVILL QLLL
   292  210 B T  E     +     0   0F   1  582   84  LQQQQVQQQVQVQQQQQ  QQQYYQQFQVIQQQQQHQQVIQQQQQAQQL VQVV HQQVVLVIQI YQQQ
   293  211 B G  E     -ML 312 281F   0  582    0  GGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG GGGGGGGGGG GGGG
   294  212 B I  E     -ML 311 280F   0  582   19  IIIIIVIIVIVVIIIVV  IIIVVILVIIIVVVVLIVVVVIIVIIIIVV VIII AIVIVIIIIV IIVI
   295  213 B V  E     +M  310   0F   7  582   14  VVVVVVVVVVVVVVVVV  VVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VVVV TVVVVVVVVV VVVV
   296  214 B S  E     -     0   0F   1  581    0  SSSSSSSSSSSSSSSSS  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSS SSSSSSSSSS SSSS
   297  215 B W  E     -M  309   0F  45  582    8  WWWWWWWWWWWWWWWWW  WWWWWWWWWWWWWWWWWWWWWWWWWWWWWF WWYY WWWWWWFWWW WWWW
   298  216 B G        -     0   0   26  582    0  GGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG GGGGGGGGGG SGGG
   299  217 B E  S    S-     0   0   25  577   90  VYIYYIRRYVYVYYYYY  DYYWQYQHYEEYYYYQQYYQYYYYDDYYDV FYII YYHIHTEVYY FYAY
   300  218 B G  S    S-     0   0   19  580   15  GGGGGGGGGGGGGGGGG  GGGGGGGEGGGGGGGGGGGGGGGGGGGGGG GGGG GGGGGGGGGG GGGG
   301  220 B k  S    S-     0   0    7  582    2  CCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCC CCCCCCCCCC CCCC
   302  221 B A  S    S+     0   0    4  581   17  GAAAAAAAAGAAAAAAA  AAAAAAAAADDAAAAAAAAAAAAAAAAAAA AAAA AAAGAAAGAA AAAA
   303  222 B R    >   -     0   0  105  578   74  QQQQQELLERQRQLLEE  QLQQEQLKLRREEQQEQQERRQQQLLRQQR QQNN RQWKDRRRQR LQQE
   304  223 B K  T 3  S+     0   0  152  578   65  KKKKRPPPRAKPKPPRR  KKKRRKPKPDDRRRRPPRRPPKKKEEPKKK PKPP SKKGVAAKPP PRKK
   305  223AB G  T 3  S+     0   0   26  582   58  KGGNDGNNDGDNNDDDD  NRNNNNEGDGGDDGGNNDDGNNNGGGGNNN KGFF GGNQKKQNNN NNGD
   306  224 B K    <   -     0   0   43  582   85  QKKKRYYYHYNFRNNHH  KRKAARYYNKKHHKKYYHHKLKRKKKYKKN YKFF KKRYYYYHYT YQKS
   307  225 B Y        -     0   0   33  582   49  PPPPPPPPPPPPPPPPP  PPPPPPPPPYYPPPPPPPPPPPPPPPPPPP PPPP FPPPPPPYPP PPPP
   308  226 B G  E     -K  263   0F   4  580    2  GGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG GGGGGGGGGG SGGG
   309  227 B I  E     -KM 262 297F   6  581   10  VVVVVVVVVVVVVVVVV  VVVVVVVVVFFVVVVVVVVIVVVVVVVVVI VVVV VVVVVVVYVI VVVV
   310  228 B Y  E     -KM 261 295F   1  581    2  YYYYYYYYYYYYYYYYY  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YYYY YYYYYYYYYY FYYY
   311  229 B T  E     -KM 260 294F   2  581   40  TTTTTSTTATTATTTAA  TTTAATVTTTTAATTVTAAAATTTTTTTTA STAA ATTTAAAVTA AATT
   312  230 B K  E >   - M   0 293F  21  581   40  QKKKKRKKKRKKKKKKK  KKKKKKKKKHHKKKKKKKRKRKKKKKEKKK RKNN HKKRDAAKKK KKKK
   313  231 B V  G >  S+     0   0    1  581    8  VVVVVEVVVVVVVVVVV  VVVVVVVVVLLVVVVLVVVVVVVVVVVVVV VVVV VVVVVVVVVT VVVV
   314  232 B T  G 3  S+     0   0    2  579   72  SCCYCACCCACSYCCCC  YYYCCYCCCHFCCCCCCCCSSCYCCCSCYS SCAA KCYTAPPSCS SCCC
   315  233 B A  G <  S+     0   0   29  579   80  SNNNNANNIRLNNNNII  NNNNNNEHNRRLLKKESIIHANNNNNYNNA SNEV NNNHYEYNAE ANNN
   316  234 B F  S <> S+     0   0    7  575   36  YYYYYVYYFYFLYYYFF  YYYYYYFYYMMFFYYFLFF LFYYYYHYYA VYLL LYYFFLFYLF IFYF
   317  235 B L  H  > S+     0   0   23  573   81  LVVVNRNNNLNRVVVTN  LVVLLVLIVRRNNVVHIII LVVVLLVVVA RVKK IVVMHRQHLS RTVV
   318  236 B K  H  > S+     0   0  116  572   68  SDSDTDSSDPNSDDDDD  TDDRGDYDDQRDDNNSPDD PDDNNNDNKK EDPP GDDPREEDPA DTSD
   319  237 B W  H  > S+     0   0   26  572    1  WWWWWWWWWWWWWWWWW  WWWWWWWWWWWWWWWWWWW FWWWWWWWWW WWWW WWWWWWWWWW WWWW
   320  238 B I  H  X S+     0   0    1  569   12  IIIIIIIILLLIIIILL  IIIVVIIVIMMLLIIFILL IIIIIIIIII VIII VIIIIIIIII IIII
   321  239 B D  H  < S+     0   0   66  541   72  EKRKRKAAEREQKQQKE  KKEQQKENQMKEEQQEDEE QQKQHQKQKK HQLL TQKTELAKNK KRRK
   322  240 B R  H >< S+     0   0  136  528   71  TQQDNESSTATSDDDNT  NDDNDDDDDKKSTQQESRT QSDQQQ QNS EENN SEDKRAEEED DNQQ
   323  241 B S  H >< S+     0   0    6  495   71  KTTTT TTTNTNTTTTT  TTTIITVITIVTSTTVITT  TTTTT TTT VTAA GTTNTTQKIK  TTT
   324  242 B M  T 3< S+     0   0   25  452   39  TIIIM MMMLM IIIMM  IIIIIILMIIIMMIILLMM  IIVIV II  VIII MIIL RRILI  MII
   325  243 B K  T <  S+     0   0  153  418   69  KASAS AAADA AAAAA  AAAEEAQEA  AAAAASSA  AAAAA AA   AEK AAAK NA TH  SAA
   326  244 B T    <         0   0   51  369   66   AAAS AASDS AAASS  AAANNATDA  SNAAAISS  AAAEA AA   A   KAA  SA SE  SAK
   327  245 B R              0   0  197  260   47   NNNN NN    NNN    NNNNNN HN    NN N    NNNNN NN   N   NNN  K      NNH
## ALIGNMENTS  561 -  630
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....7....:....8....:....9....:....0....:....1....:....2....:....3
     1   49 A Q              0   0  101  253   29             H                                  E                       
     2   50 A a    >   +     0   0   22  341    0             C                      C           C                       
     3   51 A E  T 3  S+     0   0  187  342   77             Q                      L           K                       
     4   52 A T  T 3  S-     0   0  105  342   54             S                      E           V                       
     5   53 A S    <   +     0   0   89  342   62             E                      N           l                       
     6   54 A P        +     0   0   10  343   18             P                      P           l                       
     7   55 A b        -     0   0   18  344    0             C                      C           C                       
     8   56 A Q  S    S+     0   0   92  343   70             Q                      R           Q                       
     9   57 A N  S    S-     0   0   63  303   24             N                      N           .                       
    10   58 A Q  S    S-     0   0  152  336   48             G                      N           N                       
    11   59 A G        -     0   0   16  344   17             A                      G           G                       
    12   60 A K  E     -A   23   0A 117  344   75             T                      T           Q                       
    13   61 A a  E     -A   22   0A  45  344    0             C                      C           C                       
    14   62 A K  E     -A   21   0A 155  344   82             V                      V           V                       
    15   63 A X  E     +A   20   0A 120  302   29             D                      .           N                       
    16   64 A G        -     0   0   44  341   74             Q                      Y           S                       
    17   65 A L  S    S-     0   0  152  342   69             I                      L           I                       
    18   66 A G  S    S+     0   0   67  343   62             N                      e           G                       
    19   67 A E        -     0   0  119  329   61             T                      t           S                       
    20   68 A Y  E     -A   15   0A  37  342    9             Y                      Y           F                       
    21   69 A T  E     -A   14   0A  71  343   83             I                      Q           R                       
    22   70 A b  E     -A   13   0A  20  343    0             C                      C           C                       
    23   71 A T  E     -A   12   0A  85  344   80             I                      Y           H                       
    24   72 A c        -     0   0   44  344    1             C                      C           C                       
    25   73 A L    >   -     0   0   62  344   86             P                      A           K                       
    26   74 A E  T 3  S+     0   0  177  344   74             V                      E           P                       
    27   75 A G  T 3  S+     0   0   29  344   24             N                      G           g                       
    28   76 A F  E <   +B   36   0B  40  343   16             L                      F           l                       
    29   77 A E  E     +B   35   0B  74  343   63             E                      E           T                       
    30   78 A G  S >  S-     0   0   32  343    1             G                      G           G                       
    31   79 A K  T 3  S+     0   0  156  343   72             R                      R           T                       
    32   80 A N  T 3  S-     0   0   33  343   62             H                      F           A                       
    33   81 A c  S <  S+     0   0    1  344    0             C                      C           C                       
    34   82 A E        +     0   0   87  342   30             d                      q           l                       
    35   83 A L  E    S-B   29   0B  96  289   42             s                      f           l                       
    36   84 A F  E     -B   28   0B 139  292   93             F                      L           D                       
    37   85 A T        -     0   0   44   76   76             .                      .           .                       
    38   86 A R        +     0   0   57  101   88             .                      .           .                       
    39   87 A K        +     0   0   96  140   78             .                      .           .                       
    40   88 A L        -     0   0   91  168   91             G                      K           E                       
    41   89 A d  S  > S+     0   0   15  238   19             C                      C           C                       
    42   90 A S  T  4 S+     0   0   98  244   86             L                      L           S                       
    43   91 A L  T >4 S-     0   0  120  274   90             Y                      Y           Q                       
    44   92 A D  G >4 S-     0   0  107  297   62             R                      N           S                       
    45   93 A N  G >< S-     0   0    8  315   63             N                      N           P                       
    46   94 A G  G <  S-     0   0    0  316   53             G                      G           K                       
    47   95 A D  G <  S+     0   0   44  344   60             G                      Q           P                       
    48   96 A e    <   -     0   0    0  344    1             C                      C           C                       
    49   97 A D  S    S-     0   0   59  344   73             E                      E           N                       
    50   98 A Q  S    S+     0   0    2  344   62             H                      H           F                       
    51   99 A F  E     -C   62   0C   4  344   77             F                      Y           I                       
    52  100 A d  E     +C   61   0C  10  344    0             C                      C           C                       
    53  101 A H  E     -C   60   0C  68  344   86             V                      D           K                       
    54  102 A E  E     -C   59   0C  92  344   56             E                      G           N                       
    55  103 A E  S    S-     0   0  100  344   81             t                      s           T                       
    56  104 A Q  S    S-     0   0  175  310   77             e                      .           E                       
    57  105 A N  S    S+     0   0  154  307   78             .                      e           G                       
    58  106 A S  S    S-     0   0   58  337   71             t                      R           S                       
    59  107 A V  E     -C   54   0C   7  343   86             H                      R           Y                       
    60  108 A V  E     -C   53   0C  45  344   87             S                      R           Q                       
    61  109 A e  E     +C   52   0C   5  344    0             C                      C           C                       
    62  110 A S  E     -C   51   0C  24  344   70             D                      S           S                       
    63  111 A f        -     0   0   23  344    0             C                      C           C                       
    64  112 A A    >   -     0   0    8  344   70             A                      A           P                       
    65  113 A R  T 3  S+     0   0  149  344   83             P                      D           R                       
    66  114 A G  T 3  S+     0   0   24  344   13             G                      G           G                       
    67  115 A Y  E <   -D   78   0D  20  344    7             Y                      F           Y                       
    68  116 A T  E     -D   77   0D  72  343   81             T                      K           V                       
    69  117 A L  E     -D   76   0D  67  340   68             L                      L           L                       
    70  118 A A    >   -     0   0   23  340   78             H                      G           Q                       
    71  119 A D  T 3  S+     0   0  175  340   77             S                      E           E                       
    72  120 A N  T 3  S-     0   0   92  340   74             D                      D           D                       
    73  121 A G  S <  S+     0   0   16  340   56             N                      G           G                       
    74  122 A K  S    S+     0   0   71  332   83             S                      R           K                       
    75  123 A A        -     0   0   22  330   70             S                      R           T                       
    76  124 A f  E     -D   69   0D  12  300   48             C                      C           C                       
    77  125 A I  E     -D   68   0D  78  304   82             V                      V           K                       
    78  126 A P  E     -D   67   0D  62  304   56             P                      A           G                       
    79  127 A T  S    S+     0   0  103  304   79             T                      Q           T                       
    80  128 A G  S    S-     0   0   32  305   75             A                      V           G                       
    81  129 A P  S    S+     0   0  116  311   78             D                      E           P                       
    82  130 A Y  S    S+     0   0   59  312   77             F                      F           N                       
    83  131 A P    >   -     0   0   17  312   34             S                      P           R                       
    84  132 A g  T 3  S+     0   0   16  323    2             C                      C           G                       
    85  133 A G  T 3  S+     0   0    0  295   30             G                      G           G                       
    86  134 A K    <   -     0   0   69  294   62             R                      Q           Q                       
    87  135 A Q        -     0   0   37  243   74                                    L           Q                       
    88  136 A T        +     0   0    4  220   79                                    P           L                       
    89  137 A L        +     0   0  105  200   57                                                R                       
    90  138 A E              0   0  104  120   71                                                S                       
    91  139 A R              0   0  231   97   28                                                R                       
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3  IIIIIIILII  IIIIIIIIIIIIIIIIIIIIII IIIIIIIIIII IIIIIIIIIIIIIIIIIIIIIII
    94   17 B V  B     -E  271   0E   7  561    9  VVVVIVIVVT  VVVVVVVVVIVAVVVVVVVVVV VVVVVVVVIVV VVIVVVVVIVVVVIIVVVVVVVV
    95   18 B G  S    S+     0   0   25  562    6  GGGGGGGGGG  GDGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGG GGGGGGGGGGGGNGGGGGGGGGG
    96   19 B G  S    S-     0   0   26  563    0  GGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGG
    97   20 B Q  E     -F  237   0F  98  564   95  EYYTREQTYE  YTYYYYYFYYYMYYSYYYYYYT YYYQYYVYYYY YYQTSSFDNFYVSRRYYFYYYYY
    98   21 B E  E     -F  236   0F  80  565   65  PEEEKEEATPD EPTETTTTTETDTTSTTTTTTD TEEPTEATETE TTESEETAQTNAFKKTETTTTTE
    99   22 B h        -     0   0    8  565   58  VCCTAIVACAA CTCCCCCCCCCACCACCCCCCA CCCACCSCCCC CCCACCCASCCSAAACCCCCCCC
   100   23 B K    >   -     0   0  123  564   79  TTTDTSVASDQ TTETTEETQEEEQQAQREQQQS KQRAQPSQAQR ERESAAADNAESATTATTEEKEI
   101   24 B D  T 3  S+     0   0   60  565   85  NRRITIPPRLE PIEPKEEKQPEEKKPEKEAAEI EAAEEVPRKEK ERPAAAKVIKEPVTTEKKEEEEP
   102   25 B G  T 3  S+     0   0    0  565   73  NHHSLNYGNNG HTNHNNNNNNNGNNGNNNNNNE NHNRNSGNNNN NNHGHHNKSNNGELLNNNNNNNH
   103   26 B E  S <  S+     0   0   36  565   67  QSSKEKSESDE SKSSSSGASSSEASDSSSSSSH SSSKSSSSSSS SSSESSAEAASSSEESGASSSSS
   104   27 B h    >   +     0   0    4  565   91  FQQVFVIFVFW QHIQLVVVLRLWIVWVIVVVVW VQQWVKWVVVV VVRFQQVYYVVWHFFVVVVLVVQ
   105   28 B P  T 3   +     0   0    0  567    9  PAAPPPKPPPP PPPPPPPPPPPPPPPPPPPPPP PPPPPPPPPPP PPPPPPPPPPPPPPPPPPPPPPP
   106   29 B W  T 3  S+     0   0    5  568   27  WHHYYYYFYWW HYYWYYYYYYYWYYWYYYYYYW YHHWYFWYYYY YYYFWWYWWYYWWYYYYYYYYYW
   107   30 B Q  E <   -N  122   0G   7  569   24  QQQqQQQQQqQ QQQQQQQQQMQQQQQQQQQQQQ QQQQQQQQMQQ QQMIQQQiMQQQiQQQQQQQQQQ
   108   31 B A  E     -NO 121 146G   1  559   47  VVVlVAVAVsA VVVVVVVVVAVAVVVVVVVVVV AVVVVVVVVVV VVAAVVVmAVVVaVVVVVVVVVV
   109   32 B L  E     -NO 120 145G   3  567   65  ASSLEYSASIS SSSLSSSSSSSSSSSSSSSSSS SSSSSSSSSSS SSSSSSSLASSSIEESSSSSFSY
   110   33 B L  E     -NO 119 144G   0  570   11  LLLLLLLLLLL LILFLLLLLLLLLLLLLLLLLL LLLLLLLLLLL LLLLLLLLLLLLFLLLLLLLLLF
   111   34 B I  E     -NO 117 143G   0  570   81  LNNKELQNNYQ NHNTNNNNNNNQNNHNNNNNNQ NNNQNNHNNNN NNNQNNNYYNNHSEENNNNNYNT
   112   35 B N  E >   - O   0 142G  30  570   88  YSSSMlVLSNQ IYSFSSAASYSQSSVAASSSSQ SSSISADAISA SSYLIIARYASDRMMASASSSYQ
   113   36 B E  T 3  S+     0   0   63  113   77  .....k..... ...................... ........... .......................
   114   37 B E  T 3  S-     0   0  136  242   76  ....TDD...N ...N.......N..Q......G ...K....... ...S.........TT.......N
   115   38 B N  S <  S+     0   0   84  543   52  EGG.YNRNGRS GKGGGGGGGGGSGGGGGGGGGG GGGGGGFGGGG GGGGGGG.QGGF.YYGGGGGGGG
   116   39 B E        -     0   0  100  561   93  DYYYMEKGYRV YDYRYYYYYYSVYYVKYYYYYQ YYYSYYGYYYY YYYSYYYGGYYG.MMYYYYSYYL
   117   40 B G  E     +N  111   0G  14  572   55  SHHYHYHGHHH HKHNHHHHHHHHHHHHHHHHHH HHHHHHRHHHH HHHHHHHAQHHRRHHHHHHHHHV
   118   41 B F  E     +     0   0G  28  581   35  lFFFMfFLFLR FlFWFFFFFFFRFFVLFFFFFT FFFFFFfFFFF FFFFFFFffFFffMMFFFFFFFF
   119   42 B i  E     -N  110   0G   0  578    1  cCCCCcCCCCC CcCCCCCCCCCCCCCCCCCCCC CCCCCCcCCCC CCCCCCCccCCccCCCCCCCCCC
   120   43 B G  E     -N  109   0G   1  581    2  GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGG
   121   44 B G  E     -N  108   0G   0  581    9  GGGGGGGGGGA GGGGGGGGGGGAGGGGGGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGG
   122   45 B T  E     -NP 107 130G   0  581   43  SSSVSSTTSST SSSSSASSSVSTSSSSASSSST SSSSSSSSSSS SSVTSSSSSSSSSSSSSSSSASS
   123   46 B I  E     + P   0 129G   0  581   23  ILLIIILLLIL LILLLLLLLLLLLLILLLLLLL LLLLLLLLLLL LLLILLLLLLLLLIILLLLLLLL
   124   47 B L        -     0   0    6  581   27  IVVIIIIIILI VIIIIIIIIIIIIIIIIIIIIV IVVIIIIIIII IIIIIIIIIIIIIIIIIIIIIII
   125   48 B S  S    S-     0   0   22  581   57  SSSSSSQSNSS NNNSDSNNNNSSNNTNNSNNNS NNNSSNTQSNS SNSNNNNNNNNTSSSNSNNNCNT
   126   49 B E  S    S+     0   0   99  581   62  PKKENKPESQN EEAPKEESSRENSSPDDESSDP DEANDEDDSQS DSTSSSSDDSEDPNNDNSEKEKP
   127   50 B F  S    S+     0   0   42  581   82  DDDKNRQSQWS NRQRKQQQEQQSQQEQQQQQQR QNNRQNQRTQT QQQNQQQRRQQQCNNQLQQQQQR
   128   51 B Y  E     - Q   0 185G   7  581   33  WWWFFHWIWWW WWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWW WWWTWWWYYWWWWFFWWWWWWWW
   129   52 B I  E     -PQ 123 184G   0  581   14  VVVIIIVIVIL VIVIVVVVVVVLVVIVVVVVVV VVVVVVVVAVV VVVIVVVIIVVVVIIVVVVVVVI
   130   53 B L  E     +PQ 122 183G   0  581   28  LVVLLLLLVLV VLVIVVVVVLVVVVVVVVVVVV VVVLVVLLVVV VVLVVVVVLVVLVLLVVVVVIVI
   131   54 B T  E     - Q   0 182G   0  581   43  TSSSTTTTSTT STSSSSSSSSSTSSTSSSSSST SSSTSSTSSSS SSSTSSSTTSSTTTTSSSSSSSS
   132   55 B A    >>  -     0   0    0  581    2  AAAGAAAAAAA AAAAAAAAAVAAAAAAAAAAAA AAAAAAAAAAA AAVAAAAAAAAAAAAAAAAAAAA
   133   56 B A  G >4 S+     0   0    0  581    8  AAAAAAAAAAA AAAAAGAAAAAAAAAAAAAAAA AAAAAAAAAAA AAAAAAAAAAGAAAAAAAAACAA
   134   57 B H  G >4 S+     0   0    7  581    0  HHHHHHHHHHH HHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHHH HHHHHHHHHHHHHHHHHHHHHHH
   135   58 B i  G X4 S+     0   0    0  581    2  CCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCC
   136   59 B L  G << S+     0   0   31  581   65  IYYIVIWLYFF YVYYYYYYYWYFYYVYYYYYYF YYYIYYVYYYY YYWSYYYVVYYVFVVYYYYYYYY
   137   60 B Y  G <  S+     0   0  109  581   87  FKKVKERSKII KYKQKKKKMYKIKKEMKKKKKS KKKLKMEKQKK KKYVQQKLAKKEDKKQKKKKKKR
   138   61 B Q  S <  S+     0   0   95  581   78  ASSlsGPgSnk SgSPSPSSSNTkSSePSSSSTg YSSGSSDSSSS SSNtTTSsrSSDgssYSSTPPPA
   139   61AB A        -     0   0   16  352   75  N..eaIAa.es .l.P.....P.p..g......l ...H.PP.... ..PvAA.aa..Piaa.......P
   140   62 B K  S    S-     0   0  172  366   75  V..QTSSN.SV .S.K.....Y.K..E......S ...L.SA.... ..YRSS.KK..ANTT.......K
   141   63 B R  S    S-     0   0  162  570   78  VRRNVKVTRAS RVRTQRRRRARQRRARRRQQRR RRRNRRGRSRR RRSNRRRLQRRGSVVHRRRRRRT
   142   64 B F  E     -O  112   0G  36  577   54  FIILFVILILF IFILIIIIIMIWIIVIIIIIIW IVVYIVIIIIV IIMVIIIYFIIILFFIVIIIIIL
   143   65 B K  E     -O  111   0G  67  577   78  TEEFRTQSQEG EKQVQQQQQQQNQQNQQQQQQR QEQVQVTQQQQ QQQRSSQDEQQTSRRQQQQQQQV
   144   66 B V  E     -OR 110 161G   0  577   16  VVVVLVVLVIL VVVAVVVVVIVVVVIVVVVVVV VVVVVVVVLVV VVIVVVVVVVVVVLLVVVVVVVA
   145   67 B R  E     -OR 109 160G  40  577   53  RRRRRRVRRML RRRLRRRRRMRSRRRRRRRRRM RRRKRRYRRRR RRFRRRREFRRYHRRRRRRRIRH
   146   68 B V  E     +OR 108 159G   1  578   43  ALLVVILGLHL MVLLLLLLLLLFLLVLLLLLVS LLLLLILLLLL LLLLIILHLLLLLVVLLLLLLLL
   147   69 B G  S    S+     0   0    9  578   14  GGGGGGSGGGS GGGGGGGGGGGGGGFGGGGGGG GGGGGGGGGGG GGGGGGGGRGGGGGGGGGGGGGG
   148   70 B D        +     0   0   11  579   58  SEESASEAEED ESEEEEEEEEEPKEAEEEEEEQ EEEDEEREEEE EEESEEEEREERKAAEEEEEEED
   149   71 B R  S    S+     0   0   24  579   73  NHHNDSHNYRP HTYHHHHHHHHLHHHHHHHHHT YHHTHHHHHHH HHHLHHHMIHHHKDDYHHHHHHN
   150   72 B N  B >   -T  234   0H  18  579   65  SHHYSNNANIQ HYNDNNNNDDNLNNMNNNNNNF NHDNNNSNNNN NNDNNNNVNNNSASSNNNNNNND
   151   73 B T  T 3  S+     0   0   56  579   79  YIITTSLVIIT IYILIIIIIVISIISIIIIIIM IIILIIQIIII IIVNIIITIIIQTTTIIIIIIIL
   152   74 B E  T 3  S-     0   0  119  579   84  QRRTSNATAGQ GDEKNEEAERKDAAVKEEKKNS DRYQEFAMAEA DARAFFARRAEANSSDDAEKNET
   153   75 B Q  S <  S-     0   0  130  578   86  KVVTKKVRVIR VKVKEVVVVVVPVVLVVVVVVA VVRHVSGEVVV VVVSVVLAGLVGEKKVVVVVVVK
   154   76 B E        +     0   0  165  578   85  NNNGGGERSKS TGVKILNNLFLQSSEEVLTTLL LSNDLSSLNIN VSFGNNNISNLSTGGLTNLLLLE
   155   77 B E        -     0   0   93  438   29  .EE..GE.E.. E.EEEEEEEEE.EEEEEEEEEG EEEAEENEEEE EEE.EEE..EEND..EEEEEEEE
   156   78 B G  S    S+     0   0   46  547   33  GGGGGTG.G.. GGGGEGGGGGG.GGNGGGGGGG GGGPGGPGGGG GGGGGGG.NGGPAGGGGGGGGGG
   157   79 B G  S    S+     0   0   47  555   76  QTTSVVF.GN. NINTTTNTTTN.GGsNNNSSNS NTSKNTGGTNT NSTTTTT.PTNGtVVGTTTNTTT
   158   80 B E        -     0   0   37  444   33  .EE...E.EL. E.EEEEEEEEE.EEiEEEEEE. EEEVEEQEEEE EEE.EEE.EEEQe..EEEEEEEE
   159   81 B A  E     -R  146   0G  27  457   60  .QQ...Q.QK. QLQQQQQQQKQTQQNQQQQQQ. QQQVQQEQQQQ QQQ.QQQ.MQQEQ..QQQQQQQQ
   160   82 B V  E     -R  145   0G  71  557   81  TFFLI.V.FR. FIFHFFFFFLFQFFAFFFFFF. FFFTFFSFFFF FFLTQQF.LFFSIIIFFFFFFFH
   161   83 B H  E     -R  144   0G  14  567   77  RIIVYYC.IM. IKIIIIIIIMIRIIYIIIIIV. IIIVIIRVIII IIMSIII.QIIRFYYIIIIIIII
   162   84 B E        -     0   0   90  569   77  KSSKNTT.NK. SDNQNNDEDKNSNNRNNNSSTY STDPNQRDSNN NNKAQQD.RDNRSNNDNENHSNQ
   163   85 B V  E     -S  186   0G  27  574   64  ASSVVAVVAVI SIAVSAASSTAISSVSAASSAV TSSVAAVSSSS SSTVAAS.KSAVVVVASSAAAAV
   164   86 B E  E    S+     0   0G  70  575   73  KSSKEKARADK LVAESAEQADAKAAGAAASSED ASSQAQQESAA AADSSSQVVQAQEEESEQAADAE
   165   87 B V  E     -S  185   0G  13  576   72  RSSNKSKKKKD SSKALKKKSTKDKKKKKKKKKR KRRDKKQKRKK KKTAKKKKEKKQDKKKKKKKKKN
   166   88 B V  E     -S  184   0G  72  577   45  VVVSVKVFILI VIIAVIIVVIIIVVVVIIVVII TVVIIAAVVVV VVIIAAVLSVIALVVIVVIIIII
   167   89 B I  E     +S  183   0G  27  578   45  IIITIVFVIII IIIYIIIIIIIIIIIIIIIIII IIIVIIVIIII IIIYIIIYIIIVIIIIIIIIIIY
   168   90 B K  E     -S  182   0G  68  578   82  IRRCCASVRII TCRKRRRKRWRIRRSRRRRRRM RRRITRCRRRR RRWVQQKGTKRCICCRRKRRCPK
   169   91 B H    >   -     0   0   19  579   14  NHHHHHHHHHH HHHHHHHHHHHNHHHHHHHHHN HNHHHHHHHHH HHHHHHHHLHHHHHHHHHHHHHH
   170   92 B N  T 3  S+     0   0  156  579   60  KPPDEPVGPPE PKPFPPPPPPPEPPPPPPPPPG PPPQPPSPQPP PPPPPPPENPPSPEEPPPPPPPF
   171   93 B R  T 3  S+     0   0  150  576   74  RNNDKKASRYN YKKGNDKSNSKNSSNRKKSSGD QNNEGRSQSNR KRNNQQNRHNQSHKKKSSDKEKS
   172   94 B F    <   -     0   0   24  579    5  FYYFYYYYYFY YYYYYYYYYYYYYYYFYYYYFY YYYYYYYYYYY YYYYYYYFYYYYFYYYYYYYYYY
   173   95 B T     >  -     0   0   56  579   67  NSSNrNNNNDH DRNKDDSNNDNHNNDNNNSNSn DNNsNSNNNSN NNDiNNNSQNDNDrrSNNDNNnK
   174   96 B K  T  4 S+     0   0  145  525   79  I..FeSPSASY RPSDSRSS.YRYSSSSASSSSr SAStSSFSSSS SAYdSSSLGSRFSeeSSSRNPvD
   175   97 B E  T  4 S+     0   0  174  533   92  K..DVKKKNWP YLWEWKWR.QDPNNKMRRSARS KYWTAYLWYRR WNQEWWRDGRKLSVVWNRKETKN
   176   98 B T  T  4 S-     0   0   44  561   58  TSSTPTTTTFA STTAVTTNSTTANTTTTTTTTD TTNATNTLTTN TTTHTTNTRNTTSPPTTNTTTKG
   177   99 B Y    ><  +     0   0   60  566   66  MYYYKKFNILH LYLYLLLLFLLHFIKAILLVLY LIIFMLFLLLL LILHIILFILLFNKKLLLLLLYL
   178  100 B D  T 3   +     0   0   25  578   38  DnnDdNNDDND TDDDDNDDnDDDNDNEDDNDDD DDDgDDDDDDD DDDDDDDNNDDDNddDDDNDDND
   179  101 B F  T 3  S+     0   0   21  558   68  CnnYfNNNNHN NYNHNNNNnFNNNNNNNNNNN. NNNnNNNNNNN SNYFNNNNNNNNNffNNNNNNNH
   180  102 B D    <   +     0   0    1  577    0  DDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDD. DDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDDDD
   181  103 B I        +     0   0    0  579   14  IIIIIFIIIII IVIIIIIIIIIIIIIIIIIIII IIVIIIIIIII IIIIIIIIVIIIIIIIVIIIIII
   182  104 B A  E     -QS 131 168G   0  579   60  AMMCAAMAMAA MALMMLMMMMMAMMAMMLMMMA LMMAMMCMMMM MMMAMMMAAMLCGAALMMLMMMM
   183  105 B V  E     -QS 130 167G   0  580   15  LLLLLIILLLV LLLLMLLLLMLVLLLLLLLLLL LLLLLLLLLLL LLLILLLLLLLLVLLLLLLLLLL
   184  106 B L  E     -QS 129 166G   0  581   30  IIILVVILILV IIIVIIIIIIIVIIMIIIIIIM IIIVIILIIII IIIWIIIVLIILYVVIIIIVIIV
   185  107 B R  E     -QS 128 165G  40  581   42  RKKEKTKAKLH KKKKKKKKKKKHKKKKKKKKKR KKKLKKQKKKK KKKKKKKKRKKQAKKKKKKKKKK
   186  108 B L  E     - S   0 163G   0  581   17  LLLLTVLLLLL LLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLL LLLLLLLLLLLLYTTLLLLLLLL
   187  109 B K  S    S+     0   0  101  581   69  RSSETNTSSKS SSAASSKSEFSSSSQSKSKKAS SSSSSSSKSAS SSFTSSSQTSSSGTTSSSSSSST
   188  110 B T  S    S-     0   0   82  582   74  SKKEEKASSSS KTSKTSTTTHSSSSTSSSSSSS SKRFSRADQSK SSHTSSTQETSAAEETSTSTTTE
   189  111 B P        -     0   0   48  582   39  PPPPPDPPPPP PPPPPPPTPPPPPPPPPRAAPP SPPPKPPRPPP PPPPPPTPPTPPCPPPSTPPPPP
   190  112 B I        -     0   0    4  532   62  FAALIMA.A.V ALAAAAAAA.AVAALAAAAA.I AAAVAVLAAAA AAV.AAA.VAAL.IIAAAAAAAA
   191  113 B T        -     0   0   95  537   72  TTTKKAQ.T.L TTVQAVLRE.VLTTTVTVSS.G VITNKENETAS ATE.TTR.SRVNAKKVQRVIIVQ
   192  114 B F        +     0   0   56  580   32  LLLFFIIILFY LFIYLILLLVIYLLFIIILLVV ILLYIMFLLIL LLVILLLVILIFVFFIILIIIIY
   193  115 B R  B >   -U  196   0I  52  581   64  NNNNTDNKNkT NGNNNNSSSeNTNNnNSNNNAG NNNSNNTSNNN NNTsNNSeESNTkTTNNSNNNNN
   194  116 B M  T 3  S+     0   0   29  564   77  TQQDDGA.SaS QEAQSASSSaASSSdSSASS.A SQSTSQATSAS TSEgQQAgPASAaDDASSAADAQ
   195  117 B N  T 3  S+     0   0   13  572   89  NYYNNKYNRNN YYRYRRRNRARNRRKWRRKKQS QYYHRRSRYRY RRANYYNSNNRSSNNRYNRRYRY
   196  118 B V  B <   +U  193   0I   0  574   26  VVVIITVVVII VIVVVVVIVVVIVVVVVVVVVQ VVVIVVIIVVV VVVIAAIFLIVIVIIVVIVVVVV
   197  119 B A        -     0   0    1  576   81  QQQQKTQASIR QKSQASTQAASRSSKSSSAAAK SQQQSRFAKAR SSAAQQQIVQSFRKKSKQSSSSQ
   198  120 B P        -     0   0    8  576   54  PTTPPKPFAPR PPSPSTASTPTKAAPTTTAATP PPPPTPPPTTT TAPYAASPPSAPVPPTTSTTITP
   199  121 B A        -     0   0    2  577   39  IVVVIIAVIIA VIIIVIIVVIIAVVVIIIVVVV VVVVIIVIVVV IIIAIIVIIVIVVIILVVIIIII
   200  122 B g  B     -g  290   0F   1  578   67  SAAEEILKACC ALSPSSSPSSSCSSCASSSSAC AAACASCASSS SSSNAAPCCPSCCEEASPSSPSP
   201  123 B L        -     0   0   27  580    5  VLLLLTLLLLL LLLVLLLLLLLLLLLLLLLLLL LLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLV
   202  124 B P        -     0   0    7  581   31  APPAVLPPPSP PAPAPPPPPPPPPPPPPPPPPP PPPPPPAGPPP PPPAPPPPPPPAPVVPPPPPPPA
   203  124AB E     >  -     0   0   92  580   75  KTTESATSKEE SLRRSTKSSTTETTNTATSSVP STTTKRAKSTS SKTASSSVESTAPSSSSSTSTTR
   204  125 B R  H  > S+     0   0  109  580   79  FEEEKKAASVA SPASSASADWTASSPSTASSSK GSSKSSAGGSS ASGSSSAAGAAALKKASAAAHAS
   205  126 B D  H  > S+     0   0  124  580   85  TCCEEEDSCTT CLSCCPCCCCPTCCGCCSCCCA CCCSCCDCCCC CCCGCCCGSCPDHEECCCPLPPC
   206  127 B W  H  >>S+     0   0    4  580   87  RAAPPGTAPDY AMAPVPAAAPPYAALAAPAAAF AAALAASAAAA AAPSVVARDAPSTPPAAAPAPPP
   207  128 B A  I  X>S+     0   0    0  580   75  KAAKSSPSAIT PNPTEAPSPIATATMPDASSPG SPPKAPTAGPS PPMDNNSSSSATRSSSSSAAVAR
   208  129 B E  I  <5S+     0   0   75  581   83  LDDGESETAQF AIADAAAAAGAFAGLAVTAAAL AAALAAFTAAS ASGPTTAFYAAFIEEGSAAAPPE
   209  130 B S  I  <5S+     0   0   70  582   65  PGGGGVLYGKP GTGGGGGGGGGPGTEGGGGGGL GGGRGGHGGGG GGGAGGGAVGGHPGGSGGGGCGG
   210  131 B T  I  <5S+     0   0   18  104   77  ........... ...................... ........... .......................
   211  131AB L  I ><  S-     0   0  119  478   80  .MMsmS.SsVk MSs.ss.ss.sk.S.sSsss.. sM..s..stsS .sG...sATss.RmmSassssss
   227  146 B E  T 3  S+     0   0   47  513   76  .SSEREYSIPS STS.SS.SSEFS.T.SVSSS.E SSMNSF.DSSS .LE...SSASS.YRRSSSSFYSD
   228  147 B K  T 3  S+     0   0  169  537   69  SSSNSGNGGTD SNG.GGGGGPGDRR.GGGGG.N GSSDGI.GGGG .GEGSSGEDGGDLSSGGGGGGGN
   229  149 B G  S <  S-     0   0   29  548   67  TVVGGGFGQQG TGS.TAYTSVAGEE.ISATTLG VVSGVD.VSVS LEVGIVTWGTAGGGGVSTAAAAV
   230  150 B R        -     0   0  213  557   86  TDAQMSYRNST AANRDDDNNNDTKK.NNDNNSK NTVSNG.NNNN SKNSGGNSDNDQLMMNNNDDDDK
   231  151 B Q  B     -V  224   0J  79  563   93  PDDNLSLIYMS DSYYYYYYYLYSYY.YYYNNFV YDSLYM.YYYY SYMGSSYLLYYFYLLYYYYYYYF
   232  152 B S        -     0   0   14  569   51  SGGPASSSPTP GSPPPPPPPPPPPPSPPPPPGS PGGSPPDPPPP GPPSPPPSSPPASAAPPPPPPPP
   233  153 B T  S    S+     0   0   48  570   73  NDDENTPQDEN NEDDSDDDDTDNDDDDEDDDDS ENDTDADDDDD KDTSDDDQDDDDQNNDSDDDDDD
   234  154 B R  B    S-T  150   0H 102  570   86  DKKHHTITVEI RVLQLELLLREIVVMLLELLLS LKQRLDILRLR LVRSVVLGTLEIYHHLRLEEEEI
   235  155 B L        -     0   0    3  578    3  LLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLL
   236  156 B K  E     -FH  98 221F  31  578   51  MQQQMRRLQHQ QRQQQQQQQQKQQQNQQQQQQQ QQQHQQQQMQR QQQLMMQQQQQQKMMQMQQQQKQ
   237  157 B M  E     -FH  97 220F  18  579   94  FCCSAAAKCKK CTCCCCCCCCCKCCACCCCCCE CCCECCECCCC CCCKCCCKQCCEKAACCCCCCCC
   238  158 B L  E     - H   0 219F   4  580   42  VLLVVVVALVG VVLLLLLLLLLGLLALLLLLLA LLLALLVLLLL LLLVVVLALLLVTVVLLLLLLLV
   239  159 B E  E     - H   0 218F 107  580   72  TNNLEHDTKNL ATEEDENNDDDLQQMDDDNKDT DDEEKDADNHD DKDSQQNITNDAEEEENNEDDDD
   240  160 B V  E     - H   0 217F   0  580   46  ILLILVVVAIV VIAVAAAAAVAVAAVAAAAAAV ALIVAIVVAAA AAVVAAAVVAAVVLLAAAAAAAV
   241  161 B P  E     - H   0 216F  34  580   26  SPPPPQETPDK PSPPPPPPPPPKPPPPPPPPPR PPPNPPQPPPP PPPPPPPPPPPQNPPPPPPPPPP
   242  162 B Y  E     -J  263   0F  36  581   45  PIIVVAIVILI IVLIVVIIIIVIIILLVVIILL LIIIVIVIILI LIIVVVVIIIVVLVVLIIVVVVV
   243  163 B V  E     -J  262   0F  24  582   35  VLLTVHFLLVI LTLVLLLLLLLILLILLLLLLI LLLVLLVLLLL LLVVLLLIMLLVIVVLLLLLLLL
   244  164 B D     >  -     0   0   88  581   58  ISSNGSSESKD SDSSSSSTDDTDPSEASSSSPD SSSGSTGSSSS STDASSTSSTSGSGGSSTSTTTS
   245  165 B R  H  > S+     0   0   51  581   79  RHHKLDSNDWN YQQDEQDADEQNDDPQDQDDQW QDTLDDNDDQD EDDRDDDNNVQNHLLHDAQQQQD
   246  166 B N  H  > S+     0   0  105  582   75  SAATKDCASEK EEASFAASAQAKSSGESASSAA ASRETRNETAS ASESTTSMQSANKKKASSAAAAS
   247  167 B S  H  > S+     0   0   48  582   78  EDDDKEQAVIT DKESDEQEQDETSSQQVKTTDK DDDSAKQDDQS EADTSSQQEQEQLKKDTEEKEES
   248  168 B j  H  X S+     0   0    1  582    2  CCCCCCLCCCC CCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCC
   249  169 B K  H >< S+     0   0   88  582   73  qDDfQKYNRSn DrEKRERSHEKnRRnERERREs EQEnRDRRRER EREqRRSrkSERqKKERSEEEEK
   250  170 B L  H 3< S+     0   0  150  547   89  iNNy.K.KN.e NyAANASNNNAeNSyAKASSAs ANNhNN.NNAS AKNqNNNsgNA.s..ANNAAAAA
   251  171 B S  H 3< S+     0   0   23  578   76  YSSEKY.KAQV SASSASSSAASVAAVSASSSSV SSSMASCASAS SAAYSSSYYSSCYKKSASSSCSS
   252  172 B S    <<  -     0   0   20  581   83  GYYIKFYYYLY YRYYYYYYYYYYYYYYYYYYYY YYYLYYSYYYY YYYPYYYRFYYSYKKYYYYYYYY
   253  173 B S  S    S+     0   0   79  581   83  KPPILRYGPMS PNPPAPPPPPPGPPNPPPPPPG PPPTPPYPPPP PPPEPPPARPPYGLLPPPPPPPL
   254  174 B F  S    S-     0   0  124  581   79  SGGSK.YGGPG GRGRGGGGGGGGGGNGGGNNGS GGGDGGQGGGG GGGEGGGSFGGQKKKGGGGGGGG
   255  175 B I        -     0   0  100  582   88  IMMPGSRKQMV MLEMQKQEQMKVQQLQQEQQRA EMMPKMEQEQQ QQMDDDERQEKERGGEQEKKRKM
   256  176 B I        -     0   0   13  582   16  IIIIVLVIILI TVIIIIIIIIIIIIVIIIIIIV IIIVIILIIII IIIIIIIIIIILIVVIIIIIIII
   257  177 B T    >   -     0   0   16  582   36  TTTTATNTSTT DTTSTTTTTTTTTTTTTTTTTT TSTSTTTTTTT TTTSTTTTTTTTTAATSTTTTTT
   258  178 B Q  T 3  S+     0   0  133  582   68  KQQDNSDSSRP NSKERSENNRNPGRPDNSSSSP EDDESSDDNNS ESRTNNKDNKNDDNNNSNSSSSE
   259  179 B N  T 3  S+     0   0   24  582   61  NSSRDNNNNNG TNNNNNNNNRSGNNTDNNNNKR NAAGNNNNNNN TNRNNNNNRNNNNDDNNNNNNNN
   260  180 B M  E <   - K   0 311F   2  582   11  MMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMM MMMGMMMMMMM MMMMMMMMMMMMMMMMMMMMMMM
   261  181 B F  E     - K   0 310F   8  581   34  LFFIIFIIMML FIVFMFMFMMFLIIVVMLFFVL VFFLVFMIFVF VIVVIIFLMFFMLIIIFFFFFFF
   262  182 B j  E     +JK 243 309F   1  582    0  CCCCCCCCCCC CCCCCCCCCCCCCCCCCGCCCC CCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCC
   263  183 B A  E     +JK 242 308F   0  582   27  AAAAAAAALAA AAAALVAALAVALLAALVLLAA AAAALAAIAAA ALAALLAAAAVAAAAAAAVVIVA
   264  184 B G  S    S-     0   0    3  582   10  AGGGGGGAGGG GGGGGGGGGGGGGGGGGGGGGG GGGYGGGGGGG GGGGGGGGGGGGGGGGGGGGGGG
   265  185 B Y        -     0   0   56  561   58  DYYLFPSAYNF YDFFFFFFFYFFYYYFFFFFFL FYYGFYVSFFF FFYQYYFYYFFVSFFFFFFFFFF
   266  185AB D  S    S-     0   0   81  565   84  PLLEEPRPMIL LNLLLLLLLLLLLLLLLLLLLL LLLGLLALLLL LLMTLLLTLLLAPEELMLLLLLL
   267  185BB T  S    S+     0   0   76  582   62  KEEGKEFGEQE EKEEEEEAEDEEQQREEKEEEQ EEEEEEEAEEE EEDSEEAEDAEEDKKEEAEEEEE
   268  186 B K  S    S-     0   0  107  532   32  .GG.GGG.GEG G.GGGGGGGGGGGGGGGGGGGG GGG.GGGGGGG GGGGGGGGGGGGWGGGGGGGGGG
   269  187 B Q  S    S+     0   0  102  537   37  .GG.NGG.GGS G.GEGGGGGGGSGGSGGGGGGG GGG.GGGGGGG GGGGGGGGGGGGTNNGGGGGGGG
   270  188 B E        +     0   0   33  581   54  KKKKKKKKKKV KGKKKKKKKRKVKKVKKKKKKV KKKKKKKQKKK KKRKKKKRRKKKTKKKKKKKKKK
   271  189 B D  B     -E   94   0E   7  582    3  DDDDDDDDDDD DDDGDDDDDDDDDDDDDDDDDD DDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDDDD
   272  190 B A        -     0   0    7  582   42  ASSSASSTSAA STSSASSSSASASSSSSSSSSA SSSASSASSSS SSASSSSASSSASAASSSSSSSS
   273  191 B k    >   -     0   0    7  582    0  CCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCC
   274  192 B Q  T 3  S+     0   0   90  582   25  IQQQVQQQQQQ QQQKQQQQQNQQQQQQQQQQQQ QQQQQQQQQQQ QQNQQQQQQQQQNVVQQQQQQQQ
   275  193 B G  T 3  S+     0   0    6  582    7  GGGGGGGGGGG GGGGGGGGGGRGGGGNGGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGRGGV
   276  194 B D    X   +     0   0    0  582    0  DDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDDDD
   277  195 B S  T 3  S+     0   0   14  582    1  SSSSSSSSSSS SSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSS SSSSSSSSSSSSSSSSSSSSSSS
   278  196 B G  T 3  S+     0   0    0  582    0  GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGG
   279  197 B G    <   -     0   0    0  582    2  GGGGGGGDGGG GGGGGGGGGSGGGGGGGGGGGG GGGGGGGGGGG GGSGGGGGGGGGGGGGGGGGGGG
   280  198 B P  E     - L   0 294F   1  582    3  PPPGPPPPPPP PAPPPPPPPPPPPPPPPPPPPP PPPPPPPPPPP PPPPPPPPPPPPPPPPPPPPPPP
   281  199 B H  E     -IL 219 293F   0  582   49  LVVLMALLVLL VLVLVVVVVLVLVVLMVVVVVL VVVLVVLVVVV VVLLVVVLLVVLLMMVVVVVAVM
   282  200 B V  E     -IL 218 291F   3  582   27  FVVVAVILVVV VVVIVVVVVVVVVVVVVVVVVV VVVVVEVAVVV VVVVVVVNQVVVVAAAVVVVVVV
   283  201 B T  E     - L   0 290F   0  582   67  FCCVVKCVCCG CGCCCSCCCCCGCCTCCCCCCH CCCCCCSCCCC CCCDCCCVLCSSCVVCCCSCCYC
   284  202 B R  E     + L   0 289F  99  582   70  GNNDNGDGNQA DYNNNNNNNDNANNLNNNNNNL NNNENNRNNNN NNVANNNGVNNRENNNNNNNDNN
   285  203 B F  E >  S- L   0 288F  22  582   70  NGGNNNGGGkd GNGGGGGGGGGdGGKGGGGGGT GGGFGGgGGGG GNGSGGGDnGGgANNGNGGGGGG
   286  204 B K  T 3  S-     0   0   85  206   71  .........qk ...........k..N......S ...K..a.... .......St..aS..........
   287  205 B D  T 3  S+     0   0  108  208   57  .........SG ...........G..S......S ...D..S.... .......NG..SG..........
   288  206 B T  E <   - L   0 285F   3  218   75  .........IT ...........T..I......H ...T..V.... .......FR..VR..........
   289  207 B Y  E     - L   0 284F  21  227   50  .........WW .G.........W..W......W ...F..W.... ...K...RH..WM..........
   290  208 B F  E     -gL 200 283F   0  582   91  EVVKKVYVEYF ELQEEQEQEEQFAAWEQQAAQH EEQVQEIVQQE EQETEEQEEQEIFKKQQQQQEQE
   291  209 B V  E     + L   0 282F   1  582   41  QLLLLQLQLQL LQLLLLLLLVLLLLLLLLLLLL LLLQLLQLLLL LLVLLLLLILLQLLLLLLLLLLL
   292  210 B T  E     +     0   0F   1  582   84  FQQVALEGQLA QIQYQQQQQHQAQQIQQQQQQV QQQVQQSQQQQ QQHVQQQVVQQSFAAQQQQQQQF
   293  211 B G  E     -ML 312 281F   0  582    0  GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGG
   294  212 B I  E     -ML 311 280F   0  582   19  IVVIVVIIVII VIIAIIVVILVIVVDVIVIIIV IVVIIVIIIIV IILVIIVIVVIIIVVIIVIVIVV
   295  213 B V  E     +M  310   0F   7  582   14  VVVIVVVTVVV VVVVVVVVVVVVVVTVVVVVVV VVVVVVVVVVV VVVVVVVVVVVVVVVVVVVVVVV
   296  214 B S  E     -     0   0F   1  581    0  SSSSASSSSSS SSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSS SSSSSSSSSSSSSAASSSSSSSS
   297  215 B W  E     -M  309   0F  45  582    8  FWWTWFWFWWW WWWWWWWWWWWWWWWWWWWWWW WWWWWWFWWWW WWWWWWWWWWWFWWWWWWWWWWW
   298  216 B G        -     0   0   26  582    0  GGGGGGGGGGG GgGgGGGGGGGGGGGGGGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGG
   299  217 B E  S    S-     0   0   25  577   90  VYYFKVIYAVD YqYrYYIYYRHDAASIYDYYYV YYYIYYDIYYY YAQYRRYEKYYDEKKYYYYYDYR
   300  218 B G  S    S-     0   0   19  580   15  GGGGGGGGGGE GEGYGGGGGGGEGGGGGGGGGG GGGGGGGGGGG GGGGGGGGEGGGGGGGGGGGGGG
   301  220 B k  S    S-     0   0    7  582    2  CCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCC
   302  221 B A  S    S+     0   0    4  581   17  AAAGGAAAAGA AAAIAAAAAAAAAAAAAAAAAA AAAGAAGAAAA AAAAAAAAAAAGAGGAAAAAAAA
   303  222 B R    >   -     0   0  105  578   74  REEVQRLDQEL ESQSQQQQMQWLQQKQMQQQLR QQERLEQLQLE QQQQLLQRQQQQGQQQQQQRQQL
   304  223 B K  T 3  S+     0   0  152  578   65  HRRKEKPSKKR KVKKKKKRKPKPKKAKKKKKKK ERRIKRPPRKK KKPPPPRPRRKPKEEKRRKKKKS
   305  223AB G  T 3  S+     0   0   26  582   58  GDDDGNYKGRN NGNNGNNNGNNNGGNNGNNNDD NDDGGNGGNDD GGNNNNNNNNNGNGGGNNNNNND
   306  224 B K    <   -     0   0   43  582   85  YHHFVNYFKLK HFRSRRYYKYRKKKRKKKKKSK LHHLRHVYRNH RKYLYYYYYYRVKVVKKYRRKRA
   307  225 B Y        -     0   0   33  582   49  PPPPPPPPPPP PPPPPPPPPPPPPPPPPPPPPP PPPPPPPPPPP PPPPPPPPPPPPPPPPPPPPPPP
   308  226 B G  E     -K  263   0F   4  580    2  GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGG
   309  227 B I  E     -KM 262 297F   6  581   10  VVVVVIVVVVV VVVVVVVVVVVVVVVVVVVVVV VVVVVVVVVVV VVVVVVVVVVVVVVVVVVVVVVV
   310  228 B Y  E     -KM 261 295F   1  581    2  YYYYYYYYYYY YYYYYYYYYYYYYYYYYYYYYY YYYYYYYYYYY YYYYYYYYYYYYYYYYYYYYYYY
   311  229 B T  E     -KM 260 294F   2  581   40  TAATTATTTTT STTATTTTTVTTTTGTTTTTTT TAATTTTTTTS TTVSTTTTATTTTTTTATTTTTA
   312  230 B K  E >   - M   0 293F  21  581   40  DKKSNKKRRKR KRKKKKRKKKKRKKNRKKKKRN KKKDKKRRKRK KKKRKKKRRKKRQNNKKKKKKKK
   313  231 B V  G >  S+     0   0    1  581    8  VVVIVVVVVVV VVVVVVVVVLVVVVVVVVVVVV VVVVVVVVVVV VVVIVVVVVVVVVVVVVVVVVVV
   314  232 B T  G 3  S+     0   0    2  579   72  RCCAASRSCST CPSCCYCCCCYTCCTCCYCCCE CCCSCCSCCCC CCCGCCCTTCYSTAACCCYYHYC
   315  233 B A  G <  S+     0   0   29  579   80  RVVHHANNKNY VANNNNKNNENYNNMNNNNNNE NIIFNNRNNNV QNETNNNRKNNRNHHNNNNNNNN
   316  234 B F  S <> S+     0   0    7  575   36  QLL YAYYYYY QIYYYYYYYFYYYYFFYYYYYM YFFYYYFYYYQ FYFFYYFYFFYFYYYYFYYYYYY
   317  235 B L  H  > S+     0   0   23  573   81  ISS RANVVLR TRVLVVVVILVRVVTVVVVVVL VNTKVNQINVT VVLRNNVLVVVQNRRVTVVVLLL
   318  236 B K  H  > S+     0   0  116  572   68  PGG KKRDSLD EQDDSDDSSYDDSSDDRDSSDN NEDDQDTDSDE DSYSAATNATDTKKKDTSDDAAD
   319  237 B W  H  > S+     0   0   26  572    1  WWW WWWWWWW WWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWW WWWFWWWWWWWWWWWWWWWWWWW
   320  238 B I  H  X S+     0   0    1  569   12  MVV IIIIIII LVIIIIIIIIIIIIIIIIIIII ILLIILIIIIL IIIIIIIIAIIIIIIIIIIIIIM
   321  239 B D  H  < S+     0   0   66  541   72  KRR DKDKQ   HTQKRREQQEK RRYQQKRREH QEEVQI NSQH QQESAAQKRQK  DDQRQRRKKQ
   322  240 B R  H >< S+     0   0  136  528   71  NDD TSWRQ   NEQNNDSNQDD QQREDDQQNT DNSRQS ENKS EQDQQQSSSSD  TTENNDDEDD
   323  241 B S  H >< S+     0   0    6  495   71  VTT HTITT   T TIITTTTVT TTQTTTTTTV TTTHTT TTTT TTT TTTNNTT  HHTTTTTTTI
   324  242 B M  T 3< S+     0   0   25  452   39  FMM M ILI   M ITIIIIIMI IIMMMIIIIV IMMLII MMIM IIL IIIT II  MMIMIIIIII
   325  243 B K  T <  S+     0   0  153  418   69  SAA K SAA   A AERAAAEAA AAKAAAAADE AAASAS NAAA AAA AASR SA  KKANAAAAAE
   326  244 B T    <         0   0   51  369   66  ENN E TNA   T ANTAAANAA AA ASAAAAT ASN AS ANAS AAA AASD SA  EEASAAAAAN
   327  245 B R              0   0  197  260   47      N E N     NNSNNN NN NN NNNNNNK N N NN NNNN NNN NNN  NN  NNNNNNNNNN
## ALIGNMENTS  631 -  700
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....4....:....5....:....6....:....7....:....8....:....9....:....0
     1   49 A Q              0   0  101  253   29                        E   D                              D            
     2   50 A a    >   +     0   0   22  341    0                   C    C   C                      C       C        C   
     3   51 A E  T 3  S+     0   0  187  342   77                   T    A   T                      A       V        A   
     4   52 A T  T 3  S-     0   0  105  342   54                   K    S   Q                      S       N        S   
     5   53 A S    <   +     0   0   89  342   62                   N    D   S                      Q       D        Q   
     6   54 A P        +     0   0   10  343   18                   P    P   P                      P       P        P   
     7   55 A b        -     0   0   18  344    0                   C    C   C                      C       C        C   
     8   56 A Q  S    S+     0   0   92  343   70                   Q    Q   Q                      L       Q        L   
     9   57 A N  S    S-     0   0   63  303   24                   N    N   N                      N       N        N   
    10   58 A Q  S    S-     0   0  152  336   48                   G    G   G                      N       E        N   
    11   59 A G        -     0   0   16  344   17                   G    A   G                      G       G        G   
    12   60 A K  E     -A   23   0A 117  344   75                   T    T   N                      S       A        S   
    13   61 A a  E     -A   22   0A  45  344    0                   C    C   C                      C       C        C   
    14   62 A K  E     -A   21   0A 155  344   82                   i    N   T                      Q       L        Q   
    15   63 A X  E     +A   20   0A 120  302   29                   s    D   D                      D       D        D   
    16   64 A G        -     0   0   44  341   74                   G    G   L                      S       G        S   
    17   65 A L  S    S-     0   0  152  342   69                   P    L   I                      I       L        I   
    18   66 A G  S    S+     0   0   67  343   62                   S    N   N                      R       N        R   
    19   67 A E        -     0   0  119  329   61                   V    N   D                      G       S        G   
    20   68 A Y  E     -A   15   0A  37  342    9                   Y    Y   Y                      Y       Y        Y   
    21   69 A T  E     -A   14   0A  71  343   83                   T    T   T                      A       T        A   
    22   70 A b  E     -A   13   0A  20  343    0                   C    C   C                      C       C        C   
    23   71 A T  E     -A   12   0A  85  344   80                   T    A   T                      T       Q        T   
    24   72 A c        -     0   0   44  344    1                   C    C   C                      C       C        C   
    25   73 A L    >   -     0   0   62  344   86                   T    I   P                      A       T        A   
    26   74 A E  T 3  S+     0   0  177  344   74                   P    S   N                      P       D        P   
    27   75 A G  T 3  S+     0   0   29  344   24                   G    G   G                      G       G        G   
    28   76 A F  E <   +B   36   0B  40  343   16                   V    F   Y                      Y       W        Y   
    29   77 A E  E     +B   35   0B  74  343   63                   T    T   T                      E       E        E   
    30   78 A G  S >  S-     0   0   32  343    1                   G    G   G                      G       G        G   
    31   79 A K  T 3  S+     0   0  156  343   72                   A    T   K                      P       S        P   
    32   80 A N  T 3  S-     0   0   33  343   62                   N    N   N                      N       N        N   
    33   81 A c  S <  S+     0   0    1  344    0                   C    C   C                      C       C        C   
    34   82 A E        +     0   0   87  342   30                   e    E   l                      a       E        a   
    35   83 A L  E    S-B   29   0B  96  289   42                   v    .   l                      l       .        l   
    36   84 A F  E     -B   28   0B 139  292   93                   A    .   T                      R       .        R   
    37   85 A T        -     0   0   44   76   76                   .    .   .                      .       .        .   
    38   86 A R        +     0   0   57  101   88                   .    .   G                      .       .        .   
    39   87 A K        +     0   0   96  140   78                   .    .   S                      .       .        .   
    40   88 A L        -     0   0   91  168   91                   .    .   L                      .       .        .   
    41   89 A d  S  > S+     0   0   15  238   19                   .    .   C                      .       .        .   
    42   90 A S  T  4 S+     0   0   98  244   86                   .    .   E                      .       .        .   
    43   91 A L  T >4 S-     0   0  120  274   90                   .    T   T                      .       N        .   
    44   92 A D  G >4 S-     0   0  107  297   62                   .    N   N                      .       D        .   
    45   93 A N  G >< S-     0   0    8  315   63                   .    I   I                      L       I        L   
    46   94 A G  G <  S-     0   0    0  316   53                   D    D   D                      D       D        D   
    47   95 A D  G <  S+     0   0   44  344   60                   Q    E   D                      G       E        G   
    48   96 A e    <   -     0   0    0  344    1                   C    C   C                      C       C        C   
    49   97 A D  S    S-     0   0   59  344   73                   S    A   A                      Q       S        Q   
    50   98 A Q  S    S+     0   0    2  344   62                   s    s   s                      H       s        H   
    51   99 A F  E     -C   62   0C   4  344   77                   e    t   s                      F       i        F   
    52  100 A d  E     +C   61   0C  10  344    0                   C    C   C                      C       C        C   
    53  101 A H  E     -C   60   0C  68  344   86                   K    N   I                      Y       Q        Y   
    54  102 A E  E     -C   59   0C  92  344   56                   T    D   D                      P       D        P   
    55  103 A E  S    S-     0   0  100  344   81                   a    G   D                      g       E        g   
    56  104 A Q  S    S-     0   0  175  310   77                   .    L   V                      e       E        e   
    57  105 A N  S    S+     0   0  154  307   78                   s    N   N                      .       N        .   
    58  106 A S  S    S-     0   0   58  337   71                   T    N   S                      S       G        S   
    59  107 A V  E     -C   54   0C   7  343   86                   F    Y   F                      Y       Y        Y   
    60  108 A V  E     -C   53   0C  45  344   87                   T    T   T                      T       T        T   
    61  109 A e  E     +C   52   0C   5  344    0                   C    C   C                      C       C        C   
    62  110 A S  E     -C   51   0C  24  344   70                   S    A   V                      S       A        S   
    63  111 A f        -     0   0   23  344    0                   C    C   C                      C       C        C   
    64  112 A A    >   -     0   0    8  344   70                   T    I   I                      A       E        A   
    65  113 A R  T 3  S+     0   0  149  344   83                   A    F   A                      R       D        R   
    66  114 A G  T 3  S+     0   0   24  344   13                   G    G   G                      G       G        G   
    67  115 A Y  E <   -D   78   0D  20  344    7                   F    F   F                      H       W        H   
    68  116 A T  E     -D   77   0D  72  343   81                   T    T   T                      K       T        K   
    69  117 A L  E     -D   76   0D  67  340   68                   G        G                      L       G        L   
    70  118 A A    >   -     0   0   23  340   78                   D        N                      G       T        G   
    71  119 A D  T 3  S+     0   0  175  340   77                   L        L                      Q       H        Q   
    72  120 A N  T 3  S-     0   0   92  340   74                   C        C                      D       C        D   
    73  121 A G  S <  S+     0   0   16  340   56                   D        Q                      R       E        R   
    74  122 A K  S    S+     0   0   71  332   83                   K        T                      R       T        R   
    75  123 A A        -     0   0   22  330   70                   E        N                      S       D        S   
    76  124 A f  E     -D   69   0D  12  300   48                   L        I                      C       I        C   
    77  125 A I  E     -D   68   0D  78  304   82                   Q        Q                      L       A        L   
    78  126 A P  E     -D   67   0D  62  304   56                   P        E                      P       E        P   
    79  127 A T  S    S+     0   0  103  304   79                   C        C                      H       C        H   
    80  128 A G  S    S-     0   0   32  305   75                   V        D                      D       S        D   
    81  129 A P  S    S+     0   0  116  311   78                   P        S                      R       S        R   
    82  130 A Y  S    S+     0   0   59  312   77                   S        N                      C       Q        C   
    83  131 A P    >   -     0   0   17  312   34                   P        P                      A       P        A   
    84  132 A g  T 3  S+     0   0   16  323    2                   C        C                      C       C        C   
    85  133 A G  T 3  S+     0   0    0  295   30                   G                               G       G        G   
    86  134 A K    <   -     0   0   69  294   62                   N                               T       N        T   
    87  135 A Q        -     0   0   37  243   74                                                   L       Q        L   
    88  136 A T        +     0   0    4  220   79                                                           G            
    89  137 A L        +     0   0  105  200   57                                                           I            
    90  138 A E              0   0  104  120   71                                                                        
    91  139 A R              0   0  231   97   28                                                                        
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3  IIIIIIIIIIIIIIIII IIII III IIIIIIIVIIII IIIIIIIII IIIIIII IIIII II III
    94   17 B V  B     -E  271   0E   7  561    9  VIIVVVVVVVVVVIVVV VVVV VVV IVVVVIVVVVIV VVVVAVVIV VVVVVVV VVVIVIVV IVV
    95   18 B G  S    S+     0   0   25  562    6  GGGGGGGGGGGGGGGGG GGGG GGG GGGGGGGGGGGG GGGGGGGGG GGGGGGG GGGGGVGG GGG
    96   19 B G  S    S-     0   0   26  563    0  GGGGGGGGGGGGGGGGG GGGG GGG GGGGGGGGGGGG GGGGGGGGG GGGGGGG GGGGGGGG GGG
    97   20 B Q  E     -F  237   0F  98  564   95  YYYFYYYYYYFYYHYYY QKSR KFY YVVIEQSVYEMEYYWHNYMYAY YYYYYQN FFKEYGTV YHD
    98   21 B E  E     -F  236   0F  80  565   65  TEETETTTSNTETDTPP TVTE DQP EDETDYEQTDEDTSVTNSNTTE TETTTDY EEEETEDA EPD
    99   22 B h        -     0   0    8  565   58  CCCCCCCCCCCCCACVV ATAA TVV CTASAAAACAASCCAASCSCCC CCCCCAA ACACCQAT CIA
   100   23 B K    >   -     0   0  123  564   79  EAAAQTGSAEARENPPP KEPS TEE KSTDPSYVAEETQAKAKAKQAA PPEEGPD DTSVGAST RGE
   101   24 B D  T 3  S+     0   0   60  565   85  EKKKAKARREKKEIEII VHPP III PNIIPQPQALVDERPPFRKKKH ERNNKAA IPFPAGLI PII
   102   25 B G  T 3  S+     0   0    0  565   73  NNNNHNNNSNNNNIHSS EGGN EAS HYKKGGGGNGGAHSYNGSGDNH HRSSNGN EYGHNQGQ HET
   103   26 B E  S <  S+     0   0   36  565   67  SSSASSTSASASSDSEE DAAS NDQ SFENAMSSSEEESASSSAESSS SSLLAFE DSKSTAED SQE
   104   27 B h    >   +     0   0    4  565   91  LVVVQIVVAVVAVYVVV WWWW HFV QAYLWFWWVYFWVAFIWAWVVQ VVPPVWW FEWQVIFL QAY
   105   28 B P  T 3   +     0   0    0  567    9  PPPPPPPPPPPSPPPPP PPPP PPP PKPPPPPPPPPPPPPKPPPPPP PPYYPPP PPPPPPPP PPP
   106   29 B W  T 3  S+     0   0    5  568   27  YYYYHYYYYYYYYWYWW WWWW YYW WYYWWWWWYHWWYYWYWYWYYW YYQQYWW WHWWYYYW WYY
   107   30 B Q  E <   -N  122   0G   7  569   24  QMMQTQQQQQQQQQQqq QQQQ QQq QvQQMQQQQQQVQQtIqQQQIQ QQVVQQq QQqQQQqq QqQ
   108   31 B A  E     -NO 121 146G   1  559   47  VVVVVVVVVVVAVIVll AVVV VVs AsVVVVVAVIVVVVsVtVIVVV VV..VVr VVtVVAka AvI
   109   32 B L  E     -NO 120 145G   3  567   65  SSSSSSSSSSSSSSSYY GQMD SSL YSSSSSDSSSSSSSGSSSSSSS SSSSSSW SSSASRFI FQA
   110   33 B L  E     -NO 119 144G   0  570   11  LLLLLLLLLLLLLFLLL LILL LLL LTLILLVLLLIILLLLFLLLLL LLLLLLF ILFLLLLL LVL
   111   34 B I  E     -NO 117 143G   0  570   81  NNNNNNNNNNNQNQNGG KGIV RQY VSQQQQRKNRQQNNLQFNNNNN NNNNNQI QNFYNQGR TKL
   112   35 B N  E >   - O   0 142G  30  570   88  SIIASSSSSSASSHSKK KYYV RRS DSRRHnRLSFAKASYSGSYAAI SASSSTY RVGYSYFN DsS
   113   36 B E  T 3  S+     0   0   63  113   77  ................. GKN. ... .....a.........TF..... ....... ..F..... .s.
   114   37 B E  T 3  S-     0   0  136  242   76  .............R... LTSN RN. ...WPQRN.QRN...KS..... ....... G.S..S.. .S.
   115   38 B N  S <  S+     0   0   84  543   52  GGGGGGGGGGGGGLG.. DMGG GS. .AHGEGGGGGNGGG.GSGKGGG GGGGGSH GGSFGASG .QG
   116   39 B E        -     0   0  100  561   93  SYYYYYYYYYYYSHY.. DGRT TRG NYYNLGGRYRETSC.QTCNYYY YYKKYSF YYTSYGFA NRG
   117   40 B G  E     +N  111   0G  14  572   55  HHHHHHHHHHHHHHH.. THQR HHN KAHHGSHHHHHHHHEHHHEHHH HHHHHHQ HHHDHSHQ RHS
   118   41 B F  E     +     0   0G  28  581   35  FFFFFFFFFFFFFFFlf iIFh THy fqMFhhIFFTFHIFSFRFfFFF FFFFFFN FFRfFiFI iIl
   119   42 B i  E     -N  110   0G   0  578    1  CCCCCCCCCCCCCCCcc cCCc CCc ccCCccCCCCCCCCCCCCcCCC CCCCCCC CCCcCcCC cCc
   120   43 B G  E     -N  109   0G   1  581    2  GGGGGGGGGGGGGGGGG GGGG GGG GGGGGGGGGGGAGGGGGGGGGG GGGGGGG GGGGGGGG GGG
   121   44 B G  E     -N  108   0G   0  581    9  GGGGGGGGGGGGGGGAA GGGG GGA GGGGGGAGGGGGGGGGGGGGGG GGGGGGG GGGGGGAG GGG
   122   45 B T  E     -NP 107 130G   0  581   43  SSSSSSSSSSSSSFSVV SSTS ASV SSSSTSAQSSSTSSSSASSSSS SSSSSST SSAVSSSI STS
   123   46 B I  E     + P   0 129G   0  581   23  LLLLLLLLLLLLLLLII LILL III LVLILLLILIILLLLLLLLLLL LLLLLLL ILVLLLIL LII
   124   47 B L        -     0   0    6  581   27  IIIIVIIIIIIIIIIYY IVVI LIY ILILIFIIILILIIIVLIIIII IIIIIII YILIIIYV ILI
   125   48 B S  S    S-     0   0   22  581   57  SSSNNSNNSNNSSSNSS NNTD NDS NDANSNHASHNTTSsHNSTNNN NSNNSNH SNNNNSNA NSS
   126   49 B E  S    S+     0   0   99  581   62  ESSSESSSSESSEDSED RSPK EAD NSEEENRPDSKSDSsRESDNND SSEESNS PQEKSEEP EAS
   127   50 B F  S    S+     0   0   42  581   82  QTTQNQQQQQQTQTQKK EQEQ NGK RRGNDEQNQLWRQQDYLQSQQR QQQQQQC ENNWQTNR RDK
   128   51 B Y  E     - Q   0 185G   7  581   33  WWWWWWWWWWWWWWWII WWWW TWI WTWIWWWWWYWWWWTWWWWWWW WWWWWWW IWWWWYYV WKY
   129   52 B I  E     -PQ 123 184G   0  581   14  VAAVVVVVVVVVVVVII VIVV IIV VIVIVVVIVIIVVVIVVVVVVI VVVVVVV IVIVVVAV AVV
   130   53 B L  E     +PQ 122 183G   0  581   28  VVVVVLVVLVVVVVLII VVIV LLI VVLVVILVVLVVLLLLILMVVV LVVVVLL VVALVLIL VLV
   131   54 B T  E     - Q   0 182G   0  581   43  SSSSSSSSSSSSSTSTT TTTT TTT STTTTTSTSTTTSSTTTSASSS SSSSSTT TSTTSCTT STT
   132   55 B A    >>  -     0   0    0  581    2  AAAAAAAAAAAAAAAAA AAAS AAA AAAAAAAAAAAAAAAAAAAAAA AAAAAAA AAAAAAAA AAA
   133   56 B A  G >4 S+     0   0    0  581    8  AAAAAAAAAGAAGAAAA AAAG AAA AAAAAGAAAAAAAASAGAAAAA AAAAAAA AAGAAAGA AAG
   134   57 B H  G >4 S+     0   0    7  581    0  HHHHHHHHHHHHHHHHH HHHH HHH HHHHHHHHHHHHHHHHHHHHHH HHHHHHH HHHHHHHH HHH
   135   58 B i  G X4 S+     0   0    0  581    2  CCCCCCCCCCCCCCCCC CCCC CCC CCCCCCCCCCCCCCCCCCCCCC CCCCCCC CCCCCCCC CCC
   136   59 B L  G << S+     0   0   31  581   65  YYYYYYYYYYYYYIYVV IVVF VTL TVVLFVFFYVFFYYVNVYFYYW YYYYYFF LYVNYQVV NIT
   137   60 B Y  G <  S+     0   0  109  581   87  KQQKKKKKKKKKKYKDD DTVD YED FYEQNDQDKYSKHKRIEKDKQQ KKKKKPS EQDQKGYT FED
   138   61 B Q  S <  S+     0   0   95  581   78  TSSSSSSSSSSSPeSnn rtdq ynr SnsgdgsgSgsgLSvGdSsSAN STSSSSq kSdSSsgl QEg
   139   61AB A        -     0   0   16  352   75  .............t.dd dspl pad Ravawplp.ipp..aAv.v..P .....Rt a.t..wpl QGa
   140   62 B K  S    S-     0   0  172  366   75  .............E.TT PRAS STV NEDKRASS.DTS..NES.S..F .....ST S.S..NSA DTS
   141   63 B R  S    S-     0   0  162  570   78  RSSRRSGRSRRRHNRLL PYSY EIL KNADTMMQRLDQQSAHQSYRSA RRRRRQS QRQNGTGT RKS
   142   64 B F  E     -O  112   0G  36  577   54  IIIIVIIIIIIIILIYY ITIY FYY LFLMLWYWIFLFLIIMIIYIIQ IIMMILY LIILIWLL LYL
   143   65 B K  E     -O  111   0G  67  577   78  QQQQEQQQQQQQQNQSS RMQE SGS SLRKYRTRQTSSQQTMRQTQQI QQQQQCW RERQQKNN SAS
   144   66 B V  E     -OR 110 161G   0  577   16  VLLVVVVVVVVVVIVVV VYVF IVV VVVVAVFVVVVVVVVIMVVVVA VVVVVVI VVIVVIIV VVI
   145   67 B R  E     -OR 109 160G  40  577   53  RRRRRKRRKRRRRRRKK IARR RRR HVRRVRISRVVLHKAVRKYRRI RRRRQIR RRRLRVVR RRR
   146   68 B V  E     +OR 108 159G   1  578   43  LLLLLLLLLLLLLVLVV LFLL AAV LAIVVMLLLALLLLAAMLLLLL LLLLLFL VLVLLLAT LAA
   147   69 B G  S    S+     0   0    9  578   14  GGGGGGGGGGGGGGGGG GSGG GGG GGGGGGGGGGGGGGGGGGGGGG GGGGGAG GGGGGGGG GGG
   148   70 B D        +     0   0   11  579   58  EEEEEEEEEEEEESESS EEAE SSS RTASELKSESSAEEVDEEAEEE EEEEKRD GEEAELES RSS
   149   71 B R  S    S+     0   0   24  579   73  HHHHHHDYYHHHHSYVV SHQH TSK HDTSHAYYNVNWHYFYFYYYHH YHHHHCH SHYHDYLT HNT
   150   72 B N  B >   -T  234   0H  18  579   65  NNNNHNNNNNNNNENWW DQNR LEY SNRYTSHRNLDQNNNIDNQNNH NNNNNMQ YDDNNQDT NNY
   151   73 B T  T 3  S+     0   0   56  579   79  IIIIILIILIIIIWIKK VLRE RHK LRKWLLERILLLILIVFLLIII ILIILCT WIFRIAMH LHH
   152   74 B E  T 3  S-     0   0  119  579   84  KAAAGANAAEAAESDTT TYTS NAF QAENSQFTDSSGDAKNSASEAW DAEEETS DSSTNSSN VGD
   153   75 B Q  S <  S-     0   0  130  578   86  VVVLQSVVAVLVVAVLL KQST ETD TGISDYATVQSNEAKTSAAVLN VVVVTYK EVSKVNVA TRK
   154   76 B E        +     0   0  165  578   85  LNNNNQVSQLNNLKQGG HLPT GGG NMDEqYTTLGSPIQlFvQLVSN ENLLTvI ENvPAaNG AGG
   155   77 B E        -     0   0   93  438   29  EEEEEEEEDEEEE.E.. EDDE ... ED..nEDDE...EDeEeDDEEG EEEEEqD .EeTEeE. E..
   156   78 B G  S    S+     0   0   46  547   33  GGGGNGGGGGGGGGDGG GGPG GGG NGGGENASGG.GGGPGPGNGGG DGGGSDG GGRGGAGG NGG
   157   79 B G  S    S+     0   0   47  555   76  NTTTTTNGSNTTNKSQQ NSsW QQq TLIFqGTTDDSpASHTySSNTT STNNThT STlHNGST TQT
   158   80 B E        -     0   0   37  444   33  EEEEEEEEEEEEE.E.. EEeE ..v G...gEEQE.LsEE.EfETEEE EEEEQnE .EyKEVE. E..
   159   81 B A  E     -R  146   0G  27  457   60  QQQQQQQQQQQQQ.V.. IQME ..K Q...TQQQQ.EQQQ.QVQVQQQ VQQQQVQ .QVQQQQ. Q..
   160   82 B V  E     -R  145   0G  71  557   81  FFFFFTFFTFFFFLVHH HNRI LLV KVLLTEVDFVIEFT.YETSFFY VLFFLSD LFEYFTTR RLV
   161   83 B H  E     -R  144   0G  14  567   77  IIIIIIIIIIIIIHRAA RIII IVA IVVCQFFLIHKVVI.ARIRIIM RIIIIQF LIRTIFIV IVV
   162   84 B E        -     0   0   90  569   77  NSSDDSSNSNDDNDSRR DPSK TTG KRKDPTRSDEGGDS.KGSGNNP SDDDNTK TDGYSNAA END
   163   85 B V  E     -S  186   0G  27  574   64  ASSSSSAASASSAVSVV VIIG AVI VVIVIVSVAIIIAS.PVSVASV SGAASVI VSIAAVVV AVV
   164   86 B E  E    S+     0   0G  70  575   73  ASSQSSSASAQVAKSAA AERE SKR EERVGTAVAATAAS.HNSKAAD SAEEATQ SSTASNSS ELE
   165   87 B V  E     -S  185   0G  13  576   72  KRRKRKKKKKKKKRVVV QGSK EAK KQTSNKVRKKSWKKRRKKKKKA VKKKKTR NRKKKAKS KDA
   166   88 B V  E     -S  184   0G  72  577   45  IVVVVVSIVIVVIYIII IIIL IVH ILVFLVIIIIIVMVVVKVIIVI IMIIVVL FVKISQIR MYI
   167   89 B I  E     +S  183   0G  27  578   45  IIIIIIIIIIIIIIIRR CVHF FHE IIHKQIIIITVQIITVIIIIIY VIIIIII KIVCITII IRT
   168   90 B K  E     -S  182   0G  68  578   82  RRRKRRVRRRKMRTRKK IVNI ISD PPRIEMKMRYLSPRSTVRKRRW RRLLRVR IRVPVPLL PVV
   169   91 B H    >   -     0   0   19  579   14  HHHHHHHHHHHHHHHHH HHHH HHY FHHHNHHHHHHHHHKHHHNHHH HHHHHHH HHHHHNHH FHH
   170   92 B N  T 3  S+     0   0  156  579   60  PQQPPSPPSPPPPPPEE PPPP PPR PEPELPHEPKKPPSvPPSPPPQ PPPPSPT EPPEPSEA PPP
   171   93 B R  T 3  S+     0   0  150  576   74  KSSNQGSRGQNSKQKDD DSDK WEE KNKGQSDSKKDVDGaLKGNNSS KQNNGNF KQKESDNQ KEE
   172   94 B F    <   -     0   0   24  579    5  YYYYYYYYYYYYYYYYY YYYY YYY YYYYAYYYYYFYYYYYYYFYYY YYYYYYN YYYFYYLY YFY
   173   95 B T     >  -     0   0   56  579   67  NNNNSNNNNDNNNNSll HNgk DNK NNDDatDDNIQsNNVNNNLNNN SNNNSNV DDNDNDDq NSN
   174   96 B K  T  4 S+     0   0  145  525   79  RSSSSASAARSSRISaa ..kg DSK DAAQgaWRSARkSSSRFS.SSY SSSSPS. .SFWSS.c D.A
   175   97 B E  T  4 S+     0   0  174  533   92  DYYRYYNNNKRRITIII ..RL WGI RTRRSMRIWAPEWNDSFN.ARQ LYPPYED .WFSNA.E R.N
   176   98 B T  T  4 S-     0   0   44  561   58  TTTNNTTTTTNNTTTLL EDSD TNY PTISTGTRTFTGTTNTTT.TTT TNNNTTS ANTTTT.T PDT
   177   99 B Y    ><  +     0   0   60  566   66  LLLLILLILLLLLMLFF ILSY LYF HTILWFSILKMSFLFNYLYITL LLLLLSN MIFYLTYC HYV
   178  100 B D  T 3   +     0   0   25  578   38  DDDDDDNDNNDDNDNNN kDNt DDF NDDEGpDNDGNRDNDNENeDDD NDNNDDD iDENNDds NyD
   179  101 B F  T 3  S+     0   0   21  558   68  NNNNNNNNNNNNNNN.. nY.y WFN NNYNKnNNNYNANNdAYNgNNY NNNNNNN yNYNNNny NnN
   180  102 B D    <   +     0   0    1  577    0  DDDDDDDDDDDDDDDDD DDDD DDD DDDDDDDDDDDDDDdDDDDDDD DDDDDDD DDDDDDDD DDD
   181  103 B I        +     0   0    0  579   14  IIIIVIIIIIIIIIIII LIII IFI IIFVIVIVIVIIIIIILIIIII IIIIIII VILIIVII IVI
   182  104 B A  E     -QS 131 168G   0  579   60  MMMMMMMMMMMMMAMAA AAAA ASA MAAAAAAALAAAMMAMAMAMMM MMMMMAA AMAMMMSA MAS
   183  105 B V  E     -QS 130 167G   0  580   15  LLLLLLLLLLLLLLLVV LLLL ILV LLVILLLLLILLLLVLLLLLLL LLLLLLL LLLLLLLV LMI
   184  106 B L  E     -QS 129 166G   0  581   30  IIIIIIIIIIIIILIMM ILLV LLI IVLMLMIMILLVIILIVIMIIM IIIIILI LIVLILLL ILL
   185  107 B R  E     -QS 128 165G  40  581   42  KKKKKKKKKKKKKEKRR RKRK KER KIQKRKKKKKLRKKRKRKEKKK KKKKKQE KQRKKRKH KRE
   186  108 B L  E     - S   0 163G   0  581   17  LLLLLLLLLLLLLLLLL LLLL LLL LVLLLLLLLLLLLLLLLLLLLL LLLLLLL LLLLLLLL LLL
   187  109 B K  S    S+     0   0  101  581   69  SSSSSSKSSSSSSAAVV RRSK EGA KSAAANSSSKDEKSKRESESAA ASKKASK SSEAKDAA KEA
   188  110 B T  S    S-     0   0   82  582   74  SQQTTKSSKSTKTLSDD TQRR QED KPETARTGSTSHLKVAEKTSSH SRTTTSR SRTSSETA QRE
   189  111 B P        -     0   0   48  582   39  PPPTPAAPARTPPPASS pPPP NAS PPyKPPPNPPPSPAEPPAPAPP APPPPPi KPPQASPN PHE
   190  112 B I        -     0   0    4  532   62  AAAAAAAAAAAAAVVLL tITA LVL V.tLAAAAAIIVAA.MIAVAAA VAAAAVa LALAAALA ALL
   191  113 B T        -     0   0   95  537   72  VTTRTTSTTVRSVDEII TTIV EQI T.NTTTTQVTTRTT.VTTTTSI ETVVTNI TTSDSTTN TFQ
   192  114 B F        +     0   0   56  580   32  ILLLLLLLLILLILYFF FFLF LFF FLVFIVLYLFFFLLILFLFILL YLLLLFI YLFILLFI LFF
   193  115 B R  B >   -U  196   0I  52  581   64  NNNSNNNNNNSNNNSNN TNTY GGN NPtSNSTNNDSSNNqNQNTNNN SNNNNTN GNANNTNS NSG
   194  116 B M  T 3  S+     0   0   29  564   77  ASSAQSSSSAASAQAAA KAHK PET K.aSRNPNSEGESSeKPSPSSD ASSSKNE ASPTSSN. R.D
   195  117 B N  T 3  S+     0   0   13  572   89  RYYNYYRRYRNYHSDDD HYRR AGN Y.FRRYYYRTLRKYYYNYYRYF DDRRAYV TYHRRSNP Y.G
   196  118 B V  B <   +U  193   0I   0  574   26  VVVIVVVVVVIVVVIVV VVIV VVV V.VIVVVVVKKIVVIVIVIVVV VVVVVIV VVIVVVVA V.I
   197  119 B A        -     0   0    1  576   81  SKKQQNASNSQSSRQRR RSNH QQR K.KRANQSSQELSNSSANLSKK QQGGQTK KQSAAAAA KRK
   198  120 B P        -     0   0    8  576   54  TTTSPTSATTSTTPPPP PQLS KPP P.LNPNPPTPPPTTPLPTPTAP PTTTTPP NAPPSLPT PSA
   199  121 B A        -     0   0    2  577   39  IVVVVVIIVIVVIAIII VVAV III I.PILIVILIIVVVVAIVVIVV IVIIIVA IVIIIVII IVI
   200  122 B g  B     -g  290   0F   1  578   67  SSSPAPSAPSPASKAPP CCCC DVP R.KPCCCCAACCSPCPCPCSSA ASSSPCC EACPSSAA PAD
   201  123 B L        -     0   0   27  580    5  LLLLLLLLLLLLLLLLL LLML LLL L.LLLLLLLLMLLLLLLLLLLL LLLLLLL LLLLLLLL LLL
   202  124 B P        -     0   0    7  581   31  PPPPPPPPPPPPPPPAA PPPP PVA PPNAPPPPPPPPPPPPPPPPPP PPPPPSP APPAPPPW PIP
   203  124AB E     >  -     0   0   92  580   75  TSSSSTTKTTSSTVSDD TQNE EED KTENDDQTSKRDQTKRATSRST SSKKTAT KRASTTAD NGS
   204  125 B R  H  > S+     0   0  109  580   79  AGGARSSSSAASAASSS SADK ADS KEDKSRAKAEKASSQQMSQSSA ARTTSTS ESSYSQQD KMS
   205  126 B D  H  > S+     0   0  124  580   85  PCCCCCCCCPCCPGCAA AATS TEE CQIQDDDDCDPSCCNGDCECCC CCCCCNP TCDLCSGN CAS
   206  127 B W  H  >>S+     0   0    4  580   87  PAAAAVAPVPAAPQAPP TLVW LPP PPAPLAPVATSVPVQTEVVAAA APAAVSN PAEVATHT PYS
   207  128 B A  I  X>S+     0   0    0  580   75  AGGSSASATASSAEKAA PLHS KSA SPDGSSKPPMPRSTKGSTQAAA KEPPATQ PPLASSTA SSL
   208  129 B E  I  <5S+     0   0   75  581   83  AAAAATAAATASAIAAA DAFP IDA VVGDLVAAAGSLAALVLALTAP AAAATFF DALDATAF AEP
   209  130 B S  I  <5S+     0   0   70  582   65  GGGGGGGGGGGGGPGGG LGPP QEG GGTNPGGGGGVSGGPVIGAGGG GDGGGYP NGINGSTA GYS
   210  131 B T  I  <5S+     0   0   18  104   77  ................. .... ... .A.................... ....... ........ ...
   211  131AB L  I ><  S-     0   0  119  478   80  stts.S.ssss.sysGG GGsA yRG RqQ.VsT.sTEGfs.lSsgsa. sassSGq e.Ssns.S RLt
   227  146 B E  T 3  S+     0   0   47  513   76  FSSSMSSISSS.SVNII EESE YSL TES.EQQGSPDVGS.GESISS. NNFFSVS N.EPPS.E TYE
   228  147 B K  T 3  S+     0   0  169  537   69  GGGGSGGGGGG.GGGLL NSGN QLF ASV.PYGSGFKPFGSGGGPGG. GGGGGSS Y.GQRG.G ADG
   229  149 B G  S <  S-     0   0   29  548   67  ASSTNSTQSAT.AGYWW ESGE GEG AGH.TSTGVGTLESGGGSLTS. YDAASLT P.GEAG.G DSG
   230  150 B R        -     0   0  213  557   86  DNNNVLSNLDNNDYNLL DPSG PEI GLEFGPGLNQSPSLKQTLSNNF NNEENPP Y.TTST.A GSN
   231  151 B Q  B     -V  224   0J  79  563   93  YYYYSYYYYYYYYNYQQ LGQY SSS SSSIPLGLYIMHPYPALYNYYN YFYYYAY M.LYYI.G ILV
   232  152 B S        -     0   0   14  569   51  PPPPGPPPPPPPPEPPP SSPS TRP ASTPSSDSPPKPSPSPPPPPPP PPPPPPT P.PPPSPS ASS
   233  153 B T  S    S+     0   0   48  570   73  DDDDDDDDDDDDDYELI TNED NQS SNEADADTEDTQSDSFSDKDNF EDDDDQR V.SDDDDV SDP
   234  154 B R  B    S-T  150   0H 102  570   86  ERRLKNVVVELTETLSS QVAV HFF VKVQVTVYLHDTVVKTMVTLLN LRVVQTL Q.VNVYVT TRN
   235  155 B L        -     0   0    3  578    3  LLLLLLLLLLLLLLLLL LLLL LLL LLLLLLLLLLLLLLLLLLLLLL LLLLLLL L.LLLLLL LLL
   236  156 B K  E     -FH  98 221F  31  578   51  KMMQQQKQQQQRQQQLL RQNR QRL QQRRQKKMQQMQQQRRQQQQQQ QQQQQQK R.QKQMQR QQQ
   237  157 B M  E     -FH  97 220F  18  579   94  CCCCCCCCCCCCCVCKK HEQE QAE CQASEWQQCKKKCCQTQCMCCC CCCCCEE S.ECCKKR CGY
   238  158 B L  E     - H   0 219F   4  580   42  LLLLLLLLLLLLLVLTT AAAA VVT LVVVATVALMVLLLVVVLALLV LLLLLVA V.VVLVVV LVV
   239  159 B E  E     - H   0 218F 107  580   72  DNNNQRKKNDNDDTNSS TSVQ SVS NQTKEYLRDMPEDNGTTNEKND KRNNNQT D.SNKETD KSE
   240  160 B V  E     - H   0 217F   0  580   46  AAAAIAAAAAALAIAVV IIVV VVV LVVVVALVAGMVAAIVVAVAAV AQAAAVV V.VIAVIV LIV
   241  161 B P  E     - H   0 216F  34  580   26  PPPPPPPPPPPPPPPKK PPPR PPG PPPKPPPPPITPPPPPPPGPPP PPPPPPA K.PTPNPP PPP
   242  162 B Y  E     -J  263   0F  36  581   45  VIIIIVIIVVIIVTIII VLLL VLL VLTIIILILSIIVVIIIVIIII IILLVIL I.ITIVLV VLV
   243  163 B V  E     -J  262   0F  24  582   35  LLLLLLLLLLLLLVLLL LVRV VVV LVVVVLVMLYMILLLVVLILLL LILLLVI VMVVLVVI LVV
   244  164 B D     >  -     0   0   88  581   58  TSSTSSSSSSTSTNSDD SDTS DND SDNNGDKESEDDSSRSSSSSTS SDSSSGS SSSSSDSG SSS
   245  165 B R  H  > S+     0   0   51  581   79  QDDDDSDDSQDSQIDPP VQRR NRP QSQRTPTWQSWSDSNTNSSDTH DDDDANR RSNNDQDN EHK
   246  166 B N  H  > S+     0   0  105  582   75  ATTSRSSSSASSANQNN SRSD VTN RVTEAGSNAREESSSADSSTAK QRAAART ETDSSDAV KES
   247  167 B S  H  > S+     0   0   48  582   78  EDDQDQSVQKQSKVEVV EAET IEY TQQSRYKKEIKIVQNRKQSAQE EIQQEQD VARVSEEQ VQQ
   248  168 B j  H  X S+     0   0    1  582    2  CCCCCCCCCCCCCCCCC CCCC CCC CCCCCCCCCCCCCCCCCCCCCC CCCCCCC CNCCCCCC CCC
   249  169 B K  H >< S+     0   0   88  582   73  KRRSDSKRSESNKqQKK reEN saR KqqeDsnnEqSsHSPnkSeRSD QKTTSka rekqKGrR Kss
   250  170 B L  H 3< S+     0   0  150  547   89  ANNNNSSNSANSAaE.. nyRA yn. RtyyEisqAv.gKR.maSsKSG ENSSDss yxacS.dN Tyy
   251  171 B S  H 3< S+     0   0   23  578   76  SSSSSAAAASSASIARR YRSS QKR AYDRLWMYSSKAAA.SGATAAS AASSAYV GSGYANYV AAS
   252  172 B S    <<  -     0   0   20  581   83  YYYYYYYYYYYYYTYSS SNYY NDS YYSYLGHMYRAGYY.FRYGYYY YYYYYGY YYRPYRGY YEG
   253  173 B S  S    S+     0   0   79  581   83  PPPPPPPPPPPPPNPYY GLPS FIY KWFGPSDNPQFQPP.NHPGPPP PSPPPAG GPHSPYAG GFF
   254  174 B F  S    S-     0   0  124  581   79  GGGGGGGGGGGGLDGQQ HKGG GLR KRGSFEGGGNPGLGFGEGTGGG GNGGGSS NGEDGGDS SNN
   255  175 B I        -     0   0  100  582   88  KEEEMQQQRKEQKTDYY TPKI SPY IPSSDMSAEDKAQRINYRFKQM DLQQQSS AMFIQSEI INE
   256  176 B I        -     0   0   13  582   16  IIIIIIIIIIIIIIIII IIII IVL IIIIIVIIIILIIIDIIIIIII IFIIIIL IIIIILII IVI
   257  177 B T    >   -     0   0   16  582   36  TTTTTTTSTTTTTTTTT NTSN LTT TSTKTGTTTTTTTTATPTQTTT TTTTTTT GTPTTTFT TTT
   258  178 B Q  T 3  S+     0   0  133  582   68  NNNKDSSSSSKSSNSEE DAAE SEK KEDPTSEDSEKESSDADSETND SEEENDN PDEDSGDT REA
   259  179 B N  T 3  S+     0   0   24  582   61  SNNNANNNNNNNKNNTT KRDR YSA NARSQINKNTNDNNDNINDNNR NNNNNNN TSINNGSR NSS
   260  180 B M  E <   - K   0 311F   2  582   11  MMMMMMMMMMMMMMMMM VMMY HMM MMMMVMMMMMMMMMMMFMMMMM MMMMMMM MMFMMMMT MMM
   261  181 B F  E     - K   0 310F   8  581   34  FFFFFIFMIFFFFFIII IRII LII FLMI.VLIVLLLFIFIMIVIFV IVVVMVF IFLLFMII FFF
   262  182 B j  E     +JK 243 309F   1  582    0  CCCCCCCCCCCCCCCCC CCCC CCC CCCCCCCCCCCCCCCCCCCCCC CCCCCCC CCCCCCCC CCC
   263  183 B A  E     +JK 242 308F   0  582   27  VAAAAVALIVAAVAVAA AAAA AAA AAATAAAAAAAALIAAAIALAA VSAAVAA AAAAALAA AAA
   264  184 B G  S    S-     0   0    3  582   10  GGGGGGGGGGGGGGGAA GGGG GGA GGGYGGGGGFGGGGGGGGGGGG GGGGGGG YGGGGAGG GGG
   265  185 B Y        -     0   0   56  561   58  FFFFYYYYYFFFFLFAA YINY DYA FLL.RYYYFRYYFY.YFYYFFY FFFFFLY .YYNYAVL FQE
   266  185AB D  S    S-     0   0   81  565   84  LLLLLLLMLLLMLILLL EYPP AVL IPR.DDQDLKELLL.RELQLLL LMLLMLM .LEMLSPA IVE
   267  185BB T  S    S+     0   0   76  582   62  EEEAEEEENEAEEgEGG GGEG GeG KEATEHEQELNEENdTENEEEE EAEEEAR AETAEGEQ ReE
   268  186 B K  S    S-     0   0  107  532   32  GGGGGGGGGGGGGgG.. GTGG .g. GGGLGGGGG.EGGGgGGGGGGG GGGGGGG VGGGG.GG GgG
   269  187 B Q  S    S+     0   0  102  537   37  GGGGGGGGGGGGGGG.. KPGG .G. GGGGGQQGGGSQGGGGGGQGGG GGGGGGG GGGGG.GG GGG
   270  188 B E        +     0   0   33  581   54  KKKKKKKKKKKKKKKRR IKVV IKK KKKKIDQKKIFRKKKKRKIKKK KAKKKKV KKQEKKKR KKK
   271  189 B D  B     -E   94   0E   7  582    3  DDDDDDDDDDDDDDDDD DGDD DDD DDDDDDDDDGDDDDDDDDDDDD DSDDDDD DDDDDDDD DDD
   272  190 B A        -     0   0    7  582   42  SSSSSSSSSSSSSSSAA STTS AAS SAAAAATASVAASSSASSASSA SSSSSST ASSTSSSS SSG
   273  191 B k    >   -     0   0    7  582    0  CCCCCCCCCCCCCCCCC CCCC CCC CCCCCCCCCCCCCCCCCCCCCC CCCCCCC CCCCCCCC CCC
   274  192 B Q  T 3  S+     0   0   90  582   25  QQQQQQQQQQQQQSQRR KKQG QQQ QQQQQNDQQMQLQQQKQQQQQQ QQQQQQQ QQQVQQQQ QQQ
   275  193 B G  T 3  S+     0   0    6  582    7  RGGGGGGGGGGGGGGGG GGGG GGG GGGGGGGAGGGGYGGGGGGGGG GGNNGGG GGGGGGGG GGG
   276  194 B D    X   +     0   0    0  582    0  DDDDDDDDDDDDDDDDD DDDD DDD DDDDDDDsDDDDDDDDDDDDDD DDDDDDD DDDDDDDD DDD
   277  195 B S  T 3  S+     0   0   14  582    1  SSSSSSSSSSSSSSSSS SSSS SSS SSSSSSSsSSSSSSSSSSSSSS SSSSSSS SSSSSSSS SSS
   278  196 B G  T 3  S+     0   0    0  582    0  GGGGGGGGGGGGGGGGG GGGG GGG GGGGGGGGGGGGGSGGGSGGGG GGGGGGG GGGGGGGG GGG
   279  197 B G    <   -     0   0    0  582    2  GGGGGGGGGGGGGGGGG GGGG GGG GGGGGGGGGGGGGGGGGGGGGG GGGGGGG GGGGGGGG GGG
   280  198 B P  E     - L   0 294F   1  582    3  PPPPPPPPPPPPPPPPP PPPP PPP PPPPPPPPPPPPPPPPPPPPPP PPPPPPP PPPPPPPP PPP
   281  199 B H  E     -IL 219 293F   0  582   49  VVVVVVVVVVVVVAVLL FLLL LLL VLLLLFLLVLLLVVLLLVLVVM VLVVVLL LVLLVALY VVF
   282  200 B V  E     -IL 218 291F   3  582   27  VVVVVVVVVVVVVVVVV VVVV VVV VVVVMIVVAIVMVVVVQVVVVV AVVVVVL VVQVVVAV VVA
   283  201 B T  E     - L   0 290F   0  582   67  CCCCCCCCCCCCCICSS CCCC YVS CVASCCYCCVCCCCCCICCCCC CCCCCIC VCVCCCAI CMA
   284  202 B R  E     + L   0 289F  99  582   70  NNNNNNSNNNNNNDNGG KEQP GDG GNHGEPPKNRNQNNKWRNNNNN NNNNNKQ GNRNSNSQ KND
   285  203 B F  E >  S- L   0 288F  22  582   70  GGGGGGGGGGGGGGGGG dSHr GGG GNGNasdYGEtVGGLGgGVGGG GGGGGQa EGgGGGDN GGG
   286  204 B K  T 3  S-     0   0   85  206   71  ................. tKGd ... ....dgdS.PdE..N.d.N... .....Nn ..d...T. ...
   287  205 B D  T 3  S+     0   0  108  208   57  ................. SGNG ... ....GSQG.DKD..G.G.N... .....NG ..G...G. ...
   288  206 B T  E <   - L   0 285F   3  218   75  ................. RRQS ... ....HRTK.GIT..T.K.V... .....RR ..R...S. ...
   289  207 B Y  E     - L   0 284F  21  227   50  ................. FWWF ... ....WWWW.PWW..Y.Y.W... .....WY ..Y...T. ...
   290  208 B F  E     -gL 200 283F   0  582   91  QQQQEQKEQQQQQQEQQ IVFV QQQ QQKVFERTQVYLQQVRFQLEQE EQEEEIY AEFEKVYR QYV
   291  209 B V  E     + L   0 282F   1  582   41  LLLLLLLLLLLLLVLLL LLLL VLL LLLLLLLLLVQLVLQVLLQLLL LLLLLQV LLLLLQLL LLL
   292  210 B T  E     +     0   0F   1  582   84  QQQQQQQQQQQQQVQVV HMTT VAV KVWVYNADQVVAQQMYGQFQQQ QQQQQAW VQAHQYAA KVI
   293  211 B G  E     -ML 312 281F   0  582    0  GGGGGGGGGGGGGGGGG GGGG GGG GGGGGGGGGGGGGGGGGGGGGG GGGGGGG GGGGGGGG GGG
   294  212 B I  E     -ML 311 280F   0  582   19  VIIVVIIVIVVVIIIII AVVI IVI VIVIVILIIVIIVIIVIIIVII IVIIIVI VIIIIIII VVI
   295  213 B V  E     +M  310   0F   7  582   14  VVVVVVVVVVVVVVVVV VTTV VVV VVVVTVTVVVIIVVVVIVVVVV VVVVVVV VVITVVVV VVT
   296  214 B S  E     -     0   0F   1  581    0  SSSSSSSSSSSSSSSSS SSSS SSS SSSSSSSSSSSSSSSSSSSSSS SSSSSSS SSSSSSSS SSS
   297  215 B W  E     -M  309   0F  45  582    8  WWWWWWWWWWWWWWWYY WWWW WWF FWWWFWWWWFWWWWFWWWWWWW WWWWWFW WWWWWWWF FWW
   298  216 B G        -     0   0   26  582    0  GGGGGGGGGGGGGGGGG GsGG GGG GGGGGggGGGGGGGGGGGGGGG GGGGGGG GGGgGGGG GGG
   299  217 B E  S    S-     0   0   25  577   90  HYYYYISAIDYYYYIII VnHK YNY NEFMRqvRY.KEVTDNIFYYIQ IYYYLEN EYIyYAYA NYN
   300  218 B G  S    S-     0   0   19  580   15  GGGGGGGGGGGGGSGGG GGGG GDG GGGGGPPDGISGGGGGGGGGGG GDGGGGG GGGVGGGG GGG
   301  220 B k  S    S-     0   0    7  582    2  CCCCCCCCCCCCCCCCC CCCC CCC CCCCCCCCCPCCCCCCCCCCCC CCCCCCC CCCCCCCC CCC
   302  221 B A  S    S+     0   0    4  581   17  AAAAAAAAAAAAAAAAA AAAA AAA AAAAAGAAACGAAAAGAAAAAA AAAAAAA AAAGAAAA AAA
   303  222 B R    >   -     0   0  105  578   74  WQQQEQQQQQQQQDLNN RDFR FKN KRKYRAALQGQELQRDEQEQQQ LMQQQLK YEECQSRR KER
   304  223 B K  T 3  S+     0   0  152  578   65  KRRRRKKKKKRRKPKPP KSAP KPP PPPPPQSAKTKREKKAAKPKRP KQKKEPP PRAPKVAA PPA
   305  223AB G  T 3  S+     0   0   26  582   58  NNDNDGNGGNNNRKGFF GGGN GGF KNEQMYMYNGNDGGDKNGNNNN GGNNGNR GNNNNLGG KKG
   306  224 B K    <   -     0   0   43  582   85  RRRYHYKKYKYKRYYFF QYKY YYF YTYYSKRKRVMRKYHFLYKRYY YHKKYFA FHLKKSYL YYY
   307  225 B Y        -     0   0   33  582   49  PPPPPPPPPPPPPPPPP PAYV PPP PPPPPPPPPPPPPPPPPPPPPP PPPPPPP PPPPPPPP PPP
   308  226 B G  E     -K  263   0F   4  580    2  GGGGGGGGGGGGGGGGG GGGG TGG GGGGGSGGGDGGGGGGGGGGGG GSGGGGG GGGGGGGG GGG
   309  227 B I  E     -KM 262 297F   6  581   10  VVVVVVVVVVVVVIVVV IVVV VVV VVVVAAVIVVIVIVIVVVVVVV VVVVVVV VVVIVVVV VVV
   310  228 B Y  E     -KM 261 295F   1  581    2  YYYYYYYSYYYYYYYYY YYYY YYY YYYYYYYYYYYYYYYYCYYYYY YYYYYYY YYCFYYYY YYY
   311  229 B T  E     -KM 260 294F   2  581   40  TTTTATTPTTTTTTTAA TAAL TSA TASAVTTTTATITTTTTTTTAT TATTTTT TTTATTTA ASS
   312  230 B K  E >   - M   0 293F  21  581   40  KKKKKKKKKKKKKKKNN DDGQ RNN ENRDNRRRKRLSKKKARKKKKK KRRRKRV DKRKKRES EKS
   313  231 B V  G >  S+     0   0    1  581    8  VVVVVVVVVVVVVVVVV IVVV VVV VVVVVVVVVVLLVVVVIVVVVV VVVVVVV VVIVVVVI VVP
   314  232 B T  G 3  S+     0   0    2  579   72  YCCCCCCCCYCCYSCAA KVQT SAA CAAAPTTTCYEACCPSSCQCCC CCCCCSA SCSFCASP CYA
   315  233 B A  G <  S+     0   0   29  579   80  NNNNINNKNNNNNANVV KYQS DYH RHAYTARQNHNANNHKKNYNNS NRNNNQN VIKNNVYG RSY
   316  234 B F  S <> S+     0   0    7  575   36  YYYFFYYYYYFYYFYLL YFLM FVL YFVLMFYFYFYHYYYFFYYYYL YYYYYYY VFFYYFHY YFF
   317  235 B L  H  > S+     0   0   23  573   81  VNNVTVVVVVVRVRVKK LKKM IRK TNRRTKLVVLNRLVVRTVQVNL VNVVVQV RNVLVRVR TRR
   318  236 B K  H  > S+     0   0  116  572   68  DSSTDSSSSKTSDDDPP NDQS EDP KNDYQSQSDDLSNSKRSSDKSP DSDDSTE SDPNSTDA RED
   319  237 B W  H  > S+     0   0   26  572    1  WWWWWWWWWWWWWWWWW WWWF FWW WWWWWWWWWWWWWWWWWWWWWW WWWWWWW WWWWWWWW WWF
   320  238 B I  H  X S+     0   0    1  569   12  IIIILIIIIIIIIIIII IIVI III IIIIIIIIIIIVIIIIIILIII IIIIIII IIIIIIII III
   321  239 B D  H  < S+     0   0   66  541   72  KSSQQQKQKKQSKNQLL DRFN HRL KADTLQQNQH  NK DLKKQQN QSEEQNS TQLSKDKR KQQ
   322  240 B R  H >< S+     0   0  136  528   71  DNNSSSQQTNSSDEENN NQHE EEN SQSSQQENQK  QT QETTESD ETAASTR EQKDQDAQ SSQ
   323  241 B S  H >< S+     0   0    6  495   71  TTTTTTTTTTTTT TAA ITVT H A T  ANTKKTN  TT TNTKTTI TTTTTQN NTNITNNN TL 
   324  242 B M  T 3< S+     0   0   25  452   39  IMMIMIIIMIIMI III VVMI M I I  AIIMMI   IM IVMVIIL IMIIII  AMVIIM   IL 
   325  243 B K  T <  S+     0   0  153  418   69  AAASAAAASASSA AKK KSTS   K A  NGQAAA   AS  TSPAAS ARAAAS  KATQA    A  
   326  244 B T    <         0   0   51  369   66  ANNSSASASASSA A   NTNA     K  DDSASA   ES   S AAS ANQQSS  SS NS    S  
   327  245 B R              0   0  197  260   47  NNNNNNNNNNNNN        N     N   SN NN   NN   N NN   NNNHN     EN    N  
## ALIGNMENTS  701 -  770
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1   49 A Q              0   0  101  253   29                   E  E E     E            E     K  EE Q             E  
     2   50 A a    >   +     0   0   22  341    0                   C  CCC     CC         C CC  C C  CC C   C    C  C CCC
     3   51 A E  T 3  S+     0   0  187  342   77                   K  KSA     AA         F DQ  E A  DD S   E    A  A DSV
     4   52 A T  T 3  S-     0   0  105  342   54                   S  SSS     SQ         L ST  N S  SS D   H    Q  T SSR
     5   53 A S    <   +     0   0   89  342   62                   S  SSS     NN         S NN  N S  NN S   e    S  S NAe
     6   54 A P        +     0   0   10  343   18                   P  PPP     PP         P PP  P P  PP P   pP   P  P PPp
     7   55 A b        -     0   0   18  344    0                   C  CCC     CC         C CC  C C  CC C   CC   C  C CCC
     8   56 A Q  S    S+     0   0   92  343   70                   K  KQQ     QQ         E RQ  L Q  RR Q   QL   Q  R KQQ
     9   57 A N  S    S-     0   0   63  303   24                   N  NNN     HN         N NN  H N  NN .   NN   N  N NNN
    10   58 A Q  S    S-     0   0  152  336   48                   G  GGG     GG         G GG  G G  GG H   GG   G  G GGG
    11   59 A G        -     0   0   16  344   17                   G  GGA     GG         A GG  G G  GG G   AG   G  G GGG
    12   60 A K  E     -A   23   0A 117  344   75                   T  TST     TT         T SR  T T  TT S   ET   N  T STT
    13   61 A a  E     -A   22   0A  45  344    0                   C  CCC     CC         C CC  C C  CC C   CC   C  C CCC
    14   62 A K  E     -A   21   0A 155  344   82                   V  VaN     TT         E KT  q H  TT R   ve   n  t NTK
    15   63 A X  E     +A   20   0A 120  302   29                   D  DkD     D.         . DV  n E  .. D   dt   r  v DVE
    16   64 A G        -     0   0   44  341   74                   G  GGG     AD         D LE  G R  NN V   GA   Q  S QVS
    17   65 A L  S    S-     0   0  152  342   69                   I  IGV     LT         L LR  T R  LL V   DP   S  G ESA
    18   66 A G  S    S+     0   0   67  343   62                   N  NGN     Dg         g NG  L G  ee Q   GD   G  g NGG
    19   67 A E        -     0   0  119  329   61                   R  RLN     St         g DA  . E  gg G   EN   .  s DGK
    20   68 A Y  E     -A   15   0A  37  342    9                   Y  YYY     YY         Y YS  Y Y  YY Y   YY   H  Y YYY
    21   69 A T  E     -A   14   0A  71  343   83                   S  SGT     TT         A SV  S S  MM T   SL   H  K TSY
    22   70 A b  E     -A   13   0A  20  343    0                   C  CCC     CC         C CC  C C  CC C   CC   C  C CCC
    23   71 A T  E     -A   12   0A  85  344   80                   T  TTS     SD         T AL  T K  TT S   LT   I  I TAL
    24   72 A c        -     0   0   44  344    1                   C  CCC     CC         C CC  C C  CC C   CC   C  C CCC
    25   73 A L    >   -     0   0   62  344   86                   V  VAI     TW         S PP  N K  PP H   PP   N  P PLK
    26   74 A E  T 3  S+     0   0  177  344   74                   A  ASP     SA         A QP  P T  QQ P   EE   N  T QPE
    27   75 A G  T 3  S+     0   0   29  344   24                   G  GGG     GA         G GQ  G G  GG G   GG   G  G GGG
    28   76 A F  E <   +B   36   0B  40  343   16                   F  FYF     FW         Y FY  F Y  FF Y   FF   F  F FFF
    29   77 A E  E     +B   35   0B  74  343   63                   T  TTT     QT         V YG  T E  EE S   HS   Y  K YTK
    30   78 A G  S >  S-     0   0   32  343    1                   G  GGG     GG         G GG  G G  GG G   GG   G  G GGG
    31   79 A K  T 3  S+     0   0  156  343   72                   K  KAT     DD         K KK  E S  SS K   KA   K  N KNI
    32   80 A N  T 3  S-     0   0   33  343   62                   N  NNR     NN         H NT  N N  HH N   DN   N  T NDN
    33   81 A c  S <  S+     0   0    1  344    0                   C  CCC     CC         C CC  C C  CC C   CC   C  C CCC
    34   82 A E        +     0   0   87  342   30                   E  EEE     EE         Q Ee  E E  ee D   eE   E  I E.T
    35   83 A L  E    S-B   29   0B  96  289   42                   .  TTT     ..         . Vv  . .  ll .   .V   L  . V..
    36   84 A F  E     -B   28   0B 139  292   93                   .  DAN     ..         F SN  . .  LL .   .V   S  . S..
    37   85 A T        -     0   0   44   76   76                   .  ...     ..         . ..  . .  .. .   k.   .  . ...
    38   86 A R        +     0   0   57  101   88                   .  ...     ..         . ..  . .  .. .   T.   .  . ...
    39   87 A K        +     0   0   96  140   78                   .  ...     ..         . ..  . .  .. .   G.   .  . ...
    40   88 A L        -     0   0   91  168   91                   .  ...     ..         . .A  . .  .. .   P.   .  . ...
    41   89 A d  S  > S+     0   0   15  238   19                   .  ...     ..         . .C  . .  .. .   C.   .  . ...
    42   90 A S  T  4 S+     0   0   98  244   86                   .  ...     ..         . .R  . .  .. .   E.   .  . .E.
    43   91 A L  T >4 S-     0   0  120  274   90                   T  ...     TT         . .H  I I  .. .   K.   .  D .NE
    44   92 A D  G >4 S-     0   0  107  297   62                   D  .D.     DD         E .R  D E  .. T   A.   .  D .DD
    45   93 A N  G >< S-     0   0    8  315   63                   I  III     IV         I AN  I P  .. A   GD   G  V AII
    46   94 A G  G <  S-     0   0    0  316   53                   D  DDD     DD         D MG  D G  .. T   FN   Q  E MDD
    47   95 A D  G <  S+     0   0   44  344   60                   E  EGD     EE         E TG  D K  TT T   PP   D  E TEP
    48   96 A e    <   -     0   0    0  344    1                   C  CCC     CC         C CC  C C  CC C   CC   C  C CCC
    49   97 A D  S    S-     0   0   59  344   73                   A  AAA     AQ         Q AL  Q A  AA R   RA   D  D ATI
    50   98 A Q  S    S+     0   0    2  344   62                   g  ggg     sq         s dQ  f s  dd d   np   s  n dnt
    51   99 A F  E     -C   62   0C   4  344   77                   t  ttt     at         q tY  t t  kk s   qt   n  t tst
    52  100 A d  E     +C   61   0C  10  344    0                   C  CCC     CC         C CC  C C  CC C   CC   C  C CCC
    53  101 A H  E     -C   60   0C  68  344   86                   K  KAT     IT         K MS  I H  KK T   QM   V  L MTR
    54  102 A E  E     -C   59   0C  92  344   56                   D  DDD     DN         D EE  D E  EE D   DE   V  N ENN
    55  103 A E  S    S-     0   0  100  344   81                   G  GGG     LT         R eP  E R  KK q   eT   A  T kLF
    56  104 A Q  S    S-     0   0  175  310   77                   I  III     VP         V .p  I r  dd .   gG   d  H .QL
    57  105 A N  S    S+     0   0  154  307   78                   N  NNN     NG         S tg  N e  gg g   rG   g  G sGS
    58  106 A S  S    S-     0   0   58  337   71                   G  GGG     SS         S gA  S .  ss G   NS   g  S sDG
    59  107 A V  E     -C   54   0C   7  343   86                   F  FFF     YY         F YV  F Y  YY Y   FF   Y  Y YYY
    60  108 A V  E     -C   53   0C  45  344   87                   T  TTT     SS         L SA  V S  MM V   TN   R  Q SRN
    61  109 A e  E     +C   52   0C   5  344    0                   C  CCC     CC         C CC  C C  CC C   CC   C  C CCC
    62  110 A S  E     -C   51   0C  24  344   70                   E  EKT     SS         L HG  L K  EE R   KD   E  M RST
    63  111 A f        -     0   0   23  344    0                   C  CCC     CC         C CC  C C  CC C   CC   C  C CCC
    64  112 A A    >   -     0   0    8  344   70                   A  PPP     AA         E PA  L K  PP S   LT   P  P PVP
    65  113 A R  T 3  S+     0   0  149  344   83                   V  VAA     SD         P AD  P T  RR S   AA   R  A PSI
    66  114 A G  T 3  S+     0   0   24  344   13                   G  GGG     GG         G GG  S G  GG G   GG   G  G GGG
    67  115 A Y  E <   -D   78   0D  20  344    7                   Y  YYY     FW         Y YY  Y Y  YY Y   FW   T  Y YYF
    68  116 A T  E     -D   77   0D  72  343   81                   N  SNT     QT         T TE  G G  TT T   IT   L  T MCT
    69  117 A L  E     -D   76   0D  67  340   68                   G  GGG     GG         G GL  G D  GG G   GG   G  G GGG
    70  118 A A    >   -     0   0   23  340   78                   S  SSN     TT         Y SE  G S  LL K   AP   E  K SKK
    71  119 A D  T 3  S+     0   0  175  340   77                   T  TTT     NN         H NP  R N  NN N   LT   H  N NYL
    72  120 A N  T 3  S-     0   0   92  340   74                   C  CCC     CC         C CD  C C  CC C   CC   C  C CCC
    73  121 A G  S <  S+     0   0   16  340   56                   E  EEG     EG         E EG  E E  EE Q   EN   E  E EQQ
    74  122 A K  S    S+     0   0   71  332   83                   I   TT     AE         L KR  K I  KK T   N    I  S KSN
    75  123 A A        -     0   0   22  330   70                   D   DD     gD         A RS  D E  KK A   D    d  K KTV
    76  124 A f  E     -D   69   0D  12  300   48                   I   II     nV         S L.  . .  VV .   V    l  Y IGM
    77  125 A I  E     -D   68   0D  78  304   82                   D   DD     IN         D G.  . .  DD E   D    D  V DTA
    78  126 A P  E     -D   67   0D  62  304   56                   E   EE     GE         P R.  . .  KK P   D    E  P RPP
    79  127 A T  S    S+     0   0  103  304   79                   C   CC     CC         C C.  . .  CC C   C    C  C CCC
    80  128 A G  S    S-     0   0   32  305   75                   A   AA     AA         F S.  . .  TT K   L    S  S SSS
    81  129 A P  S    S+     0   0  116  311   78                   S   SS     SN         S S.  T .  SS S   M    P  P SSS
    82  130 A Y  S    S+     0   0   59  312   77                   G   NS     SS         S N.  E Y  LL N   R    N  S DNT
    83  131 A P    >   -     0   0   17  312   34                   P   PP     PP         P P.  G I  PP P   P    P  P PPP
    84  132 A g  T 3  S+     0   0   16  323    2                   C   CC     CC         C CC  C A  CC C   C    C  C CCC
    85  133 A G  T 3  S+     0   0    0  295   30                   Q          QE         G AS  E E  AA G   A    A  Q A  
    86  134 A K    <   -     0   0   69  294   62                   N          NN         S NQ  H N  NN H   N    Q  N N  
    87  135 A Q        -     0   0   37  243   74                                            T    F  GG                  
    88  136 A T        +     0   0    4  220   79                                            A    S  GG                  
    89  137 A L        +     0   0  105  200   57                                                 L  LL                  
    90  138 A E              0   0  104  120   71                                                 E                      
    91  139 A R              0   0  231   97   28                                                                        
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3  IIIIIIIIIIIIIIIII II   IIIII  IIIIIIVII I  II I II  I III  III II I   
    94   17 B V  B     -E  271   0E   7  561    9  IIIIVVVVIIVVVVVVV MV   VIVVV  AVVVVVVVI V  II I YV  V VVV  VVI VV V   
    95   18 B G  S    S+     0   0   25  562    6  GGGGGGGGGGGGGGGDG GG   GGGGG  DNGGGGNNG G  GG G GG  G GAG  GGG GG G   
    96   19 B G  S    S-     0   0   26  563    0  GGGGGGGGGGGGGGGGG GG   GGGGG  GGGGGGGGG G  GG G GG  G GGG  GGG GG G   
    97   20 B Q  E     -F  237   0F  98  564   95  KKKKYYSHQRYYYYYST AR   TVVHG  HEQVTYLRQ Q  QQ Q QR  T VRS  HHQ YY W   
    98   21 B E  E     -F  236   0F  80  565   65  NNNNTTNDKPTSTTENE NE   DEQLD  PPEPAVEQE A  VV E KP  Q EDQ  EPK HN E   
    99   22 B h        -     0   0    8  565   58  SSSSCCAVACCCCCCAA AA   LIVVT  AAAAAAACV A  VV V AT  A AAV  AIA CC A   
   100   23 B K    >   -     0   0  123  564   79  LLLLRRASKRAARPPAP EP   ASSPS  KVADADADT A  PP P KT  S SEE  EGN SP L   
   101   24 B D  T 3  S+     0   0   60  565   85  RRRREEDIMIEREEKDI HR   IIIMS  KIPWAVEPA A  RR R PI  P IKK  IIP VA P   
   102   25 B G  T 3  S+     0   0    0  565   73  GGGGSNGEGDNSSHHGN GN   HEKSY  AEHGGEGHY G  FF F GQ  N GGG  GEG PH H   
   103   26 B E  S <  S+     0   0   36  565   67  GGGGSSDDNQSASSADG ES   NKDEY  DDEQEDQSS A  SS S DN  E ELS  RQN YS E   
   104   27 B h    >   +     0   0    4  565   91  WWWWVVAYFRVAVVAAW WW   AAYVT  WHFLILFQI W  II I FH  F FAY  YAF QV F   
   105   28 B P  T 3   +     0   0    0  567    9  PPPPPPPPPPPPPPPPP PP   PPPPK  PPPPPPPPK P  KK K PP  P PPP  PPP VP P   
   106   29 B W  T 3  S+     0   0    5  568   27  WWWWYYYYWFYYYYWYW WW   WWYWY  WYWFYYWWY W  YY Y WY  Y YWW  WYW SY Y   
   107   30 B Q  E <   -N  122   0G   7  569   24  qqqqQQQQQQQQQQTQq qq   qQQqv  QQLVqQqQQ q  QQ Q QQ  Q IQQ  MqQ LQ Q   
   108   31 B A  E     -NO 121 146G   1  559   47  llllVVVV.VVVVVVVm mi   iVIas  AVVVlVpVA i  AA V .V  I VVV  Vv. .V V   
   109   32 B L  E     -NO 120 145G   3  567   65  RRRRSSSAVASSSSSSL KI   QSSLS  SSSALSQGS P  SS S VS  S SMS  AQA .S T   
   110   33 B L  E     -NO 119 144G   0  570   11  LLLLLLLLFILLLLLLL LL   LLLLS  LLILLLLLL V  LL L LL  L LLL  LVF .L L   
   111   34 B I  E     -NO 117 143G   0  570   81  KKKKNNQLTINNNNNQR NK   SEQYS  QQTEGQDFQ S  QQ Q IQ  R QFK  YKT .N K   
   112   35 B N  E >   - O   0 142G  30  570   88  ssssASRNNKASASVRS St   ALRFS  MNRSNRtLT G  SS S LY  R SRR  YsN .A S   
   113   36 B E  T 3  S+     0   0   63  113   77  hhhh............P Sn   .....  .V.P..g.S .  .. . ..  . .K.  .s. N. A   
   114   37 B E  T 3  S-     0   0  136  242   76  GGGG...N.R......N SL   .N...  DEKR.HN.S .  PP T GN  L .NR  .S. A. L   
   115   38 B N  S <  S+     0   0   84  543   52  DDDDGGTG.GGGGGGTG LT   .GS.A  GNGG.NQGG G  RR R GG  G SPQ  NQ. GG D   
   116   39 B E        -     0   0  100  561   93  GGGGYYSYIQYYYYYSD PT   RYFGY  IKGQ.SITQ A  GG G SK  S SQK  NRI YY S   
   117   40 B G  E     +N  111   0G  14  572   55  RRRRHHHFHIHHHHHHQ HH   HNHIA  HHHQSHINH A  HH H TH  H HEH  RHH HH L   
   118   41 B F  E     +     0   0G  28  581   35  llllFFFIgLFFFFFFF IY   IWMfq  FFFLLIhlY L  YY Y AI  I FlI  fIg FF L   
   119   42 B i  E     -N  110   0G   0  578    1  ccccCCCCgCCCCCCCC CC   CCCcc  CCCCCCccC C  CC C .C  C CcC  cCg CC C   
   120   43 B G  E     -N  109   0G   1  581    2  GGGGGGGGGGGGGGGGG GG   GGGGG  GGGGGGGGG G  GG G AG  G GGG  GGG GG G   
   121   44 B G  E     -N  108   0G   0  581    9  AAAAGDGGGGGGGGGGG GG   GGGAG  AGGAGGGGG G  AA G GG  G GAG  GGG GG G   
   122   45 B T  E     -NP 107 130G   0  581   43  TTTTSSSSASSSSSSSS NS   SVSVC  SSAATSTVT S  TT T AT  S SST  STA SS S   
   123   46 B I  E     + P   0 129G   0  581   23  LLLLLLIILLLLLLLIL VL   IILVI  LIIILVLLL L  LL L LL  I LLI  LIL LL I   
   124   47 B L        -     0   0    6  581   27  LLLLIIILLIIIIIIII II   YYIYL  ILLLILIIV I  VV V LV  Y III  ILL II I   
   125   48 B S  S    S-     0   0   22  581   57  SSSSNNANGSNSNNAAD SD   SSGSD  SSNNASDDH N  HH H YK  K KSS  NSG NN S   
   126   49 B E  S    S+     0   0   99  581   62  SSSSDDDEDDDSDSPDP PP   KKVEE  EEDEPDERP S  PP P DP  S KDA  DAD ES S   
   127   50 B F  S    S+     0   0   42  581   82  CCCCQQNYRQQQQQGNG WY   DNGKV  EDRRSRCRQ Q  QQ Q ND  N NRQ  RDR HQ R   
   128   51 B Y  E     - Q   0 185G   7  581   33  WWWWWWYFWWWWWWWYW WW   IIWIT  WIFWIWWWW W  WW W WR  W WWW  YKW WW H   
   129   52 B I  E     -PQ 123 184G   0  581   14  VVVVVVIVIVVVVVVIV VI   IIAVI  LVVLIVVVV I  VV V VV  I VVV  VVI VV V   
   130   53 B L  E     +PQ 122 183G   0  581   28  LLLLVVLLLLVLVLVLL LL   LILIA  LLLALMLLV L  VV V LV  I LLI  LLL VL L   
   131   54 B T  E     - Q   0 182G   0  581   43  TTTTSSTTTSSSSSSTT TT   TTTTT  TTTTTTTTS S  SS S TT  T TTT  TTT SS T   
   132   55 B A    >>  -     0   0    0  581    2  AAAAAAAAAAAAAAAAA AS   AAAAA  AAAAAAAAA A  AA A AA  A AAA  AAA AA A   
   133   56 B A  G >4 S+     0   0    0  581    8  AAAAAAAEAAAAAAAAA AS   AAAAA  AAAAAAAAA A  AA A AA  A AAA  AAA AA A   
   134   57 B H  G >4 S+     0   0    7  581    0  HHHHHHHHHHHHHHHHH HH   HHHHH  HHHHHHHHH H  HH H HH  H HHH  HHH HH H   
   135   58 B i  G X4 S+     0   0    0  581    2  CCCCCCCCTCCCCCCCC CC   CCCCC  CCCSCCCCC C  CC C AC  C CCC  CCT CC C   
   136   59 B L  G << S+     0   0   31  581   65  FFFFYYITLKYYYYYIL VF   VAVTV  FLLHLTFSW F  WW W IT  T VLI  VII YY T   
   137   60 B Y  G <  S+     0   0  109  581   87  KKKKKNQGYQQKKKQQV QW   KYEDY  DECQASISR S  II I YD  D RLA  FEY QK Y   
   138   61 B Q  S <  S+     0   0   95  581   78  rrrrYSgHpPYSYSRgg dt   ddsnn  igsIggdSP s  PP P eg  g gyn  gEp SS g   
   139   61AB A        -     0   0   16  352   75  tttt..a.nI.....ap as   vpvda  mpv.vaa.K t  SS S av  v vea  rGn .. a   
   140   62 B K  S    S-     0   0  172  366   75  RRRR..SGAS.....SD ST   TNEAE  AEGVSGS.N A  SS S SS  G KNS  STV .. G   
   141   63 B R  S    S-     0   0  162  570   78  NNNNRRSNSSHSRRRSS NQ   LDSLN  SDQATSIRM G  LL F SD  S KDT  RKS KS S   
   142   64 B F  E     -O  112   0G  36  577   54  YYYYIILLLIIIIIILV IF   LLLYF  FVLIFQFYM V  MM M LL  M VLL  FYK MI I   
   143   65 B K  E     -O  111   0G  67  577   78  AAAAQQTKDPQQQQQTV KE   QSKSL  GKRATATWK V  KK K DG  S VLN  SAD EQ I   
   144   66 B V  E     -OR 110 161G   0  577   16  VVVIVVTVVIVVVVVIV LI   VVVVV  TVVGVVVVV V  VV V II  I IVV  VVV LV V   
   145   67 B R  E     -OR 109 160G  40  577   53  RRRRRRRRFRRKRRRRR TR   RRRRV  TRTSRRRRV Y  VV V RR  V GRT  KRF RR G   
   146   68 B V  E     +OR 108 159G   1  578   43  VVVVLLYVLMLLLLLYL ML   VAVVA  LLLLVVLLL L  LL L LA  A LIA  FAL IL L   
   147   69 B G  S    S+     0   0    9  578   14  GGGGGGNGGGGGGGGNG GG   GGGGG  SGGDNKGGS G  SS S GG  G HGG  LGG GG G   
   148   70 B D        +     0   0   11  579   58  DDDDEETSHDEEEEETA EE   SAASD  PSEPTSDEE E  EE E AS  E DKE  MSH EE E   
   149   71 B R  S    S+     0   0   24  579   73  YYYYHHLSTHYYHYHLH WH   NTTVD  PTHSLSLHH T  HH H LS  H RHY  HNT NY H   
   150   72 B N  B >   -T  234   0H  18  579   65  HHHHNNRFNSNNNNDRY RD   RTRWS  LMNSAYNSN E  NN N KY  S TSD  DNN NN N   
   151   73 B T  T 3  S+     0   0   56  579   79  TTTTIIHSVLILIIIHR LV   HHKKR  MYLSLHNLL I  LL L RH  L NRL  RHV II R   
   152   74 B E  T 3  S-     0   0  119  579   84  LLLLNNNEEKDANDSNS FR   NNENG  RAKANARSN N  EE E LS  S ATS  TGE ED L   
   153   75 B Q  S <  S-     0   0  130  578   86  VVVVVVSRETVAVVASN NK   ALKFG  RSASGKVRL N  VV V SS  I LRH  VRE LV N   
   154   76 B E        +     0   0  165  578   85  PPPPLLGGlKLQLQNGk VY   GGDGM  NGPsaGSLE s  DD T PG  D nyI  pGi LR t   
   155   77 B E        -     0   0   93  438   29  EEEEEE..lEEDEEE.v DE   ....N  ..Ena.DDE n  EE E ..  S erE  e.l EE e   
   156   78 B G  S    S+     0   0   46  547   33  EEEEGGGGGGGGGDGGG GG   GGGGG  .GVAG.DWG S  GG G .G  G SGP  DGG GD E   
   157   79 B G  S    S+     0   0   47  555   76  FFFFNNLTNTGSNSDLT TF   TSLQV  .LpsS.TTf V  FF F HP  D IIG  SQH TS F   
   158   80 B E        -     0   0   37  444   33  EEEEEE...EEEEEE.E EE   .....  ..ar.GEEq .  EE . Y.  E .EE  ... EE .   
   159   81 B A  E     -R  146   0G  27  457   60  EEEEQQ...QQQQVT.K QE   .....  ..RQVEQQE .  QQ E T.  Q .KQ  ... QV I   
   160   82 B V  E     -R  145   0G  71  557   81  EEEEFFT..CFTFVYTD VI   LVIHV  .LHVSLDIF S  VV Q QL  Y .IT  FL. FV D   
   161   83 B H  E     -R  144   0G  14  567   77  IIIIVIV.HVIIVRIVI II   IVVVV  .VESRVFRD K  LL V AC  S .SL  EVH IR T   
   162   84 B E        -     0   0   90  569   77  GGGGDDK.PNDSDSDKK PQ   PGNRR  .DSEGMARV T  NN F WR  D AMT  RNP QS A   
   163   85 B V  E     -S  186   0G  27  574   64  VVVVSAA.ISASSSSAV VG   VVIVV  IVVGVVISA V  VV N AV  I PLI  KVV SS V   
   164   86 B E  E    S+     0   0G  70  575   73  QQQQAAS.RASSASSSA ED   ASRAS  QKIASKEGW S  SS V EG  L KEE  VLR AA A   
   165   87 B V  E     -S  185   0G  13  576   72  QQQQKNR.RKKKKVMRQ RQ   TARVK  SSNENRRFS Q  QQ S AE  S RKT  SDR KA E   
   166   88 B V  E     -S  184   0G  72  577   45  IIIIIIIIVAIVIIVII IL   YIIIL  IFAVFYLSF I  II M VV  K III  YYV IV I   
   167   89 B I  E     +S  183   0G  27  578   45  VVVVIVILSFIIIIIII IY   KSHWI  IKVRVVIVF I  YY I FV  T IYI  IRI II R   
   168   90 B K  E     -S  182   0G  68  578   82  IIIIRKGNVVRRRRRGP SI   LLRRP  ISLLIMITN V  MM Y IQ  E AII  MVI RR Q   
   169   91 B H    >   -     0   0   19  579   14  HHHHHHHVHHHHHHHHH HH   HHHHH  HHHAHHHHN H  NN I HH  H HHH  THH HH H   
   170   92 B N  T 3  S+     0   0  156  579   60  RRRRPPEkPPPSPPPEK AP   EEPEE  EEPPPPEPF E  nN N EP  E PPP  NPP PP P   
   171   93 B R  T 3  S+     0   0  150  576   74  EEEENKKiDNKGNKNKN NG   HQDGL  NKGGSKEGN N  k. K GQ  A NRY  WED QK D   
   172   94 B F    <   -     0   0   24  579    5  YYYYYFYYYYYYYYYYY YL   FYYYY  YFHYYYFYY Y  YF F YY  Y YYF  FFY YY Y   
   173   95 B T     >  -     0   0   56  579   67  RRRRNKDtrdSNNSSDH Sv   DDNvN  AnraTDsqR N  WK N tD  S Nns  lSR NS R   
   174   96 B K  T  4 S+     0   0  145  525   79  PPPPSKSddsSASSGS. Yd   PNSpS  AeggSHyg. K  .Y Y dR  S Ark  vD. SS P   
   175   97 B E  T  4 S+     0   0  174  533   92  DDDDWKNNEHWNWIYNS NL   YIRAS  HTKTSRPQ. Q  .W W AW  R RDK  LY. WR L   
   176   98 B T  T  4 S-     0   0   44  561   58  SSSSTTTSSDTTTTDTP TI   LITWT  KRYQTTSST T  TT T GT  T TIP  VY. TS T   
   177   99 B Y    ><  +     0   0   60  566   66  SSSSLLIYYSLLLLLII VS   LAIFM  HVVLNVAHF Q  FF F FT  Q MLM  FL. IL I   
   178  100 B D  T 3   +     0   0   25  578   38  DDDDDDDAndDNDNDDe Dp   HTDND  DNDDDDRDN D  DD D DD  E EDD  iTQ DD Q   
   179  101 B F  T 3  S+     0   0   21  558   68  YYYYNNNYgnNNNNNNn Yy   YNY.N  D...NYHHN N  NN N NF  N NRY  nNd NN N   
   180  102 B D    <   +     0   0    1  577    0  DDDDDDDDDdDDDDDDD DD   DDDDD  DDD.DDDDD D  DD D DD  D DDD  DDd DD D   
   181  103 B I        +     0   0    0  579   14  IIIIIIIVIIIIIIIII YV   IIYII  IVILLFVLI V  II I IV  I FII  VVI II V   
   182  104 B A  E     -QS 131 168G   0  579   60  AAAAMMAPAMLMMMMAA AA   AAAAA  AAAAASARL S  MM M AS  C AAA  AAA MM S   
   183  105 B V  E     -QS 130 167G   0  580   15  LLLLLLLVLLLLLLLLL LL   LLLVL  VILLLLLLL L  LL L LI  L LLL  LML LL I   
   184  106 B L  E     -QS 129 166G   0  581   30  VVVVIIILLLIIIIIIL LI   LLLIV  VMLIMLLLI L  II I IV  L ILL  LLL II L   
   185  107 B R  E     -QS 128 165G  40  581   42  RRRRKKQKEKKKKKKQK KK   RLERV  KKERKEKRK K  KK K KK  R EKK  KRE QK V   
   186  108 B L  E     - S   0 163G   0  581   17  LLLLLLTLLLLLLLLTL LL   LLLVV  LLLLLLLLL L  LL L LI  L LLM  LLL LL L   
   187  109 B K  S    S+     0   0  101  581   69  QQQQASASEQSSAASAE TK   ASAAD  SAAKVEAGD T  SS S NN  S SRD  SEE QA A   
   188  110 B T  S    S-     0   0   82  582   74  GGGGSSSENKTKSSKSN RR   TSPDP  TQRRSKKSR S  EE Q NS  S QKG  ERN ES E   
   189  111 B P        -     0   0   48  582   39  ppppPPkKSPPAPAPkP PP   QPySp  PPPPpPvPP P  PP P KR  P dPA  PHS PP E   
   190  112 B I        -     0   0    4  532   62  aaaaVVgIVVAAVVAgA LA   ILtLa  V.IFvLaVA V  AA A V.  L aIF  VLV AV I   
   191  113 B T        -     0   0   95  537   72  RRRRTTTETHVTTEATN NV   SRDIS  L.TKKQRVT T  RR Q V.  S PSH  PFT QA S   
   192  114 B F        +     0   0   56  580   32  FFFFLLTFLFILLYLTL FF   FLVFF  FVWWLFYLL F  LL L I.  L VFF  LFL LY F   
   193  115 B R  B >   -U  196   0I  52  581   64  SSSSNNNGGTNNNSNNV TH   SSTNS  SkSrAGTTN N  NN N N.  N ASG  GSG NS S   
   194  116 B M  T 3  S+     0   0   29  564   77  SSSSAA.KPEASAAR.N QK   LKQS.  KsEg.EDKA D  AA A SC  T LDQ  E.P NA D   
   195  117 B N  T 3  S+     0   0   13  572   89  HHHHRR.GNHRYRDN.G YR   SFADT  DASI.AASN Y  NN N NT  K NYF  T.N ED G   
   196  118 B V  B <   +U  193   0I   0  574   26  VVVVVVAILVVVVIVAV VV   VVFVM  VIVV.CVVV I  VV V IG  V PIV  I.L VV R   
   197  119 B A        -     0   0    1  576   81  LLLLAAQGLQSNAQDQG QY   KQARE  GRKE.QQQQ S  QQ Q TR  N AHG  IRL QQ R   
   198  120 B P        -     0   0    8  576   54  PPPPSTAPPPTTSPLAT PS   PVQPA  RYPP.PPPP P  PP P PP  V EPP  PSP PP M   
   199  121 B A        -     0   0    2  577   39  AAAAVVIVIVLVVIIIV VV   IILII  VIAV.VALA V  AA A IA  V IVV  VVI II V   
   200  122 B g  B     -g  290   0F   1  578   67  CCCCPAKKCALPPASKC CC   APPPE  CKCCTRCPE C  AA V CP  R TCC  CAC PA C   
   201  123 B L        -     0   0   27  580    5  LLLLLMLLLLLLLLLLL LL   LLELI  LLLLLLLLL L  LL L LL  L LLL  LLL LL P   
   202  124 B P        -     0   0    7  581   31  PPPPPPPPPPPPPPPPA PP   AAQAA  PAPPPPPPP A  PP P PA  P PPP  PIP PP P   
   203  124AB E     >  -     0   0   92  580   75  FFFLSSESDKSTSSTEN DS   ATNDS  DDVKAEDTD E  DD D RE  A TDE  PGD TS S   
   204  125 B R  H  > S+     0   0  109  580   79  WWWWSSQKNRASSSGQN SV   TEEVE  AKADAQETA Q  AA P KR  Q DKP  EMN ES R   
   205  126 B D  H  > S+     0   0  124  580   85  RRRRCCGGDCCCCCCGN DT   SEDAQ  TKTRADSCD G  AA T EE  G GQK  GAE CC V   
   206  127 B W  H  >>S+     0   0    4  580   87  EEEEAASSTPAVAAAST FA   PPLPP  FPGATEFAT S  TT A AP  A STE  NYT PV D   
   207  128 B A  I  X>S+     0   0    0  580   75  RRRRPLDIFPSTPKYDH PN   SSPAA  EVKASDPAP N  PP P EA  E EAE  TSF PK S   
   208  129 B E  I  <5S+     0   0   75  581   83  PPPPAAPPYPAAAAAPL AL   GIDAD  VTPMCVIAL F  PP P ST  T IAF  YEY VA G   
   209  130 B S  I  <5S+     0   0   70  582   65  QQQQGGKPdNGGGGGKP GT   GGGGG  LGgDsEKGG P  LL L FG  A LRE  AYd GG n   
   210  131 B T  I  <5S+     0   0   18  104   77  ........g........ ..   ..T..  ..sQa.... .  .. . .S  . .L.  .Fd .. d   
   211  131AB L  I ><  S-     0   0  119  478   80  ....sss..sSsssMss yA   i.Qg.  .F..sLL.. S  .. . .s  s .sA  .L. SS s   
   227  146 B E  T 3  S+     0   0   47  513   76  ....NSG..PSSNNDGS RE   G.NI.  .L.ESNG.Y S  YY Y .E  G GAE  GY. NS S   
   228  147 B K  T 3  S+     0   0  169  537   69  ....GGAD.EGGGGGAG GG   T.APN  NIRGGNQWS G  SS N .G  G SSD  DD. GG G   
   229  149 B G  S <  S-     0   0   29  548   67  ....VVSG.GVSVYASG SS   G.EGG  GCYVGQSSS G  SS S GG  S YDG  GS. VS G   
   230  150 B R        -     0   0  213  557   86  ....NNSE.FNLNNVSA PP   K.ELL  PDKNSESPY S  YY Y LP  T STV  TS. NS V   
   231  151 B Q  B     -V  224   0J  79  563   93  YYYYNNLT.FYYNYSLA SY   Y.SES  FLRMISAFL T  LL L LS  I LQV  FL. YF I   
   232  152 B S        -     0   0   14  569   51  SSSSPPPAAPPPPPGPP PS   SSSSS  PSTSSRAPS S  SS S AP  P PPS  PSA PP A   
   233  153 B T  S    S+     0   0   48  570   73  RRRRDDTDHDDDDEDTD NP   SNDID  NPDNQDADP S  PP P RD  D TSQ  MDF DE D   
   234  154 B R  B    S-T  150   0H 102  570   86  TTTTLLKVDVLVLLQKR YV   SRVVQ  TNVKTKNQV S  VV V NQ  I KVV  KRN LI I   
   235  155 B L        -     0   0    3  578    3  LLLLLLLLLLLLLLLLL LL   LLLLL  LLLLLLLLL L  LL L LL  L LLL  LLL LL L   
   236  156 B K  E     -FH  98 221F  31  578   51  QQQQQQQQRQQQQQQQM QN   QRRLQ  RMQHLRMQR Q  RR R MQ  R QQQ  QQR QQ R   
   237  157 B M  E     -FH  97 220F  18  579   94  QQQQCCKAFCCCCCCKQ EE   LSAQQ  QSKRKAWCS E  AA A YE  K KVD  EGF CC A   
   238  158 B L  E     - H   0 219F   4  580   42  AAAAVLVVVGLLVLLVA VV   VVVAV  VVVVAAVLV V  VV V VV  V VVV  VVV IL V   
   239  159 B E  E     - H   0 218F 107  580   72  AAAADDTERLVNDNDTS GE   QNTSK  EEEQNVTND S  DD D DT  T DNN  HSR EQ D   
   240  160 B V  E     - H   0 217F   0  580   46  IIIIAAVVLVAAAAAVV LV   LVVVV  VVVVVVLVV V  VV V IV  V VVL  VIL AA V   
   241  161 B P  E     - H   0 216F  34  580   26  PPPPPPPPPYPPPPPPP PD   QDPKP  EERPQPPST P  QQ Q PD  P PPP  PPP PP I   
   242  162 B Y  E     -J  263   0F  36  581   45  LLLLVLIIVTLVVIVIL LI   IITIV  IFVLVKTIL I  II I IV  I LII  ILI IV G   
   243  163 B V  E     -J  262   0F  24  582   35  LLLLLLVVAILLLLLVV VV   IVVVV  IVVMLSKVI V  II I VI  V VVL  LVA LL L   
   244  164 B D     >  -     0   0   88  581   58  PPPPPPDNNSSSPSSDS NS   EANDD  SDASDNSS. S  SS S DS  S SET  SSD SS T   
   245  165 B R  H  > S+     0   0   51  581   79  KKKKQQRLPNHSQDDRK HK   RRQPS  NTNRNQNS. N  NN N HR  D TRQ  NHR DD I   
   246  166 B N  H  > S+     0   0  105  582   75  RRRRAAKKQEASAQAKS SE   DATNE  DKTATEKAP S  CC C QE  A APE  EEE QR Q   
   247  167 B S  H  > S+     0   0   48  582   78  FFFFDDTDAEDQDEETR QV   DEQDK  IDVEAYYAY Q  RR R KA  T AVE  QQA EE E   
   248  168 B j  H  X S+     0   0    1  582    2  CCCCCCCCCCCCCCCCC CC   CCCCC  CCCCCCCCC C  RR R CC  C CCC  CCC CC C   
   249  169 B K  H >< S+     0   0   88  582   73  EEEEEEnQeAESEQKnd hn   sltRq  naseKnkRY S  YY Y tr  r NKv  hsq RR r   
   250  170 B L  H 3< S+     0   0  150  547   89  EEEEAAgEkKASAEGgg ld   gvy.a  nyqa.ykAY .  .. . pv  s KAt  qyk QN s   
   251  171 B S  H 3< S+     0   0   23  578   76  RRRRSSAANLSASAAAN TS   YYERY  VGGGLARVY .  YY Y YY  Y ASL  YAN SA Y   
   252  172 B S    <<  -     0   0   20  581   83  YYYYYYVYRYYYYYYVY AY   GGHAY  YYKYQATFY S  YY Y SG  G YTK  FES YY N   
   253  173 B S  S    S+     0   0   79  581   83  KKKKPPGGMPPPPPPGT SN   WEFYW  GGSAYYEPW S  WW W GS  A NRK  RFN PP S   
   254  174 B F  S    S-     0   0  124  581   79  GGGGGGAGDKGGGGGAG RG   DKGPR  GMTISGLGQ Y  GG G GY  T NIP  FND GG S   
   255  175 B I        -     0   0  100  582   88  RRRRDKEDVGQRDDMDK KT   FVNYP  AERPTGFRM S  MM M SA  S GRI  QNV SE S   
   256  176 B I        -     0   0   13  582   16  FFFFIIIVFIIIIIIII II   VFILI  IIVILVIII L  II V VV  I IIS  IVF II I   
   257  177 B T    >   -     0   0   16  582   36  TTTTTTTDSTTTTTTTH TN   GITTS  SKGDTTDTT T  TT T TT  T TTG  NTS TS H   
   258  178 B Q  T 3  S+     0   0  133  582   68  GGGGNNDEQKNSNSNDE PD   QRDEE  SESKNPDDP S  PP P AG  N DDQ  DEQ DS D   
   259  179 B N  T 3  S+     0   0   24  582   61  RRRRNNNSNNNNNNNNS RR   ETRVG  GTTTNRINN N  NN N NN  S SNT  RSN NN G   
   260  180 B M  E <   - K   0 311F   2  582   11  MMMMMMMMMMMMMMMMM MY   MSMMM  MMQKMMMMM M  MM M MM  M MMF  MMM MM M   
   261  181 B F  E     - K   0 310F   8  581   34  LLLLIIFIFLIIIIMFL RF   IILIL  IVMIIVIVL M  LL L LI  I IFL  MFF II N   
   262  182 B j  E     +JK 243 309F   1  582    0  CCCCCCCCCCCCCCCCC CC   CCCCC  CCCCCCCCC C  CC C CC  C CCC  CCC CC C   
   263  183 B A  E     +JK 242 308F   0  582   27  AAAAVVAAAAAIVVVAA AA   AAAAA  AAAAAAAAA A  AA A AA  A AAT  AAS VV A   
   264  184 B G  S    S-     0   0    3  582   10  GGGGGGGgGGGGGGGGG GG   ASGAG  GTGGAGGGG G  GG G GG  G GgG  GGG GG G   
   265  185 B Y        -     0   0   56  561   58  NNNNFFIyH.FYFFYIL TF   TALA.  FGYWAFLGS L  SS S .G  F YaF  IQ. YF I   
   266  185AB D  S    S-     0   0   81  565   84  LLLLLLLLP.LLLLMLE ET   DPTLL  LKEPPEKIR T  RR R LG  R EQP  PV. LL E   
   267  185BB T  S    S+     0   0   76  582   62  hhhhEEnDSaENEEEnQ GQ   NGELs  TEEQGETPF Q  LL L eQ  L GgD  Eed EE A   
   268  186 B K  S    S-     0   0  107  532   32  kkkkGGgGLgGGGGGgG VG   ..G.g  G.GG.GG.G G  GG G gD  G GgG  Ggl GG G   
   269  187 B Q  S    S+     0   0  102  537   37  RRRRGGGGKGGGGGGGG AG   ..G.G  K.GG.GGGG G  GG G GG  G GGG  GGK GG G   
   270  188 B E        +     0   0   33  581   54  VVVVKKKKQTKKKKKKV KR   KKKKK  LKRQKKSEK K  KK K KK  A KMR  KKH IK K   
   271  189 B D  B     -E   94   0E   7  582    3  DDDDDDDDDDDDDDDDD AD   DDDDD  DSDDDDDDD D  DD D DD  D DED  DDD DD D   
   272  190 B A        -     0   0    7  582   42  SSSSSSASASSSSSSAS VS   AAASA  ASSATAAAS S  SS A SA  S STA  SSA SS S   
   273  191 B k    >   -     0   0    7  582    0  CCCCCCCCCCCCCCCCC CC   CCCCC  CCCCCCCCC C  CC C CC  C CCC  CCC CC C   
   274  192 B Q  T 3  S+     0   0   90  582   25  QQQQQQQQQQQQQQQQQ SG   TVQQQ  EQWQQQTQQ Q  QQ Q RQ  Q QYQ  QQQ QQ L   
   275  193 B G  T 3  S+     0   0    6  582    7  GGGGGGGGGGGGGGGGG GG   GGGGG  GGAGGGGGG G  GG G GG  G GKG  GGG GG G   
   276  194 B D    X   +     0   0    0  582    0  DDDDDDDDDDDDDDDDD DD   DDDDD  DDDDDDDDD D  DD D DD  D DpD  DDD DD D   
   277  195 B S  T 3  S+     0   0   14  582    1  SSSSSSSSSSSSSSSSS SS   SSSSS  SSSSSSSSS S  SS S SS  S ScS  SSS SS S   
   278  196 B G  T 3  S+     0   0    0  582    0  GGGGGDGGGGGGGGGGG GG   GGGGG  GGGGGGGGG G  GG G GG  G GEG  GGG GG G   
   279  197 B G    <   -     0   0    0  582    2  GGGGGGGGGGGGGGGGG GG   GGGGG  GGGGGGGGG G  GG G GG  G GGG  GGG GG G   
   280  198 B P  E     - L   0 294F   1  582    3  PPPPPPPPVPPPPPPPP PP   PPPPP  PPPPPPPPP P  PP P AP  P PDS  PPV PP P   
   281  199 B H  E     -IL 219 293F   0  582   49  LLLLVVVLFLVVVVVVL LL   LLLLL  LLLLMLYLL L  LL L LL  L LSL  MVF VV L   
   282  200 B V  E     -IL 218 291F   3  582   27  MMMMVVAVAVAVVVVAV VV   VVAVV  VVMVMVVVI V  VV V VV  V VGM  HVA VV V   
   283  201 B T  E     - L   0 290F   0  582   67  CCCCCCAIVCCCCCCAC CC   SYVSV  IAVVVHCCC S  CC C FQ  D AGC  VMV CC F   
   284  202 B R  E     + L   0 289F  99  582   70  EEEENNNNRRNNNNNNE EP   AQNGA  ADGSGDRGN K  NN N LN  E QPR  FNR DD K   
   285  203 B F  E >  S- L   0 288F  22  582   70  rrrrGGGGdEGGGGGGd Rn   SGGGN  rGsQGGnGG n  GG G dG  G dfn  dGd GG N   
   286  204 B K  T 3  S-     0   0   85  206   71  gggg....t.......n Gd   .....  r.gD..e.. d  .. . t.  . nnk  a.r .. G   
   287  205 B D  T 3  S+     0   0  108  208   57  EEEE....D.......G GG   .....  N.GG..G.. T  .. . Q.  . NKG  N.D .. E   
   288  206 B T  E <   - L   0 285F   3  218   75  SSSS....R.......R RQ   .....  I.SV..K.. R  .. . R.  T QRA  R.I .. A   
   289  207 B Y  E     - L   0 284F  21  227   50  WWWW....W.......W WY   .....  W.AF..Y.. W  .. . W.  N TWW  F.W .. F   
   290  208 B F  E     -gL 200 283F   0  582   91  AAAVEQVVVEQQEEMVH FV   LQKQK  YHMVVVAVK I  HH R FV  L YYT  VYV ET E   
   291  209 B V  E     + L   0 282F   1  582   41  VVVVLLLQALLLLLLLL LL   LLLLL  LVVLQLVLF Q  FF F VL  L LQL  ILA LL E   
   292  210 B T  E     +     0   0F   1  582   84  YYYYQQVYTQQQQQQVE MR   AVWVA  VVVTVVVQE A  EE E GY  I VMA  AVT QQ V   
   293  211 B G  E     -ML 312 281F   0  582    0  GGGGGGGGGGGGGGGGG GG   GGGGG  GGGGGGGGG G  GG G GG  G GGG  GGG GG G   
   294  212 B I  E     -ML 311 280F   0  582   19  VVVVIIAIIIIFIIIAV LV   IIVII  IIVVIVVLI V  II I II  V VIV  VVI VI I   
   295  213 B V  E     +M  310   0F   7  582   14  TTTTVVVVVVVVVVVVT SV   VVVVV  VVVVTVVVV V  VV V VV  V VVT  VVV VV V   
   296  214 B S  E     -     0   0F   1  581    0  SSSSSSSSSSSSSSSSS SS   SSSSS  SSSSSSSSS S  SS S SS  S SSS  SSS SS S   
   297  215 B W  E     -M  309   0F  45  582    8  WWWWWWWWWWWWWWWWW WW   WHWHW  WWTGFWFWW F  WW W WW  W WWW  WWW WW W   
   298  216 B G        -     0   0   26  582    0  GGGGGGGGGgGGGGGGG GG   GGGGG  GSGGGGGgG G  GG G gG  G GGG  GGG GG G   
   299  217 B E  S    S-     0   0   25  577   90  YYYHYYYY.qYIYIYYY .E   HKFME  IAIINYIeI D  II I mS  I QEL  FYI RI Q   
   300  218 B G  S    S-     0   0   19  580   15  GGGGGGGG.VGGGGGGG WG   GGGLG  DGGGGGGPS G  GG G NG  G GGG  GGG GG G   
   301  220 B k  S    S-     0   0    7  582    2  CCCCCCCCICCCCCCCC VC   CCCCC  CCCCCCCCC C  CC C CC  C CCC  CCC CC C   
   302  221 B A  S    S+     0   0    4  581   17  GGGGAAAAGGAAAAAAA CA   AAAAA  GASAAAAGA A  AA A GG  A ADg  AAG AA A   
   303  222 B R    >   -     0   0  105  578   74  VVVVQQQLCQQQQLEQA PR   QLKIR  KVRRLVRQN K  HH L ER  D RRn  QE. LQ Q   
   304  223 B K  T 3  S+     0   0  152  578   65  KKKKPKAPSRKKPKRAP QP   PSPPP  KEPPPKAKP P  PP P AP  P ADQ  PP. PK E   
   305  223AB G  T 3  S+     0   0   26  582   58  DDDDDDKGRGGGDGDKR AK   NTKFN  NDRGNGKGY N  YY H GG  G NGG  RKE GG G   
   306  224 B K    <   -     0   0   43  582   85  SSSSANYYGKKYAYHYM RK   YYYYY  KYLLFYYIY T  FF F QY  Y YKS  FYG YY Y   
   307  225 B Y        -     0   0   33  582   49  PPPPPPPPYPPPPPPPY PY   PPPPP  PPPPAPPPP P  PP P YP  Y YYP  PPY PP P   
   308  226 B G  E     -K  263   0F   4  580    2  GGGGGGGGGGGGGGGGG KG   GGGGG  GGGGGGGGG G  GG G GG  G GGG  GGG GG G   
   309  227 B I  E     -KM 262 297F   6  581   10  VVVVVVVVFVVVVVVVV VV   VVVVV  IVILVVVVV V  VV V VV  V VFI  IVF VV V   
   310  228 B Y  E     -KM 261 295F   1  581    2  YYYYYYYYYYYYYYYYY FY   YYYYY  YYYYYYYYY Y  YY Y YY  Y YYF  YYY YY Y   
   311  229 B T  E     -KM 260 294F   2  581   40  TTTTTTTGTTTTTTTTA SL   VASTA  TSTTTSTTT A  TT T TS  T ATT  AST TT A   
   312  230 B K  E >   - M   0 293F  21  581   40  KKKKKKRSKRKKKKRRS DD   NNKNN  KDRNRRNNK R  RR K KN  Q KHD  RKK KK D   
   313  231 B V  G >  S+     0   0    1  581    8  VVVVVVVVVVVVVVVVV VV   VVVVV  VVTVVVVIV V  II V VV  V VVL  VVL VV T   
   314  232 B T  G 3  S+     0   0    2  579   72  SSSSCCGLLCCCCCCGR LR   APSAA  TVSATAACR S  RR R IA  S SFR  NYL CC I   
   315  233 B A  G <  S+     0   0   29  579   80  AAAANNNANQNNNNHNY AR   VTAVY  RADHQAHKN E  NN N NA  Y NRK  RSN NN Y   
   316  234 B F  S <> S+     0   0    7  575   36  FFFFYYYAYFYYYYYYL AI   MLVLF  YLYFYVFYY Y  YY Y YL  F ALV  FFY YY Y   
   317  235 B L  H  > S+     0   0   23  573   81  VVVVVVIKVTVVVVVIR ML   RNRKK  RRILLRIVI Q  VV V IR  H IKL  IRV LV L   
   318  236 B K  H  > S+     0   0  116  572   68  PPPPDDSDDSDSDDSSD DP   SKNPD  DSSPGDPDG T  GG S PP  N EKP  SED SS D   
   319  237 B W  H  > S+     0   0   26  572    1  WWWWWWWFWWWWWWWWW WF   WWWWW  WWWWWWWWW W  WW W WF  W WWW  WWW WW W   
   320  238 B I  H  X S+     0   0    1  569   12  IIIIIIIIIIIIIIIII II   IIIII  IIIIIVIII I  II I II  V III  III II I   
   321  239 B D  H  < S+     0   0   66  541   72  KKKKQQKDKHQKQQHKN RE   IL LA  KETLSRNRA S  EE E KD    NQH  NQK RQ T   
   322  240 B R  H >< S+     0   0  136  528   71  SSSSNN QKSETNEE G EG   KR SK   ERDSKSTE S  DD G NS    NKK   SK DE E   
   323  241 B S  H >< S+     0   0    6  495   71  VVVVTT FETTTTTT V  T   TT AQ   AEIT NVT R  II I IN    TVH   LE TT N   
   324  242 B M  T 3< S+     0   0   25  452   39  TTTTII VMMIMIII M  I      IR   IVIS IMI V  II I IL     II   LI II M   
   325  243 B K  T <  S+     0   0  153  418   69  KKKKAA  EKASAAA K  E      EA   NQKA NSK S  KK Q S      DQ    G AA Q   
   326  244 B T    <         0   0   51  369   66      DA  ENASDAS    G       S   SSKS  NT    NN S N            D NA     
   327  245 B R              0   0  197  260   47      NN  E NNN      R            RR   N     KK N              E N      
## ALIGNMENTS  771 -  840
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1   49 A Q              0   0  101  253   29  K R E E   DD DEEE  E    E          EE  EE E E E E     E  EEEE  EDEEEE 
     2   50 A a    >   +     0   0   22  341    0  C CCC C   CC CCCC  C   CC C  C CC  CCC CCCCCC CCC CCCCCC CCCCC CCCCCC 
     3   51 A E  T 3  S+     0   0  187  342   77  E LSK D   EE DLDN  S   TD Q  T TT  EET DDTELE ETD GGGTET DDDDE DDEEML 
     4   52 A T  T 3  S-     0   0  105  342   54  S ESS S   AA PNST  S   TS T  T ET  SST SSTSSS STS TTTTST SSSSS SPSSKS 
     5   53 A S    <   +     0   0   89  342   62  S ADS N   QE NSDn  N   qN N  q mq  NNq NNqNNN NqS rrrqNq NNNNS NNNNny 
     6   54 A P        +     0   0   10  343   18  P PPP P   PP PPPg  P   pP P  p gp  PPp PPpPPP PpP ppppPp PPPPP PSPPng 
     7   55 A b        -     0   0   18  344    0  C CCC C   CC CCCC  C   CC C  C CC  CCC CCCCCC CCC CCCCCC CCCCC CCCCCC 
     8   56 A Q  S    S+     0   0   92  343   70  K Q.K K   QQ VNQE  Q   QK L  Q QQ  VVQ RKQVQV VQQ LLLQIQ RRRRQ RSVVNE 
     9   57 A N  S    S-     0   0   63  303   24  N NVN N   NN HNN.  S   NN H  N .N  NNN NNNNNN NNN NNNNNN NNNNN NNNN.. 
    10   58 A Q  S    S-     0   0  152  336   48  G NGG G   GG NGG.  G   GG G  G .G  GGG GGGGQG GGG GGGGGG GGGGN GGGG.. 
    11   59 A G        -     0   0   16  344   17  G GGG G   GG GGGG  G   GG G  G HG  GGG AGGGGG GGG GGGGGG GGGGG GGGGQY 
    12   60 A K  E     -A   23   0A 117  344   75  N TTT S   KK NVTT  T   QS S  Q KQ  TTQ TSQTTT TQM TTTQTQ IIIIT ITTTQQ 
    13   61 A a  E     -A   22   0A  45  344    0  C CCC C   CC CCCC  C   CC C  C CC  CCC CCCCCC CCC CCCCCC CCCCC CCCCCC 
    14   62 A K  E     -A   21   0A 155  344   82  T VeV N   TT TANT  T   mN l  m Vm  KKm TKmKqK KmK iiimKm TTTTs TTKKST 
    15   63 A X  E     +A   20   0A 120  302   29  D DtD D   DD DDDN  D   dD e  d .d  ..d ..d.d. .dD tttd.d ....d .D..NN 
    16   64 A G        -     0   0   44  341   74  Q TPG Q   EE GLVN  G   GQ G  G NG  DDG NDGDPD DGL GGGGDG NNNNE NGDDTT 
    17   65 A L  S    S-     0   0  152  342   69  V VLI E   VV IPVD  V   GE G  G IG  MMG LLGMLM MGF PPPGMG LLLLN LVMMLN 
    18   66 A G  S    S+     0   0   67  343   62  N TGN N   GG NDNG  N   GN G  G pG  ttG deGtDt tGN DDDGtG eeeeG eNttGG 
    19   67 A E        -     0   0  119  329   61  N GER D   RR SGGS  G   ED .  E sE  ggE gdEgSg gED KKKEgE gggg. gSggSS 
    20   68 A Y  E     -A   15   0A  37  342    9  Y YFY Y   YY FYYF  Y   YY Y  Y YY  YYY YYYYYY YYF YYYYYY YYYYY YYYYYY 
    21   69 A T  E     -A   14   0A  71  343   83  I TRS T   TT TLNE  N   HT S  H YH  VVH KSHVRV VHN QQQHVH VVVVK MTVVTY 
    22   70 A b  E     -A   13   0A  20  343    0  C CCC C   CC CCCC  C   CC C  C CC  CCC CCCCCC CCC CCCCCC CCCCC CCCCCC 
    23   71 A T  E     -A   12   0A  85  344   80  T TIT T   QQ TIDS  T   VT L  V EV  TTV TEVTTT TVT TTTVTV TTTTQ TTTTYS 
    24   72 A c        -     0   0   44  344    1  C CCC C   CC CCCC  C   CC C  C CC  CCC CCCCCC CCC CCCCCC CCCCC CCCCCC 
    25   73 A L    >   -     0   0   62  344   86  Q TPV P   TT PQVP  Q   LP P  L NL  RRL PPLRPR RLP AAALRL PPPPE PARRYP 
    26   74 A E  T 3  S+     0   0  177  344   74  P EPA Q   PP EAPV  S   PQ Q  P EP  EEP HQPESE EPT EEEPEP QQQQM QTEESD 
    27   75 A G  T 3  S+     0   0   29  344   24  G AGG G   GG GGGg  G   GG G  G gG  GGG GGGGGG GGG GGGGGG GGGGG GGGGgg 
    28   76 A F  E <   +B   36   0B  40  343   16  Y WWF F   FF YWYg  Y   FF Y  F aF  FFF FFFFYF FFF YYYFFF FFFFF FYFFsy 
    29   77 A E  E     +B   35   0B  74  343   63  T QTT Y   VV ETED  A   HY S  H DH  SSH EYHSKS SHT SSSHSH EEEET ETSSDD 
    30   78 A G  S >  S-     0   0   32  343    1  G GGG G   GG GGGG  G   GG G  G GG  GGG GGGGGG GGG GGGGGG GGGGG GGGGDS 
    31   79 A K  T 3  S+     0   0  156  343   72  R KKK K   YY RQDL  S   RK E  H KR  PPR SKRPRP PRK AAARPR SSSSV SMPPHT 
    32   80 A N  T 3  S-     0   0   33  343   62  N NRN N   NN FNDN  N   DN S  D TD  NND HNDNDN NDK NNNDND HHHHD HNNNTG 
    33   81 A c  S <  S+     0   0    1  344    0  C CCC C   CC CCCC  C   CC C  C CC  CCC CCCCCC CCC CCCCCC CCCCC CCCCCC 
    34   82 A E        +     0   0   87  342   30  E eEE E   EE e.Ed  E   eE E  e Se  qqe eEeqeq qeE EEEeqe eeeeR esqqie 
    35   83 A L  E    S-B   29   0B  96  289   42  . l.. V   LL m.Ni  .   .V .  . L.  ii. l..ili i.. ....i. llll. lfiiii 
    36   84 A F  E     -B   28   0B 139  292   93  . D.. S   NN t.gN  .   .S .  . I.  NN. L..NNN N.. ....N. LLLLF LqNNDN 
    37   85 A T        -     0   0   44   76   76  . ... .   .. k.d.  .   k. .  k .k  ..k ..k... .k. ...k.k ..... .e.... 
    38   86 A R        +     0   0   57  101   88  . ... .   .. G.F.  .   A. .  T .A  ..A ..A... .A. ...A.A ..... .F.... 
    39   87 A K        +     0   0   96  140   78  . ... .   .. G.L.  .   G. .  G DG  ..G ..G... .G. ...G.G ..... .K.... 
    40   88 A L        -     0   0   91  168   91  . E.. .   .. N.HE  .   P. .  P LP  ..P ..P... .P. ...P.P ..... .F..EE 
    41   89 A d  S  > S+     0   0   15  238   19  . C.. .   .. V.IC  .   C. .  C CC  ..C ..C... .C. ...C.C ..... .S..CC 
    42   90 A S  T  4 S+     0   0   98  244   86  . S.. .   .. YQID  .   E. .  E AE  ..E ..E.S. .E. ...E.E ..... .I..AA 
    43   91 A L  T >4 S-     0   0  120  274   90  K GFT .   .. LTTT  T   Q. I  H QQ  ..Q .IQ.C. .QH RRRQ.Q ..... .V..VN 
    44   92 A D  G >4 S-     0   0  107  297   62  E ITD .   .. SDEE  D   A. D  A GA  ..A .SA.S. .AN AAAA.A ....N .D..DN 
    45   93 A N  G >< S-     0   0    8  315   63  H TVI A   VV KTIN  V   GA I  G NG  ..G .AG.S. .GI EEEG.G ....L .I..NN 
    46   94 A G  G <  S-     0   0    0  316   53  N TSD M   NN HDDG  D   SM D  S HS  ..S .MS.G. .SG RRRS.S ....D .D..GG 
    47   95 A D  G <  S+     0   0   44  344   60  D PDE T   EE LEEG  E   PT D  P GP  EEP TTPEPE EPD AAAPEP TTTTD TDEEEG 
    48   96 A e    <   -     0   0    0  344    1  C CCC C   CC CCCC  C   CC C  C CC  CCC CCCCCC CCC CCCCCC CCCCC CCCCCC 
    49   97 A D  S    S-     0   0   59  344   73  E ASA A   AA ADDA  A   RA Q  R ER  AAR AARAEA ARF LLLRAR AAAAA ADAAED 
    50   98 A Q  S    S+     0   0    2  344   62  s hsg d   ss nssQ  g   nd s  n Qn  ssn ddnsns snd sssnsn dddds dpssQQ 
    51   99 A F  E     -C   62   0C   4  344   77  s trt t   yy tttT  t   qt t  q Iq  ttq ktqttt tqt sssqtq eeeet ktttNH 
    52  100 A d  E     +C   61   0C  10  344    0  C CCC C   CC CCCC  C   CC C  C CC  CCC CCCCCC CCC CCCCCC CCCCC CCCCCC 
    53  101 A H  E     -C   60   0C  68  344   86  T ICK M   EE IKNT  Q   QM I  Q VQ  IIQ RTQIHI IQV SSSQIQ WWWWV GTIIHH 
    54  102 A E  E     -C   59   0C  92  344   56  D NND E   DD DDDN  E   DE D  D SD  DDD EEDDSD DDD EEEDDD EEEED EDDDNN 
    55  103 A E  S    S-     0   0  100  344   81  R eEG k   KK KGVN  G   dk E  d Sd  DDd KSdDSD DdG tttdDd KKKKG KGDDtt 
    56  104 A Q  S    S-     0   0  175  310   77  F .NI .   II VIVV  V   g. I  g Pg  vvg dvgvqv vgV qqqgvg ddddI dVvv.. 
    57  105 A N  S    S+     0   0  154  307   78  N gGN s   NN NDNG  N   ls N  l Gl  ..l ggl.e. .lN ...l.l ggggN gN..gg 
    58  106 A S  S    S-     0   0   58  337   71  D GGG s   SS DSGS  Q   Ns S  N SN  ggN sGNggg gNR GGGNgN ssssK sSggST 
    59  107 A V  E     -C   54   0C   7  343   86  Y FYF Y   YY YFYF  F   FY F  F YF  YYF YYFYFY YFY YYYFYF YYYYY YYYYYY 
    60  108 A V  E     -C   53   0C  45  344   87  T RST S   LQ EINQ  S   TS V  T ST  KKT MSTTTK KTT EEETKT MMMMS MTKKYS 
    61  109 A e  E     +C   52   0C   5  344    0  C CCC C   CC CCCC  C   CC C  C CC  CCC CCCCCC CCC CCCCCC CCCCC CCCCCC 
    62  110 A S  E     -C   51   0C  24  344   70  K LQE R   HH YSDS  S   RR L  R AR  NNR ERRNSN NRS RRRRNR EEEEK NTNNTS 
    63  111 A f        -     0   0   23  344    0  C CCC C   CC CCCC  C   CC C  C CC  CCC CCCCCC CCC CCCCCC CCCCC CCCCCC 
    64  112 A A    >   -     0   0    8  344   70  Q TLP P   AA ALVD  A   LP L  L RL  LLL PPLLPL LLP AAALLL PPPPP PALLKD 
    65  113 A R  T 3  S+     0   0  149  344   83  P PAV P   PP PPPA  D   VP P  V AV  LLV RSVLVL LVA PPPVLV HHHHP HTLLDS 
    66  114 A G  T 3  S+     0   0   24  344   13  G QGG G   GG GGGG  G   GG S  G GG  PPG GGGPGP PGG GGGGPG GGGGG GGPPGG 
    67  115 A Y  E <   -D   78   0D  20  344    7  Y WFY Y   FF FYYY  F   FY Y  F YF  YYF YYFYFY YFF WWWFYF YYYYY YYYYYY 
    68  116 A T  E     -D   77   0D  72  343   81  T QTS M   GG TT T  D   VM G  V QV  TTV TTVTET TVS SSSVTV TTTTN TTTTTS 
    69  117 A L  E     -D   76   0D  67  340   68  G G G G   GG GG L  G   GG G  G LG  GGG GGGGGG GGG GGGGGG GGGGG GGGGML 
    70  118 A A    >   -     0   0   23  340   78  K P S S   TT KD N  T   AS A  A NA  AAA LSAAPA AAR PPPAAA LLLLT LMAADA 
    71  119 A D  T 3  S+     0   0  175  340   77  N T T N   HH DV G  L   RN T  R ER  TTR NNRTTT TRA SSSRTR NNNNL NNTTDS 
    72  120 A N  T 3  S-     0   0   92  340   74  C C C C   CC CC D  C   CC C  C DC  CCC CCCCCC CCC CCCCCC CCCCC CCCCND 
    73  121 A G  S <  S+     0   0   16  340   56  E Q E E   EE GQ G  D   EE E  E KE  EEE EEEEGE EEE SSSEEE EEEEQ ESEERG 
    74  122 A K  S    S+     0   0   71  332   83  I E I K   DD RT F  N   VK K  V KV  VVV KKVVVV VVF MMMVVV KKKKN KTVVKR 
    75  123 A A        -     0   0   22  330   70  D D D K   GE ND A  D   NK D  N TN  VVN RRNVNV VNA NNNNVN RRRRD RVVVNS 
    76  124 A f  E     -D   69   0D  12  300   48  I V I I   .. II .  I   VI .  V .V  LLV VIVLTL LV. VVVVLV VVVVL VDLL.C 
    77  125 A I  E     -D   68   0D  78  304   82  D D D D   .. ED .  D   DD .  D .D  AAD DDDADA AD. DDDDAD DDDDD DCAA.I 
    78  126 A P  E     -D   67   0D  62  304   56  E E E R   .. DL .  E   DR .  D .D  PPD KKDPNP PD. DDDDPD KKKKL KNPP.D 
    79  127 A T  S    S+     0   0  103  304   79  C C C C   .. CC .  C   CC .  C .C  CCC CCCCCC CC. CCCCCC CCCCC CSCC.I 
    80  128 A G  S    S-     0   0   32  305   75  A L A S   .. TN .  G   LS .  L .L  AAL TSLARA AL. SSSLAL TTTTE TSAA.N 
    81  129 A P  S    S+     0   0  116  311   78  G D G S   .. EP .  S   MS T  M .M  PPM SSMPDP PM. PPPMPM SSSSD SDPP.E 
    82  130 A Y  S    S+     0   0   59  312   77  N S N D   .. YN .  S   RD E  R .R  SSR LNRSHS SR. NNNRSR LLLLY LNSS.C 
    83  131 A P    >   -     0   0   17  312   34  P P P P   .. SP .  P   PP G  P .P  PPP PPPPAP PP. PPPPPP PPPPN PPPP.T 
    84  132 A g  T 3  S+     0   0   16  323    2  C C C C   .. CC C  C   CC C  C CC  CCC CCCCCC CC. CCCCCC CCCCC CCCCCA 
    85  133 A G  T 3  S+     0   0    0  295   30    Q A A   ..    D  E   AA E  A SA    A AAA E   AV SSSA A AAAAG A   SG 
    86  134 A K    <   -     0   0   69  294   62    N N N   ..    D  N   NN H  N LN    N NNN N   ND HHHN N NNNNN N   DT 
    87  135 A Q        -     0   0   37  243   74            ..    V              I       G   G    K        GGGG      ID 
    88  136 A T        +     0   0    4  220   79            ..                   D       G   G    T        GGGG       S 
    89  137 A L        +     0   0  105  200   57            LL                   L       L   I    T        LLLL         
    90  138 A E              0   0  104  120   71             S                                    G                     
    91  139 A R              0   0  231   97   28                                                  R                     
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3   I   V III  I    II III  I II I  MM   I      I   M      I     I      V
    94   17 B V  B     -E  271   0E   7  561    9   V   V VVV  M    VI VVV  V VV I  VV   I      V   V      V     V      V
    95   18 B G  S    S+     0   0   25  562    6   G   G GGG  G    GG NNN  R GG G  GG   G      G   G      G     G      G
    96   19 B G  S    S-     0   0   26  563    0   G   G GGG  G    GG GGG  G GG G  GG   G      G   G      G     G      G
    97   20 B Q  E     -F  237   0F  98  564   95   I   N DVE  V    TE KVV  S QI D  QQ   E      K   Q      Q     S      S
    98   21 B E  E     -F  236   0F  80  565   65   E   E SEA  E    ED QEE  V DE K  DD   E      E   D      D     P      R
    99   22 B h        -     0   0    8  565   58   S   S IAT  A    AA STT  V AA A  AA   A      A   A      A     S      V
   100   23 B K    >   -     0   0  123  564   79   A   T SKT  V    DG TTT  R TE Q  QQ   K      P   M      P     L      S
   101   24 B D  T 3  S+     0   0   60  565   85   N   P IKA  Q    PQ III  P PE P  EE   P      R   E      P     L      I
   102   25 B G  T 3  S+     0   0    0  565   73   G   H QHE  G    GG EEE  H RE G  GG   G      S   G      G     G      G
   103   26 B E  S <  S+     0   0   36  565   67   A   V SSE  S    TV AKN  S EE N  EE   N      K   E      H     E      D
   104   27 B h    >   +     0   0    4  565   91   W   W VIY  W    IF RRR  L FW F  WW   F      W   W      W     W      H
   105   28 B P  T 3   +     0   0    0  567    9   P   P PPP  P    PP PPP  P PP P  PP   P      P   P      P     P      P
   106   29 B W  T 3  S+     0   0    5  568   27   W   W WWY  W    WW YYY  W WW W  WW   W      W   W      W     W      W
   107   30 B Q  E <   -N  122   0G   7  569   24   q   T qQV  Q    qQ QQQ  q Mq Q  QQ   Q      q   Q      m     Q      A
   108   31 B A  E     -NO 121 146G   1  559   47   l   V sVV  V    wV VVV  i Vr .  VV   .      l   V      l     V      V
   109   32 B L  E     -NO 120 145G   3  567   65   F   Q IMS  S    DS SSS  D SI A  SS   A      R   S      N     S      Y
   110   33 B L  E     -NO 119 144G   0  570   11   L   L LVL  L    VL LLL  N IM F  II   F      L   I      I     L      L
   111   34 B I  E     -NO 117 143G   0  570   81   N   I WSR  K    RQ QQQ  K TR I  QQ   T      H   Q      T     R      A
   112   35 B N  E >   - O   0 142G  30  570   88   G   y FKF  L    PM kdK  s RR R  RR   N      D   R      S     W      D
   113   36 B E  T 3  S+     0   0   63  113   77   .   e ...  .    T. anE  d .G .  ..   .      Q   .      D     .      S
   114   37 B E  T 3  S-     0   0  136  242   76   .   T ..R  Y    RN GSR  D KS V  NN   .      Y   N      G     Q      S
   115   38 B N  S <  S+     0   0   84  543   52   T   K GGD  G    NG GGG  A GW Q  GG   .      W   G      V     G      G
   116   39 B E        -     0   0  100  561   93   H   I ENK  G    RR RNS  E GK G  SS   I      M   S      E     N      N
   117   40 B G  E     +N  111   0G  14  572   55   H   H HSH  H    HH HHH  D HH R  HH   H      H   H      K     H      Q
   118   41 B F  E     +     0   0G  28  581   35   R   R FLI  V    FI FFF  t FL S  FF   g      F   F      w     V      F
   119   42 B i  E     -N  110   0G   0  578    1   C   C CCC  C    CC CCC  c CC .  CC   g      C   C      c     C      C
   120   43 B G  E     -N  109   0G   1  581    2   G   G GGG  G    GG GGG  G GG G  GG   G      G   G      G     G      G
   121   44 B G  E     -N  108   0G   0  581    9   G   A AGG  G    GG GGG  G GA G  GG   G      G   G      G     G      G
   122   45 B T  E     -NP 107 130G   0  581   43   S   A AST  T    AT SSS  S TS A  SS   A      S   S      T     S      T
   123   46 B I  E     + P   0 129G   0  581   23   V   L ILI  L    LL III  L IL L  LL   L      L   L      I     I      L
   124   47 B L        -     0   0    6  581   27   I   L YLV  L    VL III  L LI L  II   L      I   I      L     I      V
   125   48 B S  S    S-     0   0   22  581   57   K   S SNS  A    NS SSS  k NH G  AA   G      H   T      N     S      A
   126   49 B E  S    S+     0   0   99  581   62   S   D EKN  R    SN EEE  s DP D  EE   D      P   E      S     G      P
   127   50 B F  S    S+     0   0   42  581   82   Q   D DFR  D    QE DDD  N KN R  RR   R      Q   Q      E     Q      T
   128   51 B Y  E     - Q   0 185G   7  581   33   W   I IWY  W    WF III  I FW W  WW   W      W   W      W     W      K
   129   52 B I  E     -PQ 123 184G   0  581   14   V   I VVI  V    VV VIV  V II V  VV   I      V   V      V     I      V
   130   53 B L  E     +PQ 122 183G   0  581   28   V   I IVL  V    VL VVV  L LL L  LL   L      L   L      L     L      L
   131   54 B T  E     - Q   0 182G   0  581   43   T   T TTS  T    TT TTT  T TT T  TT   T      T   T      T     S      T
   132   55 B A    >>  -     0   0    0  581    2   A   A AAA  A    AA AAA  A AA A  AA   A      A   A      A     A      A
   133   56 B A  G >4 S+     0   0    0  581    8   A   A AAA  A    AA AAA  A GG A  AA   A      A   A      A     A      A
   134   57 B H  G >4 S+     0   0    7  581    0   H   H HHH  H    HH HHH  H HH H  HH   H      H   H      H     H      H
   135   58 B i  G X4 S+     0   0    0  581    2   C   C CCC  C    CC CCC  C CC I  CC   T      C   C      C     C      C
   136   59 B L  G << S+     0   0   31  581   65   F   F LLL  V    IL LVV  L LF F  FF   I      V   F      W     F      T
   137   60 B Y  G <  S+     0   0  109  581   87   S   S TPV  A    VR QTA  Y CG R  SS   Y      G   Y      V     L      G
   138   61 B Q  S <  S+     0   0   95  581   78   k   r ksq  D    Es rgy  a sl p  nn   p      p   n      t     l      a
   139   61AB A        -     0   0   16  352   75   p   p sap  .    .a ppl  k ip l  tt   n      l   t      i     s      p
   140   62 B K  S    S-     0   0  172  366   75   R   A ENF  .    .K SSS  S GS E  SS   P      A   S      R     I      T
   141   63 B R  S    S-     0   0  162  570   78   H   R YTL  .    .L DQE  N QN Q  LL   S      N   L      R     R      I
   142   64 B F  E     -O  112   0G  36  577   54   W   Y LVL  .    .Y LLL  I LY V  YY   N      L   Y      S     L      A
   143   65 B K  E     -O  111   0G  67  577   78   Q   T STT  .    .T QKQ  T RM D  QQ   D      R   R      M     Q      R
   144   66 B V  E     -OR 110 161G   0  577   16   V   V VVI  .    .V VVV  V VI V  VV   I      V   V      V     I      V
   145   67 B R  E     -OR 109 160G  40  577   53   R   L RRI  .    .R RRR  V TQ F  LL   F      Q   L      W     I      V
   146   68 B V  E     +OR 108 159G   1  578   43   L   I VLA  .    .V LLL  L LL L  LL   L      L   L      I     V      V
   147   69 B G  S    S+     0   0    9  578   14   G   G GGG  .    .G GGG  G GR G  GG   G      R   G      G     C      G
   148   70 B D        +     0   0   11  579   58   E   G SKT  H    .E SSS  V EQ H  AA   H      E   A      S     S      R
   149   71 B R  S    S+     0   0   24  579   73   H   H SHS  H    .W TTT  H HQ T  RR   T      Q   R      Y     R      E
   150   72 B N  B >   -T  234   0H  18  579   65   S   E YKS  R    .H YYY  N NN D  QQ   N      H   Q      S     N      D
   151   73 B T  T 3  S+     0   0   56  579   79   F   I TLK  T    .L HNN  R LL L  LL   I      L   L      L     G      K
   152   74 B E  T 3  S-     0   0  119  579   84   H   G RIQ  E    .Q DNN  L RY E  VV   E      Y   L      R     K      T
   153   75 B Q  S <  S-     0   0  130  578   86   K   S YSE  K    .S EEE  I AE E  QQ   E      Y   Q      K     E      D
   154   76 B E        +     0   0  165  578   85   N   G GEI  D    .G GGG  K PG i  PP   i      Q   P      A     d      a
   155   77 B E        -     0   0   93  438   29   D   . ...  .    .S ...  E E. l  ..   l      .   .      .     k      q
   156   78 B G  S    S+     0   0   46  547   33   R   . GPG  S    .G GGG  S V. G  GG   G      .   G      .     W      G
   157   79 B G  S    S+     0   0   47  555   76   T   . QND  P    .Q MII  N p. A  pp   H      .   p      S     t      E
   158   80 B E        -     0   0   37  444   33   E   . .Q.  Q    .D ...  Q aD .  aa   .      D   s      A     h      .
   159   81 B A  E     -R  146   0G  27  457   60   K   E .Q.  Q    .V ...  M RN .  MM   .      Q   I      R     A      .
   160   82 B V  E     -R  145   0G  71  557   81   I   S VD.  D    .A LVV  V HL .  YY   .      L   Y      Y     G      A
   161   83 B H  E     -R  144   0G  14  567   77   L   Y VIV  I    .V AVV  R EL H  AA   H      L   A      M     S      L
   162   84 B E        -     0   0   90  569   77   K   R RVY  G    .A GGG  K SP P  RR   P      P   H      A     I      P
   163   85 B V  E     -S  186   0G  27  574   64   V   I VAF  V    .E VVV  V VL V  VV   V      V   V      V     Y      V
   164   86 B E  E    S+     0   0G  70  575   73   A   R AAV  T    .G KKK  A IE R  RR   R      S   K      L     K      V
   165   87 B V  E     -S  185   0G  13  576   72   Q   N RAQ  K    .G SAA  D NQ R  RR   R      R   R      Y     S      G
   166   88 B V  E     -S  184   0G  72  577   45   I   I FIF  A    .I FLM  V AI V  VV   V      I   V      V     G      V
   167   89 B I  E     +S  183   0G  27  578   45   K   S LYP  I    .R KKK  K VI V  EE   I      I   E      I     L      W
   168   90 B K  E     -S  182   0G  68  578   82   I   I IIV  V    .K YYY  I LV I  SS   I      V   S      T     P      R
   169   91 B H    >   -     0   0   19  579   14   H   H HHL  H    .H HHH  H HH H  NN   H      H   N      H     L      H
   170   92 B N  T 3  S+     0   0  156  579   60   P   P EPH  E    .P EEE  S PP P  PP   P      P   P      P     E      p
   171   93 B R  T 3  S+     0   0  150  576   74   R   L KQT  G    .Q KKK  S G. D  LL   D      Q   L      D     Q      .
   172   94 B F    <   -     0   0   24  579    5   Y   F YYF  Y    .F FYF  F HY Y  YY   Y      F   Y      F     Y      .
   173   95 B T     >  -     0   0   56  579   67   i   N HSN  d    .N GDD  S kF R  QQ   R      Y   Q      k     s      .
   174   96 B K  T  4 S+     0   0  145  525   79   n   . ...  t    .. .RG  . g. P  ..   .      .   .      h     q      h
   175   97 B E  T  4 S+     0   0  174  533   92   N   . R..  S    .. MDD  . KA D  ..   .      .   .      N     K      Q
   176   98 B T  T  4 S-     0   0   44  561   58   S   V T.A  S    .R RLI  . YD D  ..   .      A   .      G     I      S
   177   99 B Y    ><  +     0   0   60  566   66   H   F M.N  N    .V LLL  L VV P  ..   .      V   .      Y     Y      A
   178  100 B D  T 3   +     0   0   25  578   38   p   m Std  N    .r MWW  d Dr d  gg   Q      q   g      V     t      e
   179  101 B F  T 3  S+     0   0   21  558   68   y   f Nkn  .    .f YYY  y .f f  ..   d      a   .      N     y      s
   180  102 B D    <   +     0   0    1  577    0   D   D DDD  D    .d DDD  D DD d  dd   d      D   d      D     d      D
   181  103 B I        +     0   0    0  579   14   I   V III  I    .I III  I IL I  VV   I      I   V      L     I      V
   182  104 B A  E     -QS 131 168G   0  579   60   A   A AGA  A    .A AAA  A AA A  AA   A      A   A      A     A      A
   183  105 B V  E     -QS 130 167G   0  580   15   L   I VLL  L    .L VVI  I LL L  LL   L      L   L      L     L      V
   184  106 B L  E     -QS 129 166G   0  581   30   V   A MIL  L    .L ILL  L LL L  VV   L      L   V      V     V      V
   185  107 B R  E     -QS 128 165G  40  581   42   R   R RKR  R    .K KKK  L EK E  EE   E      E   E      R     K      T
   186  108 B L  E     - S   0 163G   0  581   17   L   L LLT  L    .L LLL  L FL L  LL   L      L   L      L     S      L
   187  109 B K  S    S+     0   0  101  581   69   S   H QSS  S    .W DED  N AE E  EE   E      E   E      K     S      G
   188  110 B T  S    S-     0   0   82  582   74   R   G SRS  S    AT QKK  E RS D  AA   N      E   A      K     K      R
   189  111 B P        -     0   0   48  582   39   S   K KAN  S    Es APP  P PP G  PP   S      P   P      K     S      a
   190  112 B I        -     0   0    4  532   62   V   L .AI  A    Vv V..  V IA V  VV   V      V   V      I     I      s
   191  113 B T        -     0   0   95  537   72   K   N .TR  T    LD K..  E SQ K  TT   T      N   T      T     I      P
   192  114 B F        +     0   0   56  580   32   L   F ILY  Y    YL QVV  F WL L  FF   L      V   F      F     F      L
   193  115 B R  B >   -U  196   0I  52  581   64   G   S SSH  T    Ts Skk  N ST G  TT   G      S   T      S     S      G
   194  116 B M  T 3  S+     0   0   29  564   77   R   E .DN  .    Dt Sss  D EE P  NN   P      S   N      R     E      .
   195  117 B N  T 3  S+     0   0   13  572   89   H   N .QK  .    YH TTT  Y SN D  YY   N      H   Y      G     R      .
   196  118 B V  B <   +U  193   0I   0  574   26   V   V .VV  .    IV VII  V VI L  II   L      V   I      V     I      .
   197  119 B A        -     0   0    1  576   81   S   L .TQ  .    LG RRR  R KQ L  LL   L      H   L      A     Q      .
   198  120 B P        -     0   0    8  576   54   P   P .SP  .    PP YYY  P PP P  PP   P      T   P      P     P      .
   199  121 B A        -     0   0    2  577   39   I   I .IA  N    VA III  V AV I  VV   I      V   V      V     V      .
   200  122 B g  B     -g  290   0F   1  578   67   C   C .CE  Y    CC EEE  C CT C  CC   C      T   C      R     C      .
   201  123 B L        -     0   0   27  580    5   T   L .LL  V    LL LMM  I LL L  LL   L      L   M      L     L      L
   202  124 B P        -     0   0    7  581   31   P   P .PT  S    PP TAA  P PP P  PP   P      P   P      P     P      A
   203  124AB E     >  -     0   0   92  580   75   D   M .KD  P    SP KKK  S VS D  DD   D      P   D      N     R      D
   204  125 B R  H  > S+     0   0  109  580   79   N   L .SR  A    VA EKK  K AS P  PP   N      A   P      P     F      D
   205  126 B D  H  > S+     0   0  124  580   85   F   E .TD  C    GL TVV  T TS A  SS   E      L   S      T     G      P
   206  127 B W  H  >>S+     0   0    4  580   87   K   P .DI  L    RS PPP  T GQ N  VV   T      E   V      N     Q      A
   207  128 B A  I  X>S+     0   0    0  580   75   F   S .NN  P    AS KKK  Y KI V  II   F      T   V      T     I      L
   208  129 B E  I  <5S+     0   0   75  581   83   F   T .FT  A    RA TTT  N PF S  FF   Y      F   F      F     F      Y
   209  130 B S  I  <5S+     0   0   70  582   65   K   A GPD  R    Rd GGG  E gT Y  EE   d      P   E      S     S      E
   210  131 B T  I  <5S+     0   0   18  104   77   .   . ..K  .    Lh ...  R s. .  ..   s      .   T      .     P      .
   211  131AB L  I ><  S-     0   0  119  478   80   A   . .aK  .    V. FFF  s .g .  ..   .      d   .      d     v      S
   227  146 B E  T 3  S+     0   0   47  513   76   W   E .FY  .    E. TVS  E .V .  ..   .      V   .      V     E      E
   228  147 B K  T 3  S+     0   0  169  537   69   N   S .GT  .    G. NSV  N KH .  ..   .      R   .      P     G      Q
   229  149 B G  S <  S-     0   0   29  548   67   G   G .GG  .    GN CCC  A YL .  ..   .      L   .      L     G      G
   230  150 B R        -     0   0  213  557   86   S   S .NP  .    PQ HPP  E KY R  ..   .      P   .      P     P      A
   231  151 B Q  B     -V  224   0J  79  563   93   A   F LLT  .    YL ALL  L RP L  ..   .      P   .      N     V      T
   232  152 B S        -     0   0   14  569   51   S   S APA  .    SA SSS  S AP S  ..   .      P   .      P     S      S
   233  153 B T  S    S+     0   0   48  570   73   P   S KTE  .    ND RPP  S DY D  ..   .      Y   .      E     A      R
   234  154 B R  B    S-T  150   0H 102  570   86   V   K SAY  .    VQ VVV  V VT Q  ..   .      P   .      T     I      Y
   235  155 B L        -     0   0    3  578    3   L   L LLL  .    LL LLL  L LL L  LL   .      L   L      L     L      L
   236  156 B K  E     -FH  98 221F  31  578   51   R   R LQQ  .    KQ MMM  Q QR K  QQ   .      Q   Q      Q     R      R
   237  157 B M  E     -FH  97 220F  18  579   94   E   E GKK  .    KK EEE  Q KK Y  KK   .      E   K      Q     E      G
   238  158 B L  E     - H   0 219F   4  580   42   A   T VVT  .    VV VVV  A VV V  LL   V      V   L      L     A      V
   239  159 B E  E     - H   0 218F 107  580   72   W   H SVE  .    LT EEE  T EQ R  AA   R      E   A      Q     R      T
   240  160 B V  E     - H   0 217F   0  580   46   V   V VVL  .    IG LVV  V VV L  VV   L      V   V      L     V      V
   241  161 B P  E     - H   0 216F  34  580   26   D   P DPN  .    PS GTT  P RP P  PP   P      P   P      P     Q      P
   242  162 B Y  E     -J  263   0F  36  581   45   L   I III  I    RI FFF  I VV V  II   V      I   I      I     L      V
   243  163 B V  E     -J  262   0F  24  582   35   S   I VVV  M    VW LLL  M VM A  II   A      V   I      V     I      V
   244  164 B D     >  -     0   0   88  581   58   V   P DSD  N    ST EEE  S TD A  DD   D      E   D      L     T      S
   245  165 B R  H  > S+     0   0   51  581   79   F   I QNY  R    QT RRR  D NA R  TT   R      N   T      Q     R      D
   246  166 B N  H  > S+     0   0  105  582   75   D   V HPN  D    GD QEE  K AL D  PP   E      Q   P      S     R      E
   247  167 B S  H  > S+     0   0   48  582   78   V   V QIT  K    RD DDD  E VT T  KK   A      L   K      V     D      S
   248  168 B j  H  X S+     0   0    1  582    2   C   C CCC  C    CL CCC  C CC C  CC   C      C   C      C     C      C
   249  169 B K  H >< S+     0   0   88  582   73   f   n RnK  n    rn aaa  s dd q  nn   r      d   n      K     n      A
   250  170 B L  H 3< S+     0   0  150  547   89   r   h Re.  k    ag yyy  s qd h  gg   k      g   s      .     s      A
   251  171 B S  H 3< S+     0   0   23  578   76   S   Y SSR  Y    HR FLL  N GS R  YY   K      D   F      E     F      S
   252  172 B S    <<  -     0   0   20  581   83   Y   F YYE  M    PF YYY  R KS R  QQ   S      S   Q      K     Y      Y
   253  173 B S  S    S+     0   0   79  581   83   A   G GNW  N    QS GGG  I SE A  PP   N      F   P      Y     Y      S
   254  174 B F  S    S-     0   0  124  581   79   G   R KGT  G    YR DEE  L FR D  KK   D      R   K      P     G      L
   255  175 B I        -     0   0  100  582   88   K   V RGF  Q    DF DQQ  Y SI V  TT   V      I   A      E     S      F
   256  176 B I        -     0   0   13  582   16   I   D IVI  V    VL III  S VI F  II   F      V   I      L     I      R
   257  177 B T    >   -     0   0   16  582   36   G   P TAN  S    TP KKK  P EL S  KK   S      R   K      T     T      P
   258  178 B Q  T 3  S+     0   0  133  582   68   K   L KSQ  P    RN EEE  I TD Q  SS   Q      D   D      D     P      E
   259  179 B N  T 3  S+     0   0   24  582   61   R   S DHG  N    NN TTT  T KN N  DD   N      D   D      N     R      A
   260  180 B M  E <   - K   0 311F   2  582   11   F   M MMH  M    MA MMM  M QM M  MM   M      M   M      M     M      M
   261  181 B F  E     - K   0 310F   8  581   34   I   I ILI  L    FV VVV  L ML F  LL   F      L   L      L     L      V
   262  182 B j  E     +JK 243 309F   1  582    0   C   C CCC  C    CG CCC  C CC C  CC   C      C   C      C     C      C
   263  183 B A  E     +JK 242 308F   0  582   27   A   A AAV  A    AF AGG  A AA A  AA   S      A   A      A     A      A
   264  184 B G  S    S-     0   0    3  582   10   G   G AGG  G    GG YYY  G GG G  GG   g      G   G      G     G      G
   265  185 B Y        -     0   0   56  561   58   Y   . AFS  Y    R. AAA  . W. .  FF   l      S   F      .     Y      V
   266  185AB D  S    S-     0   0   81  565   84   R   . PGT  D    PD KKK  . E. .  EE   K      E   A      .     L      P
   267  185BB T  S    S+     0   0   76  582   62   E   S GNV  E    Gt EEE  k ET d  EE   Q      K   E      d     S      E
   268  186 B K  S    S-     0   0  107  532   32   G   G .G.  G    Gg ...  g GI q  GG   .      .   G      g     G      G
   269  187 B Q  S    S+     0   0  102  537   37   G   G .GQ  G    GG ...  S GY R  KK   .      .   K      G     K      G
   270  188 B E        +     0   0   33  581   54   I   A KKQ  R    EF KKK  S KR Q  KK   .      H   K      K     V      L
   271  189 B D  B     -E   94   0E   7  582    3   D   D DDG  D    DS DDD  D DD D  DD   D      D   D      G     D      D
   272  190 B A        -     0   0    7  582   42   A   A AAS  A    AA SAA  S SA A  AA   A      S   A      P     S      T
   273  191 B k    >   -     0   0    7  582    0   C   C CCC  C    CC CCC  C CC C  CC   C      C   C      C     C      C
   274  192 B Q  T 3  S+     0   0   90  582   25   A   Q TQL  Q    DK QQQ  Q WQ Q  KK   Q      Q   K      K     K      Q
   275  193 B G  T 3  S+     0   0    6  582    7   Y   G GGG  G    GG GGG  G AG G  GG   G      G   G      G     G      G
   276  194 B D    X   +     0   0    0  582    0   D   D DDD  D    DD DDD  D DD D  DD   D      D   D      D     D      D
   277  195 B S  T 3  S+     0   0   14  582    1   S   S SSS  S    SS SSS  S SS S  SS   S      S   S      Y     S      S
   278  196 B G  T 3  S+     0   0    0  582    0   G   G GGG  G    GG GGG  G GG G  GG   G      G   G      G     G      G
   279  197 B G    <   -     0   0    0  582    2   G   G GGG  G    GG GGG  G GG G  GG   S      G   G      G     G      G
   280  198 B P  E     - L   0 294F   1  582    3   P   P PPP  P    PP PPP  P PP V  PP   A      P   P      P     P      P
   281  199 B H  E     -IL 219 293F   0  582   49   L   L LLL  L    FL LFF  L LL F  LL   F      L   L      L     L      L
   282  200 B V  E     -IL 218 291F   3  582   27   M   M VFI  V    TV VVV  I MV A  VV   A      V   V      L     V      V
   283  201 B T  E     - L   0 290F   0  582   67   C   C SCA  C    VC GAA  C VC V  CC   V      C   C      C     C      A
   284  202 B R  E     + L   0 289F  99  582   70   P   Y GKN  N    FP EDE  K GN Q  LL   W      K   F      Y     Q      G
   285  203 B F  E >  S- L   0 288F  22  582   70   g   s GtD  Y    Dk GGG  a sV d  VV   d      V   M      G     D      G
   286  204 B K  T 3  S-     0   0   85  206   71   d   r .h.  S    Es ...  t aQ s  GG   r      N   N      D     E      .
   287  205 B D  T 3  S+     0   0  108  208   57   N   Q .N.  G    DG ...  G GD D  QQ   D      G   Q      S     G      .
   288  206 B T  E <   - L   0 285F   3  218   75   R   R .Q.  K    RA ...  Q PF R  SS   V      T   T      G     V      .
   289  207 B Y  E     - L   0 284F  21  227   50   W   W .W.  W    EY ...  W LW W  WW   W      W   W      F     W      .
   290  208 B F  E     -gL 200 283F   0  582   91   L   E QSR  T    YD KKK  V ML V  LL   I      L   V      V     R      R
   291  209 B V  E     + L   0 282F   1  582   41   L   L LLL  L    LV LLL  Q VQ A  QQ   A      Q   Q      Q     L      L
   292  210 B T  E     +     0   0F   1  582   84   A   Q VVI  D    LV VVV  F IA S  AA   T      A   A      V     V      I
   293  211 B G  E     -ML 312 281F   0  582    0   G   G GGG  G    GG GGG  G GG G  GG   G      G   G      G     G      G
   294  212 B I  E     -ML 311 280F   0  582   19   I   V ILI  I    VV VAV  I VI I  VV   I      V   V      I     I      V
   295  213 B V  E     +M  310   0F   7  582   14   V   V VVI  V    VV VVV  T VV V  II   V      V   I      M     V      T
   296  214 B S  E     -     0   0F   1  581    0   S   S SSS  S    SS SSS  S SS S  SS   S      S   S      S     S      S
   297  215 B W  E     -M  309   0F  45  582    8   W   W FWF  W    WF WWW  F TF W  WW   W      W   W      Y     W      W
   298  216 B G        -     0   0   26  582    0   G   G GGG  G    Gg GGG  G GG G  GG   G      G   G      g     G      G
   299  217 B E  S    S-     0   0   25  577   90   E   H AD.  Y    Df ELE  I IE I  EE   I      E   E      g     I      E
   300  218 B G  S    S-     0   0   19  580   15   K   G EGK  G    GR GGR  G GN G  GG   G      G   G      G     G      G
   301  220 B k  S    S-     0   0    7  582    2   C   C CCM  C    CC CCC  C CC C  CC   C      C   C      C     C      C
   302  221 B A  S    S+     0   0    4  581   17   A   G AAC  A    AS AAA  G SG G  AA   G      A   A      A     G      A
   303  222 B R    >   -     0   0  105  578   74   M   R LKA  Q    L. QML  R RA .  RR   .      L   R      L     R      R
   304  223 B K  T 3  S+     0   0  152  578   65   P   N PPA  A    A. RDD  M SP .  QQ   .      P   Q      P     P      K
   305  223AB G  T 3  S+     0   0   26  582   58   Y   N QNG  Y    GG GGG  F RH K  NN   K      N   N      G     N      G
   306  224 B K    <   -     0   0   43  582   85   K   I FKK  K    KK YYY  Y LR G  RR   G      R   R      Q     R      K
   307  225 B Y        -     0   0   33  582   49   Y   P PYP  P    FP PPP  P PP Y  PP   Y      P   P      P     P      P
   308  226 B G  E     -K  263   0F   4  580    2   G   G GGD  G    GG GGG  G GG G  GG   G      G   G      G     G      G
   309  227 B I  E     -KM 262 297F   6  581   10   V   V VVV  I    VI VVV  I II F  VV   F      I   V      V     V      V
   310  228 B Y  E     -KM 261 295F   1  581    2   Y   Y YYG  Y    YF YYY  Y YY Y  YY   Y      Y   Y      Y     Y      Y
   311  229 B T  E     -KM 260 294F   2  581   40   T   A ATT  T    TT AAA  T VT T  II   T      T   I      T     S      A
   312  230 B K  E >   - M   0 293F  21  581   40   N   K NRR  R    RE DDD  R RS N  RR   K      R   R      Q     N      R
   313  231 B V  G >  S+     0   0    1  581    8   V   I VVV  V    LV VVV  V VV V  VV   L      V   V      V     V      V
   314  232 B T  G 3  S+     0   0    2  579   72   N   R ATF  T    HA AAA  S SP L  TT   L      T   T      S     T      S
   315  233 B A  G <  S+     0   0   29  579   80   E   A EDY  Q    KA AAA  V DA K  AA   N      Y   S      K     A      T
   316  234 B F  S <> S+     0   0    7  575   36   F   V LFY  F    FY LLL  F YF Y  HH   Y      Y   H      Y     L      Y
   317  235 B L  H  > S+     0   0   23  573   81   M   T KVS  V    FR ARR  Y VV V  HH   V      L   H      L     L      R
   318  236 B K  H  > S+     0   0  116  572   68   P   S PDD  S    AN DDN  T PD A  NN   D      D   D      R     D      A
   319  237 B W  H  > S+     0   0   26  572    1   W   W WWW  W    WW WWW  W WW W  WW   W      W   W      Y     W      A
   320  238 B I  H  X S+     0   0    1  569   12   I   V III  I    II IIV  I II I  II   I      I   I      I     I      I
   321  239 B D  H  < S+     0   0   66  541   72   R   N LGR  N     D      D TQ Q  HH   K      H   H      N            V
   322  240 B R  H >< S+     0   0  136  528   71   G   S SQS  N     E      K QS E  RR   K      R   R      D            E
   323  241 B S  H >< S+     0   0    6  495   71   S   Q ATY  K     I      A EQ V  II   E      Y   I      Y            Q
   324  242 B M  T 3< S+     0   0   25  452   39   L   M IIM  M     M      V VI V  II   M      V   I      I            L
   325  243 B K  T <  S+     0   0  153  418   69   K   K QA   A     E      S Q  G  PP   G      P   P                   H
   326  244 B T    <         0   0   51  369   66          A   A     S      E S  E  QQ   E      E   E                   T
   327  245 B R              0   0  197  260   47          N   N              R          E      K                        
## ALIGNMENTS  841 -  910
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1   49 A Q              0   0  101  253   29      E  EEE QQQQQ   K       E NDEE    EEE E      E      E        NE   E
     2   50 A a    >   +     0   0   22  341    0  CCCCC  CCCCCCCCC   C CC    CCCCCC  CCCCC C CC   C CCC CC C C    CCCCCC
     3   51 A E  T 3  S+     0   0  187  342   77  ETEDE  DDDTAAAAA   K KR    VAEALL  TTEWA L LL   A TTT TW E S    DAEDAL
     4   52 A T  T 3  S-     0   0  105  342   54  HTNSS  SSSTSSPSP   S AT    SSGAAS  SSSTS M SS   S STK NT T F    TSPSST
     5   53 A S    <   +     0   0   89  342   62  nqNNN  NSSqTTTTT   S si    NNDVaS  qqSSN D SS   N qqq hS A g    NNNSIl
     6   54 A P        +     0   0   10  343   18  ppPPP  PPPpTTTTT   P pp    PP.VgPP ppPPP P PP   P ppp pP V s    PPPPPg
     7   55 A b        -     0   0   18  344    0  CCCCC  CCCCCCCCC   C CC    CCCCCCC CCCTC C CC   C CCC CS C C    CCCCCC
     8   56 A Q  S    S+     0   0   92  343   70  QQLRV  RKKQAAAAA   K LQ    QQpQDEQ QQLrQ G QQ   Q QQQ Lr n D    LLGVQS
     9   57 A N  S    S-     0   0   63  303   24  NNHNN  NNNNNNNNN   N NN    NNnN.NQ NNNcN . NN   N NNN Nc n .    NNNNN.
    10   58 A Q  S    S-     0   0  152  336   48  GGGGG  GGGGGGGGG   A GG    GGGG.NG GGGQG S QQ   G GGG GQ G .    GGNGQ.
    11   59 A G        -     0   0   16  344   17  AGGGG  GGGGGGGGG   G GL    GGGGHAG GGGHA G GG   A GGG GH G H    GGGAGQ
    12   60 A K  E     -A   23   0A 117  344   75  GQTIT  ILLQIIIII   T ST    TTQTATQ QQTTI E SS   I QQK TT V H    TTETIV
    13   61 A a  E     -A   22   0A  45  344    0  CCCCC  CCCCCCCCC   C CC    CCCCCCC CCCCC C CC   C CCC CC C C    CCCCCC
    14   62 A K  E     -A   21   0A 155  344   82  vvkTK  TTTmSSSSS   V Th    EEDHTTT vvIER I qq   R vmv fE V V    TTeqsV
    15   63 A X  E     +A   20   0A 120  302   29  ddn..  .DDdVVVVV   D Nt    DDHDND. ddDND N dd   D dde tN . N    DDensN
    16   64 A G        -     0   0   44  341   74  GGGND  NHHGGGGGG   G GG    SENGTYD GGQTR K PP   R GGG GT . M    GGPGQT
    17   65 A L  S    S-     0   0  152  342   69  DGTLM  LDDGTTTTT   I AP    VVTEALT GGILV M LL   V GGD QL . L    VVGFSP
    18   66 A G  S    S+     0   0   67  343   62  GGMet  eKKGRRRRR   N SY    NNGDGGg GGGGN G DD   N GGG GG R N    NNgDtG
    19   67 A E        -     0   0  119  329   61  EK.gg  gSSESSSSS   Q NS    GG.SSGs EEGSE S SS   E EEE LS P G    SSeSaS
    20   68 A Y  E     -A   15   0A  37  342    9  YYYYY  YYYYLLLLL   Y YN    YY.YFYY YYYYY Y YY   Y YYY YY N F    FYRFYY
    21   69 A T  E     -A   14   0A  71  343   83  SHGRV  MTTHSSSSS   S IN    TTETYRT HHQRS T RR   S HHH TR T Y    TTVTTN
    22   70 A b  E     -A   13   0A  20  343    0  CCCCC  CCCCCCCCC   C CC    CCCCCCC CCCCC C CC   C CCC CC C C    CCCCCC
    23   71 A T  E     -A   12   0A  85  344   80  LVSTT  TTTVSSSSS   T TT    TTTESTD VVISF T AA   F VVV TS S T    AAKEVS
    24   72 A c        -     0   0   44  344    1  CCCCC  CCCCCCCCC   C CC    CCCCCCC CCCCC C CC   C CCC CC C C    CCCCCC
    25   73 A L    >   -     0   0   62  344   86  SLDLR  PLLLPPPPP   V RL    AAAAGLP LLGAV H PP   V LPP PA P K    AELSRN
    26   74 A E  T 3  S+     0   0  177  344   74  EPQQE  QPPPLLLLL   A PP    PPPVAAS PPRSP E SS   P PPP PM S E    AAPEEA
    27   75 A G  T 3  S+     0   0   29  344   24  GGGGG  GDDGGGGGG   G GG    GGGGgGG GGGgG g GG   G GGG Gg G g    GGGGGg
    28   76 A F  E <   +B   36   0B  40  343   16  FFFFF  FFFFFFFFF   F YY    YYFYvFY FFFaF f YY   F FFF Fe F a    YYFFFs
    29   77 A E  E     +B   35   0B  74  343   63  HHAES  EEEHSSSSS   T RT    DEMEDTT HRNDQ D KK   Q HHH TD Y D    STLESI
    30   78 A G  S >  S-     0   0   32  343    1  GGGGG  GGGGGGGGG   G GG    GGGGGGG GGGGG N GG   G GGG GG G G    GGGGGG
    31   79 A K  T 3  S+     0   0  156  343   72  KRESP  STTREEEEE   K NI    DVDDFVE RRKKY Q RR   Y RHH TK P K    DDEDTQ
    32   80 A N  T 3  S-     0   0   33  343   62  DDNHN  HHHDYYYYY   N RN    DHNHTHN GGRHN T DD   N GDN DH Q T    ITYMRD
    33   81 A c  S <  S+     0   0    1  344    0  CCCCC  CCCCCCCCC   C CC    CCCCCCC CCCCC C CC   C CCC CC C C    CCCCCC
    34   82 A E        +     0   0   87  342   30  eeEeq  eeeeEEEEE   E Et    DEeEdEQ eeHEE Q ee   E eee eE Q q    GgEeed
    35   83 A L  E    S-B   29   0B  96  289   42  ...li  lll.VVVVV   T .l    .Sg.i.I ..... . ll   . ... l. R i    .iIili
    36   84 A F  E     -B   28   0B 139  292   93  ...LN  LLL.RRRRR   D .N    .Gr.N.D ..I.. . NN   . ... D. A D    .NDIDf
    37   85 A T        -     0   0   44   76   76  kk...  ...k.....   . ..    .Nc.... kk... . ..   . kkk .. . .    .....d
    38   86 A R        +     0   0   57  101   88  TR...  ...A.....   . ..    .SS.... AA... . ..   . AAT .. . .    .....I
    39   87 A K        +     0   0   96  140   78  GG...  ...G.....   . ..    .CF.... GG... . ..   . GGG .. . .    .....N
    40   88 A L        -     0   0   91  168   91  PP...  ...P.....   . ..    .IQ.E.. PP... . ..   . PPP .. . L    .....E
    41   89 A d  S  > S+     0   0   15  238   19  CC...  ...C.....   . ..    .SC.C.. CC... . ..   . CCC .. . C    .....C
    42   90 A S  T  4 S+     0   0   98  244   86  EE...  ...E.....   . ..    .FD.N.. EE... . SS   . EEE .. . A    .....T
    43   91 A L  T >4 S-     0   0  120  274   90  KQI..  ...Q.....   . ..    SLARLV. QQ..I . CC   I QQH .. . E    T....N
    44   92 A D  G >4 S-     0   0  107  297   62  AAD..  ...ADDDDD   . A.    DEADGN. AAKDD D SS   D AAA .D . G    D....D
    45   93 A N  G >< S-     0   0    8  315   63  GGI..  ...GGGGGG   I R.    VVSINII GGVVI I SS   I GGG .V . K    I.VP.N
    46   94 A G  G <  S-     0   0    0  316   53  FSD..  ...SLLLLL   D D.    DDGDGDN FFDNN N GG   N SSS .N . H    D.KF.G
    47   95 A D  G <  S+     0   0   44  344   60  PPDTE  TTTPDDDDD   E YL    EEDDGEE PPLEE E PP   E PPP DE L D    NDEPPN
    48   96 A e    <   -     0   0    0  344    1  CCCCC  CCCCCCCCC   C CC    CCDCCCC CCCCC C CC   C CCC CC C C    CCCCCC
    49   97 A D  S    S-     0   0   59  344   73  RRVAA  AAARSSSSS   A QR    GTGSQID RQDEA S EE   A RQR AE I Q    DDDEGE
    50   98 A Q  S    S+     0   0    2  344   62  nnsds  dddnrrrrr   s gt    ssasQes nnpas e nn   s nnn ht p Q    tpsssH
    51   99 A F  E     -C   62   0C   4  344   77  qltkt  krrqfffff   t ta    ttfiNtn qqirt l tt   t qqq ir h V    ttttaI
    52  100 A d  E     +C   61   0C  10  344    0  CCCCC  CCCCCCCCC   C CC    CCCCCCC CCCCC C CC   C CCC CC C C    CCCCCC
    53  101 A H  E     -C   60   0C  68  344   86  QQIWI  GHHQEEEEE   N SL    AEVIHVV QQESL E HH   L QQQ KS V M    TTSNFT
    54  102 A E  E     -C   59   0C  92  344   56  DDDED  EEEDAAAAA   D QW    DDPDNDD DDDQN N SS   N DDD PQ R N    DDDNRN
    55  103 A E  S    S-     0   0  100  344   81  edEKD  KKKdfffff   G gt    REdGTLK nnree T gg   e nnd de T m    GGnIdT
    56  104 A Q  S    S-     0   0  175  310   77  ggVdv  dddgtttnt   V qp    VVqVIVI gg.ad V ee   d ggg ga . p    VVpdtK
    57  105 A N  S    S+     0   0  154  307   78  klNg.  ggglnnnnn   N .M    NN.NGNN llniH G aa   H llk gi . A    NNNsgG
    58  106 A S  S    S-     0   0   58  337   71  NNTsg  sssNSSSSS   N TS    GG.SGDG NNNs. S GG   . NNN Ss . V    SSHSqS
    59  107 A V  E     -C   54   0C   7  343   86  FFFYY  YYYFGGGGG   Y FY    YY.YFFY FFYYY F FF   Y FFF SY N F    FFYYYY
    60  108 A V  E     -C   53   0C  45  344   87  TTVMK  MAATFFFFF   T VN    STGRQFV TTSQL I TT   L TTT RQ V T    TTDNVS
    61  109 A e  E     +C   52   0C   5  344    0  CCCCC  CCCCCCCCC   C CC    CCCCCCC CCCCC C CC   C CCC CC C C    CCCCCC
    62  110 A S  E     -C   51   0C  24  344   70  RRLEN  NEERNNNNN   L AN    TTSHSSS RREYK S SS   T RRR EY S D    AAAENS
    63  111 A f        -     0   0   23  344    0  CCCCC  CCCCCCCCC   C CC    CCCCCCC CCCCC C CC   C CCC CC C C    CCCCCC
    64  112 A A    >   -     0   0    8  344   70  LLLPL  PPPLPPPPP   I AS    AAAAAPQ LLPRI K PP   I LLL PR A N    AVLPPY
    65  113 A R  T 3  S+     0   0  149  344   83  AAPSL  HLLVFFFFF   P VS    PPTPIPP AAKQP P MM   P AAA KQ E E    ADPFSD
    66  114 A G  T 3  S+     0   0   24  344   13  GGSSP  GGGGGGGGG   E GG    GGGGGAG GGGGG G GG   G GGG GG G G    GGMGSG
    67  115 A Y  E <   -D   78   0D  20  344    7  FFYYY  YYYFYYYYY   F WY    YYFYYYW FFYYY Y FF   Y FFF FY Y Y    YYWYYY
    68  116 A T  E     -D   77   0D  72  343   81  VVGTT  TTTVTTTTT   T RT    DETEDHE MMTQT Y EE   T MVV IQ T T    TTEDEQ
    69  117 A L  E     -D   76   0D  67  340   68  GGGGG  GGGGGGGGG   G GG    GGGGLGG GGGLG L GG   G GGG GL G L    GGGGGL
    70  118 A A    >   -     0   0   23  340   78  AASLA  LLLATTTTT   T SK    DDIDNKK AAPAV E PP   I AAP AA R N    DDIDTE
    71  119 A D  T 3  S+     0   0  175  340   77  LRLNT  NNNRMMMMM   N QN    DHDHDNN HHQEN N TT   N HRR HE R E    TTNDNI
    72  120 A N  T 3  S-     0   0   92  340   74  CCCCC  CCCCCCCCC   C CC    CCCCDCC CCCDC N CC   C CCC CD C D    CCCCCN
    73  121 A G  S <  S+     0   0   16  340   56  EEEEE  EEEEQQQQQ   E NT    AETEGEE EENGE T GG   E EEE EG Q E    SGEGEG
    74  122 A K  S    S+     0   0   71  332   83  EVKKV  KRRVE   E   T VK    TIEILLR VVEHA Y VV   A VVV TH K R    TTTNQK
    75  123 A A        -     0   0   22  330   70  DNDRV  RRRN        S AD    DGANADS NNpTE V DD   E DNN ET S S    DDERAN
    76  124 A f  E     -D   69   0D  12  300   48  VV.VL  V..V          ..    VK.I.VV VVk.I . TT   I VVV S.   C    IIK...
    77  125 A I  E     -D   68   0D  78  304   82  DD.DA  D..D          D.    DF.D.TN DDA.D D DD   D DDD Q.   T    DDI.V.
    78  126 A P  E     -D   67   0D  62  304   56  DD.KP  K..D          H.    ES.D.TE DDV.E E DD   E DDD T.   P    EDP.P.
    79  127 A T  S    S+     0   0  103  304   79  CC.CC  C..C          C.    CH.C.CC CCC.C C CC   C CCC C.   I    CCC.C.
    80  128 A G  S    S-     0   0   32  305   75  LL.TA  T..L          S.    GY.S.SW LLS.D T RR   D LLL D.   D    AADIN.
    81  129 A P  S    S+     0   0  116  311   78  MMTSP  SMMM          PI    SI.S.PP MMS.S N DD   S MMM D.   L    STPPS.
    82  130 A Y  S    S+     0   0   59  312   77  RRELS  LDDR          TN    AC.V.DS RRN.Y S HH   Y RRR R.   C    NNNFN.
    83  131 A P    >   -     0   0   17  312   34  PPGPP  PKKP          PP    PT.I.PP PPP.P P TT   P PPP P.   A    PPPPP.
    84  132 A g  T 3  S+     0   0   16  323    2  CCCCC  CCCC          CC    CCCCCCC CCCCC C CC   C CCC CC   E    CCCCCC
    85  133 A G  T 3  S+     0   0    0  295   30  AADA   ATTA           R    QTSQDE  AA TQ   EE   Q AAA  T   G    T  E T
    86  134 A K    <   -     0   0   69  294   62  NNHN   NSSN           K    NS NDH  NN DN   NN   N NNN  D   K    H  S D
    87  135 A Q        -     0   0   37  243   74  G  G    MM                  D  V      IG   GG   G      I   H       F I
    88  136 A T        +     0   0    4  220   79  A  G                        P          A   GG   A                  P  
    89  137 A L        +     0   0  105  200   57  I  L                                   L   II   L                     
    90  138 A E              0   0  104  120   71                                                                        
    91  139 A R              0   0  231   97   28                                                                        
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3       II         IVI I  IIII       I     I I  MMI I   M  V I MIIL      
    94   17 B V  B     -E  271   0E   7  561    9       YV         IVV V  VVTI       V     V V  VVV V   V  G F VVIL      
    95   18 B G  S    S+     0   0   25  562    6       GG         GGN G  GGYG       N     G G  GGG G   G  G G GGGG      
    96   19 B G  S    S-     0   0   26  563    0       GG         GGG G  GGGG       G     G G  GGG G   G  L G GGGG      
    97   20 B Q  E     -F  237   0F  98  564   95       HK         KMV V  QHDS       R     S A  QQQ S   Q  S K QRSR      
    98   21 B E  E     -F  236   0F  80  565   65       DN         PDD E  EEDP       D     A E  DDE P   D  S D DNME      
    99   22 B h        -     0   0    8  565   58       IA         CCT S  AAAA       A     A V  AAA A   A  A A TAAS      
   100   23 B K    >   -     0   0  123  564   79       SP         SET R  HVAV       L     P V  QQP P   Q  E P QEQR      
   101   24 B D  T 3  S+     0   0   60  565   85       IF         IPI Q  GAVT       L     V P  EER E   E  T Q EPPR      
   102   25 B G  T 3  S+     0   0    0  565   73       EG         THE G  NGGG       F     G N  GGN R   G  G N GGGA      
   103   26 B E  S <  S+     0   0   36  565   67       QR         QSA T  KSKA       E     R S  EER R   E  D T ELQE      
   104   27 B h    >   +     0   0    4  565   91       AW         RQH W  WWWW       F     Y L  WWW W   W  W I WFWF      
   105   28 B P  T 3   +     0   0    0  567    9       PP         PPP P  PPPP       P     P P  PPP P   P  P P PPPP      
   106   29 B W  T 3  S+     0   0    5  568   27       FW         FWY W  WWWW       W     Y F  WWW W   W  W W WWWW      
   107   30 B Q  E <   -N  122   0G   7  569   24       mq         QqQ Q  qmQL       m     M v  QQQ Q   Q  Q Q QqQL      
   108   31 B A  E     -NO 121 146G   1  559   47       lt         VaV V  diVV       i     V l  VVV V   V  A V VeLV      
   109   32 B L  E     -NO 120 145G   3  567   65       RS         AIP A  TQQQ       N     S T  SSS S   S  S L SDTS      
   110   33 B L  E     -NO 119 144G   0  570   11       LF         LLL L  YLLL       S     L L  IIL L   I  L L ILLL      
   111   34 B I  E     -NO 117 143G   0  570   81       NF         IDQ L  WRTK       G     R S  QQR R   Q  Q T QSHQ      
   112   35 B N  E >   - O   0 142G  30  570   88       GG         KMN L  MPLk       s     D T  RRv I   R  Y V RrFS      
   113   36 B E  T 3  S+     0   0   63  113   77       .F         ..A .  .LAn       s     A .  ..r .   .  . . .p..      
   114   37 B E  T 3  S-     0   0  136  242   76       .S         R.A N  .EGT       E     S .  NNQ G   N  N . NEMD      
   115   38 B N  S <  S+     0   0   84  543   52       TS         G.L G  .NSN       G     G .  GGF Y   G  N G GDGG      
   116   39 B E        -     0   0  100  561   93       DT         QYS T  .SNA       T     S .  SSW S   S  I S SRSD      
   117   40 B G  E     +N  111   0G  14  572   55       HH         IKH Q  HHSP       S     H H  HHK H   H  H G HWHH      
   118   41 B F  E     +     0   0G  28  581   35       YR         LlF F  FLfY       f     Y A  FFh F   F  R R FFVI      
   119   42 B i  E     -N  110   0G   0  578    1       CC         CcC C  CCcC       c     C C  CCc C   C  C . CGCC      
   120   43 B G  E     -N  109   0G   1  581    2       GG         GGG G  GGGG       G     G A  GGG G   G  G G GSGG      
   121   44 B G  E     -N  108   0G   0  581    9       AG         GGG G  GGGA       G     G G  GGG G   G  A G GGGG      
   122   45 B T  E     -NP 107 130G   0  581   43       SA         SVS S  STTV       T     S T  SSS S   S  T G SAIT      
   123   46 B I  E     + P   0 129G   0  581   23       VV         LLI L  LLLL       I     L I  LLL L   L  L I LLLI      
   124   47 B L        -     0   0    6  581   27       II         IVI V  IIVI       I     I L  III I   I  I I ILII      
   125   48 B S  S    S-     0   0   22  581   57       HN         DAS T  HSGD       N     A D  AAH T   A  S i ASSS      
   126   49 B E  S    S+     0   0   99  581   62       EE         ARE P  PDGS       D     P E  EEP S   E  N d EQPD      
   127   50 B F  S    S+     0   0   42  581   82       RN         QQD E  QLQQ       R     R K  RRQ R   R  T K QSDR      
   128   51 B Y  E     - Q   0 185G   7  581   33       FW         WWL W  WWFW       Y     V T  WWW W   W  W W WWFH      
   129   52 B I  E     -PQ 123 184G   0  581   14       II         VVV V  VIVV       I     L I  VVV V   V  L I VVVI      
   130   53 B L  E     +PQ 122 183G   0  581   28       LA         LVV V  LLVA       L     L L  LLL L   L  V M LLLL      
   131   54 B T  E     - Q   0 182G   0  581   43       TT         TTT T  TSTT       T     T T  TTT S   T  S T TTTT      
   132   55 B A    >>  -     0   0    0  581    2       AA         AAA A  AAAA       A     A A  AAA A   A  A A AAAA      
   133   56 B A  G >4 S+     0   0    0  581    8       AG         AAA A  AAAA       A     A A  AAA A   A  A A AAAA      
   134   57 B H  G >4 S+     0   0    7  581    0       HH         HHH H  HHHH       H     H H  HHH H   H  H H HHHH      
   135   58 B i  G X4 S+     0   0    0  581    2       CC         CCC C  CCCC       C     C C  CCC C   C  C V CVCC      
   136   59 B L  G << S+     0   0   31  581   65       IV         KTM F  VFLI       L     V L  FFL I   F  F L FLFF      
   137   60 B Y  G <  S+     0   0  109  581   87       LD         QTQ H  GFEV       R     A D  PPG L   P  R A PRPD      
   138   61 B Q  S <  S+     0   0   95  581   78       Pd         PPs d  prPg       g     d y  nnp R   n  d h nsKe      
   139   61AB A        -     0   0   16  352   75       Dt         G.a e  pp.p       t     h a  ttl Y   t  t v tp.p      
   140   62 B K  S    S-     0   0  172  366   75       RS         RGS D  NT.E       K     K T  SSA A   S  A S SE.L      
   141   63 B R  S    S-     0   0  162  570   78       KQ         DIQ H  KV.M       L     F I  LLD D   L  T K LH.G      
   142   64 B F  E     -O  112   0G  36  577   54       YI         LTI W  VY.L       I     P F  YYL Y   Y  F D YV.F      
   143   65 B K  E     -O  111   0G  67  577   78       TR         RTK T  RE.K       K     S R  QQR M   Q  G L QK.M      
   144   66 B V  E     -OR 110 161G   0  577   16       VI         VIV V  VA.L       V     V V  VVV V   V  A M VV.V      
   145   67 B R  E     -OR 109 160G  40  577   53       QR         LRR T  QY.L       R     H V  LLQ Q   L  L Y LF.V      
   146   68 B V  E     +OR 108 159G   1  578   43       VV         ILL L  LL.V       V     I A  LLL L   L  L V LL.T      
   147   69 B G  S    S+     0   0    9  578   14       GG         GGG G  RG.G       G     G G  GGR G   G  K G GG.G      
   148   70 B D        +     0   0   11  579   58       TE         TKS E  KK.K       E     R E  AAE D   A  P G AL.A      
   149   71 B R  S    S+     0   0   24  579   73       TY         DHT H  QH.H       Y     Q H  RRQ R   R  P T RH.N      
   150   72 B N  B >   -T  234   0H  18  579   65       YD         TNI K  YS.Y       N     Y S  QQH M   Q  S E QDSD      
   151   73 B T  T 3  S+     0   0   56  579   79       AF         LLY L  LI.L       I     L F  LLL L   L  L V LAFL      
   152   74 B E  T 3  S-     0   0  119  579   84       NS         RFN K  YR.T       E     S L  VVY D   V  K G VGNR      
   153   75 B Q  S <  S-     0   0  130  578   86       DH         DTE D  YT.E       T     Q N  QQY G   Q  R A QDKP      
   154   76 B E        +     0   0  165  578   85       Gv         GRG k  HE.n       L     A E  PPK s   P  S m PkcL      
   155   77 B E        -     0   0   93  438   29       .e         .E. f  .E.d       E     E S  ... e   .  . e .shD      
   156   78 B G  S    S+     0   0   46  547   33       GQ         .W. E  .S.P       D     S G  GG. Q   G  . S GASS      
   157   79 B G  S    S+     0   0   47  555   76       Ql         TG. q  .Y.H       C     D M  pp. A   p  . V pTTE      
   158   80 B E        -     0   0   37  444   33       .y         GEG r  DQ.E       E     Y E  aaD .   a  . . a..A      
   159   81 B A  E     -R  146   0G  27  457   60       .T         EEE D  HQ.Q       E     D H  VVR L   V  . . M..L      
   160   82 B V  E     -R  145   0G  71  557   81       VE         VRL I  LR.V       S     V N  YYL M   Y  . . YN.S      
   161   83 B H  E     -R  144   0G  14  567   77       YR         RKV S  MI.R       E     R S  AAL V   A  . . AR.Y      
   162   84 B E        -     0   0   90  569   77       DA         MMS A  TE.T       D     R N  RRR P   R  . . RS.R      
   163   85 B V  E     -S  186   0G  27  574   64       VV         IVV I  VI.V       G     T V  VVV V   V  V . VV.V      
   164   86 B E  E    S+     0   0G  70  575   73       EA         SQK Y  SA.S       R     V D  RRS Q   R  K . RD.H      
   165   87 B V  E     -S  185   0G  13  576   72       KR         RKA L  QE.G       I     T S  RRR K   R  K . RR.S      
   166   88 B V  E     -S  184   0G  72  577   45       IK         SLF H  II.I       C     T Y  VVL I   V  I . VI.A      
   167   89 B I  E     +S  183   0G  27  578   45       MV         IVK E  II.I       S     A L  EEL I   E  I H EI.Q      
   168   90 B K  E     -S  182   0G  68  578   82       KV         VPF A  TL.V       P     I M  SSV I   S  I V SL.I      
   169   91 B H    >   -     0   0   19  579   14       HH         HHH Y  HH.H       P     H H  NNH H   N  H H NHEH      
   170   92 B N  T 3  S+     0   0  156  579   60       EP         PPE k  PE.S       y     G P  PPP K   P  E P PPPR      
   171   93 B R  T 3  S+     0   0  150  576   74       MK         ANG m  DD.Q       d     S D  LLQ D   L  N G LNPT      
   172   94 B F    <   -     0   0   24  579    5       YY         YYY F  FFFY       L     Y Y  YYF F   Y  Y Y YFLY      
   173   95 B T     >  -     0   0   56  579   67       NN         NNN l  YENN       r     D S  QQY E   Q  L D QQSD      
   174   96 B K  T  4 S+     0   0  145  525   79       YF         PPP i  .P.Q       e     P P  ... A   .  Y . .P.Q      
   175   97 B E  T  4 S+     0   0  174  533   92       TF         RSK K  .AFY       V     A I  ... A   .  P . .D.T      
   176   98 B T  T  4 S-     0   0   44  561   58       TT         KTT D  IAQT       I     T T  ... S   .  E S .SAA      
   177   99 B Y    ><  +     0   0   60  566   66       HY         NKM T  VFIV       F     S L  ..M L   .  H V .YFY      
   178  100 B D  T 3   +     0   0   25  578   38       DE         DDV p  qRhK       h     A E  gga T   g  D d gDQi      
   179  101 B F  T 3  S+     0   0   21  558   68       YF         NNN f  aNnN       y     N N  ..a H   .  Y y .NNw      
   180  102 B D    <   +     0   0    1  577    0       DD         DDD D  DDDD       d     D D  ddD D   d  D d dDQD      
   181  103 B I        +     0   0    0  579   14       IL         FIV I  IIII       I     I I  VVI L   V  I I VIII      
   182  104 B A  E     -QS 131 168G   0  579   60       CA         MMA A  AAAA       G     A A  AAA A   A  A A AAQA      
   183  105 B V  E     -QS 130 167G   0  580   15       LL         LLL L  LLVL       L     L L  LLL L   L  L L LLMI      
   184  106 B L  E     -QS 129 166G   0  581   30       IV         LII V  LLLV       I     L I  VVL L   V  V I VVKL      
   185  107 B R  E     -QS 128 165G  40  581   42       KK         RKK R  KRQK       R     R Y  EEE R   E  Q K ERRE      
   186  108 B L  E     - S   0 163G   0  581   17       LL         LLL L  LLLM       V     L L  LLL L   L  L L LLQV      
   187  109 B K  S    S+     0   0  101  581   69       KE         NLA S  TAKN       P     D S  EEE A   E  S G ESRE      
   188  110 B T  S    S-     0   0   82  582   74       TQ         RTT E  NASR       K     A G  EEE Y   E  K N AQCR      
   189  111 B P        -     0   0   48  582   39       NP         PPP P  PPYP       m     a p  PPP S   P  R P PEaR      
   190  112 B I        -     0   0    4  532   62       LL         VV. A  VA.V       l     a l  VVV V   V  V L VVpF      
   191  113 B T        -     0   0   95  537   72       TV         QT. I  NH.E       S     P P  SSK N   S  E T PEMQ      
   192  114 B F        +     0   0   56  580   32       FF         FLV F  IL.F       L     L F  FFV F   F  F F FLLF      
   193  115 B R  B >   -U  196   0I  52  581   64       SA         STr D  SNev       E     A N  TTS S   T  T R TDsS      
   194  116 B M  T 3  S+     0   0   29  564   77       AP         NEs E  DHdg       .     . E  NNS S   N  S A NEnQ      
   195  117 B N  T 3  S+     0   0   13  572   89       KH         NRK N  YRYG       N     . A  YYH Y   Y  S A YLNF      
   196  118 B V  B <   +U  193   0I   0  574   26       VI         III V  VVII       I     . V  III I   I  I V IIVA      
   197  119 B A        -     0   0    1  576   81       NS         KQR S  HSNN       R     . Q  LLR Q   L  H M LQQS      
   198  120 B P        -     0   0    8  576   54       KP         KPY P  PPSF       P     . P  PPT P   P  H P PPPS      
   199  121 B A        -     0   0    2  577   39       II         IVI I  VAAI       V     . I  VVV V   V  V V VVAA      
   200  122 B g  B     -g  290   0F   1  578   67       DC         RPR C  PCCC       C     . N  CCT C   C  C C CCCC      
   201  123 B L        -     0   0   27  580    5       LL         LVL L  LLLL       L     L L  LLL L   L  L L LLLL      
   202  124 B P        -     0   0    7  581   31       AP         AAA L  PPPP       P     P A  PPP P   P  P P PPPP      
   203  124AB E     >  -     0   0   92  580   75       DA         TSD P  PEGE       L     T L  DDP G   D  E A DRNG      
   204  125 B R  H  > S+     0   0  109  580   79       RT         RCR P  ADAF       D     F T  PPA K   P  P K PLFD      
   205  126 B D  H  > S+     0   0  124  580   85       SD         CPT E  SDDG       D     D G  SSS S   S  S D SQDN      
   206  127 B W  H  >>S+     0   0    4  580   87       VD         PPP H  EVTE       N     L T  VVE L   V  Q S VHQI      
   207  128 B A  I  X>S+     0   0    0  580   75       RL         MVP K  TKEK       A     V A  IIT T   I  T S IRSW      
   208  129 B E  I  <5S+     0   0   75  581   83       LL         DPT L  FVFF       R     P D  FFF V   F  F Y FTFF      
   209  130 B S  I  <5S+     0   0   70  582   65       KI         GGG P  PGGS       N     A P  EEP K   E  p T EPPR      
   210  131 B T  I  <5S+     0   0   18  104   77       ..         ... .  ....       Y     . .  ... .   .  n . ....      
   211  131AB L  I ><  S-     0   0  119  478   80       SS         S.l R  ...t       .     e .  ... n   .  t n .s..      
   227  146 B E  T 3  S+     0   0   47  513   76       AE         P.T W  D.EE       A     G .  ... G   .  N G .D.E      
   228  147 B K  T 3  S+     0   0  169  537   69       DG         G.C N  N.NE       T     G .  ..H S   .  D S .L.N      
   229  149 B G  S <  S-     0   0   29  548   67       GG         G.V G  G.GN       G     M .  ..L S   .  G R .GSG      
   230  150 B R        -     0   0  213  557   86       DT         YSS T  V.TA       S     Y .  ..P Q   .  P I .MDL      
   231  151 B Q  B     -V  224   0J  79  563   93       IL         FYL Q  N.QQ       T     L .  ..P M   .  A L .TTD      
   232  152 B S        -     0   0   14  569   51       SP         PPP P  L.PS       S     S .  ..P A   .  P T .SSP      
   233  153 B T  S    S+     0   0   48  570   73       NS         DDK E  P.DH       S     S D  ..Y V   .  N N .DRY      
   234  154 B R  B    S-T  150   0H 102  570   86       NV         VVT A  P.FV       T     D V  ..P E   .  A R .LSL      
   235  155 B L        -     0   0    3  578    3       LL         LLL L  P.LI       L     L L  LLL L   L  L M LLLQ      
   236  156 B K  E     -FH  98 221F  31  578   51       QQ         QQQ R  F.QQ       K     Q L  QQR Q   Q  Q K QQMY      
   237  157 B M  E     -FH  97 220F  18  579   94       QE         CCE E  PEDE       K     H S  KKE E   K  E Y KYEN      
   238  158 B L  E     - H   0 219F   4  580   42       VV         GVV A  LEAV       V     V V  LLV S   L  A V LVVI      
   239  159 B E  E     - H   0 218F 107  580   72       TS         VTE K  QPRK       Q     T D  AAE Q   A  T Q AKTE      
   240  160 B V  E     - H   0 217F   0  580   46       IV         VVV V  VEVL       I     I I  VVV L   V  V L VLVT      
   241  161 B P  E     - H   0 216F  34  580   26       PP         YTD R  PTAP       P     A P  PPP R   P  K P PPDP      
   242  162 B Y  E     -J  263   0F  36  581   45       II         TII L  IGLI       V     Y V  III I   I  L L IVII      
   243  163 B V  E     -J  262   0F  24  582   35       IV         IFV V  IFIV       V     F V  IIV I   I  I V IVIL      
   244  164 B D     >  -     0   0   88  581   58       SS         SSD P  EKPP       P     D S  DDE H   D  D D DSGT      
   245  165 B R  H  > S+     0   0   51  581   79       TN         NTQ T  NKDH       H     A D  TTN F   T  S R TQDH      
   246  166 B N  H  > S+     0   0  105  582   75       FD         EAK W  HRSA       E     A E  PPH N   P  E K PDSN      
   247  167 B S  H  > S+     0   0   48  582   78       SR         EEA V  LTAT       E     T D  KKL Q   K  T K KEVI      
   248  168 B j  H  X S+     0   0    1  582    2       CC         CCC C  CCCC       C     C C  CCC C   C  C C CCCC      
   249  169 B K  H >< S+     0   0   88  582   73       ck         SKa n  dmln       v     q n  nnd n   n  n n nqnn      
   250  170 B L  H 3< S+     0   0  150  547   89       la         RRf n  gkss       y     l e  ggg s   g  e k grsg      
   251  171 B S  H 3< S+     0   0   23  578   76       KG         LLK S  DFYS       Q     Y Y  YYD T   Y  V H YSVG      
   252  172 B S    <<  -     0   0   20  581   83       VR         YYY Y  NKGY       N     P N  QQS S   Q  Y K QVYY      
   253  173 B S  S    S+     0   0   79  581   83       RH         PPG N  VDSN       I     F T  PPF T   P  D V PRNE      
   254  174 B F  S    S-     0   0  124  581   79       HE         NGS G  HNRS       T     G D  KKR N   K  G P KYNG      
   255  175 B I        -     0   0  100  582   88       AF         GSQ T  IWFY       K     Q P  TTI L   T  D H TNAS      
   256  176 B I        -     0   0   13  582   16       II         III I  VSYV       I     I V  IIV V   I  I L IIII      
   257  177 B T    >   -     0   0   16  582   36       TP         TTQ H  RSQT       T     K K  KKQ K   K  T T KTTS      
   258  178 B Q  T 3  S+     0   0  133  582   68       SD         RED S  DDED       H     P P  NND M   N  P N NDKE      
   259  179 B N  T 3  S+     0   0   24  582   61       RI         NNT R  DGEK       Q     G S  DDS G   D  R N DNNR      
   260  180 B M  E <   - K   0 311F   2  582   11       MF         MMM A  MRMM       Q     M M  MMM S   M  M M MMMM      
   261  181 B F  E     - K   0 310F   8  581   34       FL         LIV L  LRIL       L     L M  LLL I   L  L F LFLI      
   262  182 B j  E     +JK 243 309F   1  582    0       CC         CCC C  CCCC       C     C C  CCC C   C  C C CCCC      
   263  183 B A  E     +JK 242 308F   0  582   27       AA         AAA A  ARAA       A     A A  AAA G   A  A A AAAA      
   264  184 B G  S    S-     0   0    3  582   10       GG         GGY G  GLGG       G     G G  GGG Y   G  G G GGGG      
   265  185 B Y        -     0   0   56  561   58       EH         LSA F  .PYK       .     A .  FFN S   F  Y . FYHY      
   266  185AB D  S    S-     0   0   81  565   84       QE         SLL K  .TWM       S     L .  EEE A   E  L . EFLP      
   267  185BB T  S    S+     0   0   76  582   62       GT         SQK E  NTDA       t     A g  EEE Q   E  E t EEGS      
   268  186 B K  S    S-     0   0  107  532   32       .G         GG. G  EIGG       i     G g  GG. .   G  G g GGGT      
   269  187 B Q  S    S+     0   0  102  537   37       .G         GG. G  GVKG       N     G G  KK. G   K  G G KGGG      
   270  188 B E        +     0   0   33  581   54       KQ         TRK V  HTVV       G     K L  KKR K   K  V K KQKG      
   271  189 B D  B     -E   94   0E   7  582    3       DD         DDD D  DADD       D     D D  DDD D   D  D D DDDT      
   272  190 B A        -     0   0    7  582   42       SS         SSA A  SDTT       A     S A  AAS A   A  A A ATSV      
   273  191 B k    >   -     0   0    7  582    0       CC         CCC C  CCCC       C     C C  CCC C   C  C C CCCC      
   274  192 B Q  T 3  S+     0   0   90  582   25       QQ         QQQ Q  QVQQ       A     Q Q  KKQ Q   K  Q Q KLQV      
   275  193 B G  T 3  S+     0   0    6  582    7       GG         GGG Y  GGGG       G     G G  GGG G   G  G G GGGG      
   276  194 B D    X   +     0   0    0  582    0       DD         DDD D  DDDD       D     D D  DDD D   D  D D DDDD      
   277  195 B S  T 3  S+     0   0   14  582    1       SS         SSS S  SSSS       S     S S  SSS S   S  S S SSSS      
   278  196 B G  T 3  S+     0   0    0  582    0       GG         GGG G  GGGG       G     G G  GGG G   G  G G GGGG      
   279  197 B G    <   -     0   0    0  582    2       GG         GGG G  GGGG       G     G G  GGG G   G  G S GGGG      
   280  198 B P  E     - L   0 294F   1  582    3       PP         PPP P  PPPP       P     P P  PPP P   P  P P PAPP      
   281  199 B H  E     -IL 219 293F   0  582   49       LL         LLL L  LLLL       L     L L  LLL L   L  L F LFLL      
   282  200 B V  E     -IL 218 291F   3  582   27       TQ         VVV Q  VMVV       H     V F  VVV V   V  V T VVVL      
   283  201 B T  E     - L   0 290F   0  582   67       LV         CCA C  CCCC       V     L V  CCC C   C  T L CMCC      
   284  202 B R  E     + L   0 289F  99  582   70       NK         KNN E  KEAE       L     P L  LLK E   L  P T LEQE      
   285  203 B F  E >  S- L   0 288F  22  582   70       Ng         DGN H  Vsrk       v     s p  VVV Y   V  d E VdEa      
   286  204 B K  T 3  S-     0   0   85  206   71       .d         ... D  Eddd       d     a v  GGN N   G  r N GsGd      
   287  205 B D  T 3  S+     0   0  108  208   57       .G         ... G  DGNG       T     S A  QQD E   Q  L K QRDN      
   288  206 B T  E <   - L   0 285F   3  218   75       .H         ... R  THRR       R     G N  SST T   S  M Q SRRK      
   289  207 B Y  E     - L   0 284F  21  227   50       .Y         ... W  WWWW       V     D V  WWW W   W  W F WWWW      
   290  208 B F  E     -gL 200 283F   0  582   91       VF         ETQ Y  LFYY       V     L Q  LLL I   L  Y W LVYY      
   291  209 B V  E     + L   0 282F   1  582   41       QL         LLL L  QLLL       Q     Q Q  QQQ Q   Q  L V QVVL      
   292  210 B T  E     +     0   0F   1  582   84       VA         QQV T  AYTV       Q     L L  AAA V   A  V A AFVA      
   293  211 B G  E     -ML 312 281F   0  582    0       GG         GGG G  GGGG       G     G G  GGG G   G  G G GGGG      
   294  212 B I  E     -ML 311 280F   0  582   19       VI         III L  VIVI       I     V I  VVV V   V  I I VLIV      
   295  213 B V  E     +M  310   0F   7  582   14       TI         VVV V  VTTT       V     T V  IIV V   I  V V IVTV      
   296  214 B S  E     -     0   0F   1  581    0       SS         SSS S  SSSS       S     S S  SSS S   S  S S SSSS      
   297  215 B W  E     -M  309   0F  45  582    8       FW         WWW W  WYWW       F     W W  WWW W   W  W W WWWW      
   298  216 B G        -     0   0   26  582    0       GG         ggG G  GGGG       g     G G  GGG G   G  G G GgGS      
   299  217 B E  S    S-     0   0   25  577   90       .I         qeS H  EEDR       r     Y R  EEE I   E  D V EgYI      
   300  218 B G  S    S-     0   0   19  580   15       .G         VKG E  GGGG       R     G G  GGG G   G  E D GDGG      
   301  220 B k  S    S-     0   0    7  582    2       SC         CCC C  CCCC       C     C C  CCC C   C  C C CCCC      
   302  221 B A  S    S+     0   0    4  581   17       GA         GGA A  AAGG       G     A G  AAA G   A  G G AGGA      
   303  222 B R    >   -     0   0  105  578   74       CE         RQR R  QQIE       K     R L  RRL R   R  K L RSRE      
   304  223 B K  T 3  S+     0   0  152  578   65       GA         RPV P  PPAP       D     P A  QQP Q   Q  P A QQER      
   305  223AB G  T 3  S+     0   0   26  582   58       KN         GKG Q  NRRN       K     G D  NNN G   N  N G NGNK      
   306  224 B K    <   -     0   0   43  582   85       LL         KRY K  RNKY       Y     L Y  RRR Y   R  K A RVKK      
   307  225 B Y        -     0   0   33  582   49       PP         PPP Y  PPPP       P     P P  PPP P   P  P Y PYPP      
   308  226 B G  E     -K  263   0F   4  580    2       GG         GGG G  GAGG       G     G G  GGG G   G  G G GGGD      
   309  227 B I  E     -KM 262 297F   6  581   10       VV         VVV V  IVIV       V     V V  VVI V   V  V V VVVV      
   310  228 B Y  E     -KM 261 295F   1  581    2       YC         YYF Y  YYSY       Y     Y Y  YYY Y   Y  Y Y YYYF      
   311  229 B T  E     -KM 260 294F   2  581   40       TT         TTC S  TTAT       T     T T  IIT T   I  T T ITTT      
   312  230 B K  E >   - M   0 293F  21  581   40       KR         RKD N  RKRK       K     S Q  RRH E   R  R K RRRN      
   313  231 B V  G >  S+     0   0    1  581    8       II         VVV M  VVVV       V     T L  VVV V   V  V V VVVV      
   314  232 B T  G 3  S+     0   0    2  579   72       SS         CCP Q  TPTS       A     A S  TTT G   T  T V TVSQ      
   315  233 B A  G <  S+     0   0   29  579   80       AK         ERS V  YANA       P     H Y  AAY Y   A  Y E ARSY      
   316  234 B F  S <> S+     0   0    7  575   36       MF         YYV M  YMYY       Y     Y Y  HHY H   H  F Y HYVF      
   317  235 B L  H  > S+     0   0   23  573   81       LV         TAR T  LVIM       I     R L  HHL R   H  R L HVLM      
   318  236 B K  H  > S+     0   0  116  572   68       PP         AQS S  DPDD       D     S E  NND D   N  D D NESN      
   319  237 B W  H  > S+     0   0   26  572    1       WW         WWW W  WWWW       W     W W  WWW W   W  W W WWWW      
   320  238 B I  H  X S+     0   0    1  569   12       II         III V  IIII       I     I I  III I   I  I I IIII      
   321  239 B D  H  < S+     0   0   66  541   72       NL         HQE V  HRKR       L     N N  HHH     H    N H  N      
   322  240 B R  H >< S+     0   0  136  528   71       DD         DQK R  RESL       D       Q  QQQ     Q    R R  Q      
   323  241 B S  H >< S+     0   0    6  495   71       NT         TTT M  Y IK       N       N  VVY     V    T I         
   324  242 B M  T 3< S+     0   0   25  452   39       IV         MMA M  V MM       I       M  IIV     I    M I         
   325  243 B K  T <  S+     0   0  153  418   69       K          R K A  P ND       N          PPP     P    Q P         
   326  244 B T    <         0   0   51  369   66       K          R E E  K NQ       P          TTK     T    E           
   327  245 B R              0   0  197  260   47       N          K   H  D  N                    K          N           
## ALIGNMENTS  911 -  924
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1   49 A Q              0   0  101  253   29    H    E      
     2   50 A a    >   +     0   0   22  341    0    C C CCCC  C 
     3   51 A E  T 3  S+     0   0  187  342   77    PET AAAA  D 
     4   52 A T  T 3  S-     0   0  105  342   54    EAT SSSP  S 
     5   53 A S    <   +     0   0   89  342   62    gSq ASTT  K 
     6   54 A P        +     0   0   10  343   18    lPp PPTT  P 
     7   55 A b        -     0   0   18  344    0    CCC CCCC  C 
     8   56 A Q  S    S+     0   0   92  343   70    DSQ RRAA  L 
     9   57 A N  S    S-     0   0   63  303   24    .RN NNNN  N 
    10   58 A Q  S    S-     0   0  152  336   48    EQG GAGG  K 
    11   59 A G        -     0   0   16  344   17    GGG GGGG  G 
    12   60 A K  E     -A   23   0A 117  344   75    KDQ ATII  T 
    13   61 A a  E     -A   22   0A  45  344    0    CCC CCCC  C 
    14   62 A K  E     -A   21   0A 155  344   82    Imv VVSS  S 
    15   63 A X  E     +A   20   0A 120  302   29    .sd DDVV  K 
    16   64 A G        -     0   0   44  341   74    .GG GGGG  I 
    17   65 A L  S    S-     0   0  152  342   69    LVG VATK  N 
    18   66 A G  S    S+     0   0   67  343   62    GNG NNRR  g 
    19   67 A E        -     0   0  119  329   61    AGE GGSS  e 
    20   68 A Y  E     -A   15   0A  37  342    9    LAY YFLL  Y 
    21   69 A T  E     -A   14   0A  71  343   83    MVH TTSS  Q 
    22   70 A b  E     -A   13   0A  20  343    0    CCC CCCC  C 
    23   71 A T  E     -A   12   0A  85  344   80    NAV NTSS  A 
    24   72 A c        -     0   0   44  344    1    GCC CCCC  C 
    25   73 A L    >   -     0   0   62  344   86    AYP IAPP  S 
    26   74 A E  T 3  S+     0   0  177  344   74    EPP PLLL  E 
    27   75 A G  T 3  S+     0   0   29  344   24    DGG GGGG  G 
    28   76 A F  E <   +B   36   0B  40  343   16    .FF FFFF  F 
    29   77 A E  E     +B   35   0B  74  343   63    .RH DASS  T 
    30   78 A G  S >  S-     0   0   32  343    1    .GG GGGG  G 
    31   79 A K  T 3  S+     0   0  156  343   72    .GR DQEE  K 
    32   80 A N  T 3  S-     0   0   33  343   62    .DD NDYY  D 
    33   81 A c  S <  S+     0   0    1  344    0    CCC CCCC  C 
    34   82 A E        +     0   0   87  342   30    lSe eSEE  S 
    35   83 A L  E    S-B   29   0B  96  289   42    lI. iLVV  . 
    36   84 A F  E     -B   28   0B 139  292   93    sE. NRRR  . 
    37   85 A T        -     0   0   44   76   76    c.k ....  . 
    38   86 A R        +     0   0   57  101   88    G.A ....  . 
    39   87 A K        +     0   0   96  140   78    K.G ....  . 
    40   88 A L        -     0   0   91  168   91    N.P ....  . 
    41   89 A d  S  > S+     0   0   15  238   19    C.C ....  . 
    42   90 A S  T  4 S+     0   0   98  244   86    S.E ....  . 
    43   91 A L  T >4 S-     0   0  120  274   90    V.Q ....  D 
    44   92 A D  G >4 S-     0   0  107  297   62    DCA ..DD  E 
    45   93 A N  G >< S-     0   0    8  315   63    NIG ..GG  I 
    46   94 A G  G <  S-     0   0    0  316   53    GGS ..LL  N 
    47   95 A D  G <  S+     0   0   44  344   60    GGP EADD  P 
    48   96 A e    <   -     0   0    0  344    1    CSC CCCC  C 
    49   97 A D  S    S-     0   0   59  344   73    VSQ ANSS  D 
    50   98 A Q  S    S+     0   0    2  344   62    Esn srrr  s 
    51   99 A F  E     -C   62   0C   4  344   77    Tfq vsff  t 
    52  100 A d  E     +C   61   0C  10  344    0    CCC CCCC  C 
    53  101 A H  E     -C   60   0C  68  344   86    TEQ IYEE  S 
    54  102 A E  E     -C   59   0C  92  344   56    EAD DAAA  K 
    55  103 A E  S    S-     0   0  100  344   81    tDd GHff  i 
    56  104 A Q  S    S-     0   0  175  310   77    ..g VFtt  l 
    57  105 A N  S    S+     0   0  154  307   78    w.l NSnn  . 
    58  106 A S  S    S-     0   0   58  337   71    G.N GGSS  E 
    59  107 A V  E     -C   54   0C   7  343   86    VGF FPGG  Y 
    60  108 A V  E     -C   53   0C  45  344   87    RST VVFF  Q 
    61  109 A e  E     +C   52   0C   5  344    0    CCC CCCC  C 
    62  110 A S  E     -C   51   0C  24  344   70    SSR TQNN  A 
    63  111 A f        -     0   0   23  344    0    CCC CCCC  C 
    64  112 A A    >   -     0   0    8  344   70    GYL QPPP  S 
    65  113 A R  T 3  S+     0   0  149  344   83    AGA PQFF  E 
    66  114 A G  T 3  S+     0   0   24  344   13    GGG GGGG  G 
    67  115 A Y  E <   -D   78   0D  20  344    7    WWF YFYY  F 
    68  116 A T  E     -D   77   0D  72  343   81    ERV TMTT  T 
    69  117 A L  E     -D   76   0D  67  340   68    LGG GGGG  G 
    70  118 A A    >   -     0   0   23  340   78    QAA TATT  K 
    71  119 A D  T 3  S+     0   0  175  340   77    ADR LRMM  D 
    72  120 A N  T 3  S-     0   0   92  340   74    DCC CCCC  C 
    73  121 A G  S <  S+     0   0   16  340   56    GSE EEQQ  S 
    74  122 A K  S    S+     0   0   71  332   83    QIV TH    D 
    75  123 A A        -     0   0   22  330   70    NAN DA    E 
    76  124 A f  E     -D   69   0D  12  300   48    .CV I     I 
    77  125 A I  E     -D   68   0D  78  304   82    .PD D     N 
    78  126 A P  E     -D   67   0D  62  304   56    .GD E     P 
    79  127 A T  S    S+     0   0  103  304   79    .GC C     C 
    80  128 A G  S    S-     0   0   32  305   75    .SL A     D 
    81  129 A P  S    S+     0   0  116  311   78    .VM S     S 
    82  130 A Y  S    S+     0   0   59  312   77    .TR N     K 
    83  131 A P    >   -     0   0   17  312   34    .PP P     P 
    84  132 A g  T 3  S+     0   0   16  323    2    CCC C     C 
    85  133 A G  T 3  S+     0   0    0  295   30     NA Q       
    86  134 A K    <   -     0   0   69  294   62     GN N       
    87  135 A Q        -     0   0   37  243   74     H          
    88  136 A T        +     0   0    4  220   79     G          
    89  137 A L        +     0   0  105  200   57     L          
    90  138 A E              0   0  104  120   71                
    91  139 A R              0   0  231   97   28                
    92      ! !              0   0    0   0     0  
    93   16 B I              0   0    0  558    3  II   M    II I
    94   17 B V  B     -E  271   0E   7  561    9  FY   V    VY V
    95   18 B G  S    S+     0   0   25  562    6  GN   G    GN G
    96   19 B G  S    S-     0   0   26  563    0  GG   G    GG G
    97   20 B Q  E     -F  237   0F  98  564   95  NE   Q    QV Q
    98   21 B E  E     -F  236   0F  80  565   65  KK   D    EE E
    99   22 B h        -     0   0    8  565   58  TT   T    AC A
   100   23 B K    >   -     0   0  123  564   79  RG   Q    HV P
   101   24 B D  T 3  S+     0   0   60  565   85  LL   E    GK G
   102   25 B G  T 3  S+     0   0    0  565   73  YD   G    NN N
   103   26 B E  S <  S+     0   0   36  565   67  EE   E    KS K
   104   27 B h    >   +     0   0    4  565   91  MF   W    WQ W
   105   28 B P  T 3   +     0   0    0  567    9  PP   P    PP P
   106   29 B W  T 3  S+     0   0    5  568   27  WW   W    WW W
   107   30 B Q  E <   -N  122   0G   7  569   24  mm   Q    qQ q
   108   31 B A  E     -NO 121 146G   1  559   47  iq   V    dV e
   109   32 B L  E     -NO 120 145G   3  567   65  AY   S    TG T
   110   33 B L  E     -NO 119 144G   0  570   11  YL   I    YL Y
   111   34 B I  E     -NO 117 143G   0  570   81  DT   Q    WF W
   112   35 B N  E >   - O   0 142G  30  570   88  SA   R    MH R
   113   36 B E  T 3  S+     0   0   63  113   77  AA   .    .. .
   114   37 B E  T 3  S-     0   0  136  242   76  RG   N    .. .
   115   38 B N  S <  S+     0   0   84  543   52  GK   G    .G .
   116   39 B E        -     0   0  100  561   93  TQ   S    .K .
   117   40 B G  E     +N  111   0G  14  572   55  KK   H    HY H
   118   41 B F  E     +     0   0G  28  581   35  lt   F    Fl F
   119   42 B i  E     -N  110   0G   0  578    1  cc   C    Cc C
   120   43 B G  E     -N  109   0G   1  581    2  GA   G    GG G
   121   44 B G  E     -N  108   0G   0  581    9  GG   G    GG G
   122   45 B T  E     -NP 107 130G   0  581   43  TS   S    SV S
   123   46 B I  E     + P   0 129G   0  581   23  LL   L    LL L
   124   47 B L        -     0   0    6  581   27  II   I    IV I
   125   48 B S  S    S-     0   0   22  581   57  SN   A    HD H
   126   49 B E  S    S+     0   0   99  581   62  ER   E    PR P
   127   50 B F  S    S+     0   0   42  581   82  WR   Q    QK Q
   128   51 B Y  E     - Q   0 185G   7  581   33  YY   W    WW W
   129   52 B I  E     -PQ 123 184G   0  581   14  VI   V    VV V
   130   53 B L  E     +PQ 122 183G   0  581   28  LL   L    LL L
   131   54 B T  E     - Q   0 182G   0  581   43  TT   T    TT T
   132   55 B A    >>  -     0   0    0  581    2  AA   A    AA A
   133   56 B A  G >4 S+     0   0    0  581    8  AA   A    AA A
   134   57 B H  G >4 S+     0   0    7  581    0  HH   H    HH H
   135   58 B i  G X4 S+     0   0    0  581    2  CC   C    CC C
   136   59 B L  G << S+     0   0   31  581   65  VV   F    VR V
   137   60 B Y  G <  S+     0   0  109  581   87  ST   R    GD G
   138   61 B Q  S <  S+     0   0   95  581   78  fg   n    pK p
   139   61AB A        -     0   0   16  352   75  lg   t    p. p
   140   62 B K  S    S-     0   0  172  366   75  GQ   S    N. N
   141   63 B R  S    S-     0   0  162  570   78  EP   L    K. K
   142   64 B F  E     -O  112   0G  36  577   54  YI   Y    VY V
   143   65 B K  E     -O  111   0G  67  577   78  DN   Q    RV R
   144   66 B V  E     -OR 110 161G   0  577   16  VV   V    VV V
   145   67 B R  E     -OR 109 160G  40  577   53  RR   L    QR Q
   146   68 B V  E     +OR 108 159G   1  578   43  RL   L    LL L
   147   69 B G  S    S+     0   0    9  578   14  DG   G    RG R
   148   70 B D        +     0   0   11  579   58  PE   A    KE K
   149   71 B R  S    S+     0   0   24  579   73  DY   R    QH Q
   150   72 B N  B >   -T  234   0H  18  579   65  CD   Q    YS Y
   151   73 B T  T 3  S+     0   0   56  579   79  ET   L    LL L
   152   74 B E  T 3  S-     0   0  119  579   84  RS   V    YT Y
   153   75 B Q  S <  S-     0   0  130  578   86  VS   Q    YK Y
   154   76 B E        +     0   0  165  578   85  ep   P    HL H
   155   77 B E        -     0   0   93  438   29  cn   .    .D .
   156   78 B G  S    S+     0   0   46  547   33  AQ   G    .W .
   157   79 B G  S    S+     0   0   47  555   76  pP   p    .T .
   158   80 B E        -     0   0   37  444   33  sE   a    DE D
   159   81 B A  E     -R  146   0G  27  457   60  RV   M    HQ H
   160   82 B V  E     -R  145   0G  71  557   81  NN   Y    LL L
   161   83 B H  E     -R  144   0G  14  567   77  VV   A    MR L
   162   84 B E        -     0   0   90  569   77  TN   R    TH A
   163   85 B V  E     -S  186   0G  27  574   64  II   V    VT V
   164   86 B E  E    S+     0   0G  70  575   73  EE   R    ST S
   165   87 B V  E     -S  185   0G  13  576   72  ST   Q    QF R
   166   88 B V  E     -S  184   0G  72  577   45  VL   V    IS I
   167   89 B I  E     +S  183   0G  27  578   45  II   E    II I
   168   90 B K  E     -S  182   0G  68  578   82  AP   S    TT T
   169   91 B H    >   -     0   0   19  579   14  HH   N    HH H
   170   92 B N  T 3  S+     0   0  156  579   60  PP   P    PP P
   171   93 B R  T 3  S+     0   0  150  576   74  GG   L    DS T
   172   94 B F    <   -     0   0   24  579    5  YY   Y    FY F
   173   95 B T     >  -     0   0   56  579   67  TN   Q    Yq y
   174   96 B K  T  4 S+     0   0  145  525   79  P.   .    .y .
   175   97 B E  T  4 S+     0   0  174  533   92  Q.   .    .Q .
   176   98 B T  T  4 S-     0   0   44  561   58  S.   .    IN .
   177   99 B Y    ><  +     0   0   60  566   66  L.   .    VH .
   178  100 B D  T 3   +     0   0   25  578   38  Vn   g    QE .
   179  101 B F  T 3  S+     0   0   21  558   68  Dd   .    dH q
   180  102 B D    <   +     0   0    1  577    0  Dd   d    dD d
   181  103 B I        +     0   0    0  579   14  II   V    IL I
   182  104 B A  E     -QS 131 168G   0  579   60  AA   A    AR A
   183  105 B V  E     -QS 130 167G   0  580   15  LL   L    LL L
   184  106 B L  E     -QS 129 166G   0  581   30  VI   V    LL L
   185  107 B R  E     -QS 128 165G  40  581   42  RR   E    KR E
   186  108 B L  E     - S   0 163G   0  581   17  LL   L    LL L
   187  109 B K  S    S+     0   0  101  581   69  SS   E    TN K
   188  110 B T  S    S-     0   0   82  582   74  EQ   A    NR N
   189  111 B P        -     0   0   48  582   39  RD   P    PP P
   190  112 B I        -     0   0    4  532   62  AV   V    VI V
   191  113 B T        -     0   0   95  537   72  DQ   P    NH N
   192  114 B F        +     0   0   56  580   32  FF   F    IL I
   193  115 B R  B >   -U  196   0I  52  581   64  tS   T    ST S
   194  116 B M  T 3  S+     0   0   29  564   77  dD   N    DR S
   195  117 B N  T 3  S+     0   0   13  572   89  SY   Y    YA H
   196  118 B V  B <   +U  193   0I   0  574   26  MI   I    VV V
   197  119 B A        -     0   0    1  576   81  KQ   L    HR H
   198  120 B P        -     0   0    8  576   54  PP   P    PP P
   199  121 B A        -     0   0    2  577   39  LV   V    VV V
   200  122 B g  B     -g  290   0F   1  578   67  CC   C    PA S
   201  123 B L        -     0   0   27  580    5  LL   L    LL L
   202  124 B P        -     0   0    7  581   31  PP   P    PP P
   203  124AB E     >  -     0   0   92  580   75  TL   D    PS P
   204  125 B R  H  > S+     0   0  109  580   79  TP   P    AS A
   205  126 B D  H  > S+     0   0  124  580   85  RS   S    SC S
   206  127 B W  H  >>S+     0   0    4  580   87  EE   V    EV E
   207  128 B A  I  X>S+     0   0    0  580   75  LA   I    TT T
   208  129 B E  I  <5S+     0   0   75  581   83  QS   F    FT F
   209  130 B S  I  <5S+     0   0   70  582   65  RS   E    PG P
   210  131 B T  I  <5S+     0   0   18  104   77  E.   .    .. .
   211  131AB L  I ><  S-     0   0  119  478   80  ..   .    g. .
   227  146 B E  T 3  S+     0   0   47  513   76  EE   .    V. .
   228  147 B K  T 3  S+     0   0  169  537   69  EF   .    NW S
   229  149 B G  S <  S-     0   0   29  548   67  GG   .    LD L
   230  150 B R        -     0   0  213  557   86  LK   .    PP P
   231  151 B Q  B     -V  224   0J  79  563   93  QD   .    PF P
   232  152 B S        -     0   0   14  569   51  SS   .    PP P
   233  153 B T  S    S+     0   0   48  570   73  PD   .    FD F
   234  154 B R  B    S-T  150   0H 102  570   86  VV   .    PR P
   235  155 B L        -     0   0    3  578    3  LK   L    LL L
   236  156 B K  E     -FH  98 221F  31  578   51  LL   Q    KQ K
   237  157 B M  E     -FH  97 220F  18  579   94  SK   K    EC E
   238  158 B L  E     - H   0 219F   4  580   42  VL   L    VL V
   239  159 B E  E     - H   0 218F 107  580   72  DQ   A    QN Q
   240  160 B V  E     - H   0 217F   0  580   46  LV   V    VL V
   241  161 B P  E     - H   0 216F  34  580   26  PP   P    PS P
   242  162 B Y  E     -J  263   0F  36  581   45  IK   I    IT V
   243  163 B V  E     -J  262   0F  24  582   35  VV   I    IV V
   244  164 B D     >  -     0   0   88  581   58  PN   D    ES E
   245  165 B R  H  > S+     0   0   51  581   79  RP   T    NN N
   246  166 B N  H  > S+     0   0  105  582   75  AN   P    HE Q
   247  167 B S  H  > S+     0   0   48  582   78  ES   K    LT L
   248  168 B j  H  X S+     0   0    1  582    2  CC   C    CC C
   249  169 B K  H >< S+     0   0   88  582   73  qs   n    dR d
   250  170 B L  H 3< S+     0   0  150  547   89  yg   g    gA g
   251  171 B S  H 3< S+     0   0   23  578   76  NA   Y    DV D
   252  172 B S    <<  -     0   0   20  581   83  GL   Q    NF N
   253  173 B S  S    S+     0   0   79  581   83  SG   P    VP I
   254  174 B F  S    S-     0   0  124  581   79  PV   K    HG H
   255  175 B I        -     0   0  100  582   88  KS   T    IR I
   256  176 B I        -     0   0   13  582   16  II   I    VV V
   257  177 B T    >   -     0   0   16  582   36  HT   K    RT R
   258  178 B Q  T 3  S+     0   0  133  582   68  TE   N    DE D
   259  179 B N  T 3  S+     0   0   24  582   61  TN   D    DN D
   260  180 B M  E <   - K   0 311F   2  582   11  QQ   M    MM M
   261  181 B F  E     - K   0 310F   8  581   34  LI   L    LL L
   262  182 B j  E     +JK 243 309F   1  582    0  CC   C    CC C
   263  183 B A  E     +JK 242 308F   0  582   27  AA   A    AA A
   264  184 B G  S    S-     0   0    3  582   10  GG   G    GG G
   265  185 B Y        -     0   0   56  561   58  ..   F    .G .
   266  185AB D  S    S-     0   0   81  565   84  ..   E    .E .
   267  185BB T  S    S+     0   0   76  582   62  gg   E    NA N
   268  186 B K  S    S-     0   0  107  532   32  qd   G    E. E
   269  187 B Q  S    S+     0   0  102  537   37  DG   K    GG G
   270  188 B E        +     0   0   33  581   54  KK   K    HK H
   271  189 B D  B     -E   94   0E   7  582    3  DD   D    DD D
   272  190 B A        -     0   0    7  582   42  SS   A    SA S
   273  191 B k    >   -     0   0    7  582    0  CC   C    CC C
   274  192 B Q  T 3  S+     0   0   90  582   25  GK   K    QQ Q
   275  193 B G  T 3  S+     0   0    6  582    7  GG   G    GG G
   276  194 B D    X   +     0   0    0  582    0  DD   D    DD D
   277  195 B S  T 3  S+     0   0   14  582    1  SS   S    SS S
   278  196 B G  T 3  S+     0   0    0  582    0  GG   G    GG G
   279  197 B G    <   -     0   0    0  582    2  GG   G    GG G
   280  198 B P  E     - L   0 294F   1  582    3  PP   P    PP P
   281  199 B H  E     -IL 219 293F   0  582   49  LL   L    LL L
   282  200 B V  E     -IL 218 291F   3  582   27  MM   V    VV V
   283  201 B T  E     - L   0 290F   0  582   67  YR   C    CC C
   284  202 B R  E     + L   0 289F  99  582   70  PT   L    KG K
   285  203 B F  E >  S- L   0 288F  22  582   70  gl   V    VG V
   286  204 B K  T 3  S-     0   0   85  206   71  gs   G    E. N
   287  205 B D  T 3  S+     0   0  108  208   57  VS   Q    D. G
   288  206 B T  E <   - L   0 285F   3  218   75  RR   S    T. T
   289  207 B Y  E     - L   0 284F  21  227   50  YW   W    W. W
   290  208 B F  E     -gL 200 283F   0  582   91  VM   L    LV L
   291  209 B V  E     + L   0 282F   1  582   41  QI   Q    QL Q
   292  210 B T  E     +     0   0F   1  582   84  RE   A    AQ A
   293  211 B G  E     -ML 312 281F   0  582    0  GG   G    GG G
   294  212 B I  E     -ML 311 280F   0  582   19  IV   V    VL V
   295  213 B V  E     +M  310   0F   7  582   14  VV   I    VV V
   296  214 B S  E     -     0   0F   1  581    0  SS   S    SS S
   297  215 B W  E     -M  309   0F  45  582    8  YF   W    WW W
   298  216 B G        -     0   0   26  582    0  gG   G    Gg G
   299  217 B E  S    S-     0   0   25  577   90  kY   E    Eg E
   300  218 B G  S    S-     0   0   19  580   15  RI   G    GP G
   301  220 B k  S    S-     0   0    7  582    2  CC   C    CC C
   302  221 B A  S    S+     0   0    4  581   17  GG   A    AG A
   303  222 B R    >   -     0   0  105  578   74  VT   R    QQ L
   304  223 B K  T 3  S+     0   0  152  578   65  GR   Q    PK P
   305  223AB G  T 3  S+     0   0   26  582   58  GV   N    NG N
   306  224 B K    <   -     0   0   43  582   85  FY   R    RI R
   307  225 B Y        -     0   0   33  582   49  PP   P    PP P
   308  226 B G  E     -K  263   0F   4  580    2  GG   G    GG G
   309  227 B I  E     -KM 262 297F   6  581   10  VV   V    IV I
   310  228 B Y  E     -KM 261 295F   1  581    2  YY   Y    YY Y
   311  229 B T  E     -KM 260 294F   2  581   40  TT   I    TT T
   312  230 B K  E >   - M   0 293F  21  581   40  NK   R    RK R
   313  231 B V  G >  S+     0   0    1  581    8  VV   V    VV V
   314  232 B T  G 3  S+     0   0    2  579   72  AA   T    TC T
   315  233 B A  G <  S+     0   0   29  579   80  YK   A    YK Y
   316  234 B F  S <> S+     0   0    7  575   36  YY   H    YY Y
   317  235 B L  H  > S+     0   0   23  573   81  MV   H    LT L
   318  236 B K  H  > S+     0   0  116  572   68  DP   N    DD D
   319  237 B W  H  > S+     0   0   26  572    1  WW   W    WW W
   320  238 B I  H  X S+     0   0    1  569   12  II   I    II I
   321  239 B D  H  < S+     0   0   66  541   72  LH   H    HR H
   322  240 B R  H >< S+     0   0  136  528   71  DR   R    RI R
   323  241 B S  H >< S+     0   0    6  495   71  NT   I    YV Y
   324  242 B M  T 3< S+     0   0   25  452   39  MV   I    VI V
   325  243 B K  T <  S+     0   0  153  418   69  SK   P    PR P
   326  244 B T    <         0   0   51  369   66  SA        KN K
   327  245 B R              0   0  197  260   47            DN D
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1   49 A   0   0   0   0   0   0   0   0   0   0   0   0   0   3   2   2  70  21   1   3   253    0    0   0.960     32  0.70
    2   50 A   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   341    0    0   0.020      0  1.00
    3   51 A   2  10   1   0   0   1   0   1  28   0   9   8   0   0   1   5   4  18   1  11   342    0    0   2.171     72  0.23
    4   52 A   1   1   0   0   0   0   0   1   2   5  59  16   0   1   0   1   2   6   3   1   342    0    0   1.504     50  0.45
    5   53 A   0   1   1   1   0   0   0   1   2   1  26   2   0   1   1   5  11   1  44   2   342    1   36   1.737     57  0.38
    6   54 A   1   1   0   1   0   0   0   2   0  90   1   2   0   0   0   0   1   0   0   0   343    0    0   0.511     17  0.82
    7   55 A   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   344    1    0   0.040      1  0.99
    8   56 A   8  10   0   1   0   0   0   1   3   1   2   0   0   6   7  11  44   3   1   1   343   41    4   1.921     64  0.29
    9   57 A   0   0   0   0   0   0   7   0   0   0   0   0   1   5   0   0   0   0  86   0   303    0    0   0.570     19  0.76
   10   58 A   0   0   0   0   0   0   0  61   1   0   0   0   0   4   3   0  10   4  15   2   336    0    0   1.327     44  0.51
   11   59 A   0   0   0   0   0   0   0  86  11   0   0   0   0   2   0   0   1   0   0   0   344    0    0   0.501     16  0.82
   12   60 A   4   2   6   6   0   0   0   1   3   0  19  36   0   1   1  10   6   2   1   1   344    0    0   2.059     68  0.24
   13   61 A   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   344    0    0   0.000      0  1.00
   14   62 A  15   3   4   3   1   0   0   0   1   0  11  12   0   1   5  25   5  10   3   1   344   41   53   2.283     76  0.17
   15   63 A   4   0   0   0   0   0   0   0   0   0   1   2   0   1   2   1   2   5   5  78   302    0    0   0.972     32  0.70
   16   64 A   1   6   0   0   0   0   3  37   1   1  10   2   0   4   2   1  16   2   8   5   341    0    0   2.109     70  0.25
   17   65 A  11  32  19   4   8   0   3   6   3   3   3   3   0   1   1   0   0   1   1   2   342    0    0   2.222     74  0.31
   18   66 A   0   0   0   0   0   0   0  44   2   1   3   3   0   0   6   1  19   5  10   5   343   14   42   1.811     60  0.38
   19   67 A   1   1   0   0   0   0   0  20   4   0  39   4   0   0   3   2   2  16   2   6   329    0    0   1.845     61  0.39
   20   68 A   0   2   0   0  10   0  86   0   0   0   1   0   0   0   0   0   0   0   1   0   342    0    0   0.555     18  0.90
   21   69 A   8   1  15   3   0   0   3   1   5   0  11  29   0   5   3   1   5   2   3   6   343    0    0   2.309     77  0.17
   22   70 A   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   343    0    0   0.000      0  1.00
   23   71 A  11   8   6   0  16   0   1   0   3   0   8  36   0   1   3   2   2   1   1   1   344    0    0   2.077     69  0.19
   24   72 A   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   344    0    0   0.040      1  0.99
   25   73 A   2  32   1   1   0   0   1   1  11  22   5   2   0   1   3   7   2   1   8   2   344    0    0   2.128     71  0.14
   26   74 A   1   5   0   2   1   0   0   0   7  28  12   2   0   3   1   1   5  26   1   6   344    0    0   2.121     70  0.26
   27   75 A   0   0   0   0   0   0   0  78   4   0   1   0   0   0   1   0   1   5   3   6   344    1   13   0.895     29  0.76
   28   76 A   1   1   0   0  62   6  27   0   1   0   1   0   0   0   1   0   0   0   0   0   343    0    0   1.069     35  0.84
   29   77 A   1   0   1   1   1   0   2   1   1   0  11  13   0   6   2   2   3  50   1   5   343    0    0   1.810     60  0.36
   30   78 A   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   343    0    0   0.080      2  0.98
   31   79 A   8   1   1   0   0   0   1   0   3   4   5   3   0   3  29  31   3   4   1   3   343    0    0   2.092     69  0.28
   32   80 A   0   3   1   0   1   0   8   1   0   0   1   5   0  15   3   1   1   0  50  10   343    0    0   1.714     57  0.37
   33   81 A   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   344    2    0   0.000      0  1.00
   34   82 A   0   1   1   0   0   0   0   1   3   0   2   1   0   0   0   0  10  72   1   8   342   53  223   1.107     36  0.70
   35   83 A  15  61   8   2   2   0   0   0   1   2   2   3   0   1   0   0   2   0   1   0   289    0    0   1.445     48  0.58
   36   84 A   3   9  16   0  11   0   7   1   1   4   4   6   7   1   5   4   4   4   9   4   292  234   11   2.695     89  0.06
   37   85 A   4   1   3   4   0   0   0   0   1   0   0  43   3   0   0  28   0   9   1   3    76    0    0   1.651     55  0.24
   38   86 A   1   0   2   0   2   0   7   4  33   3   8   9   0   0  31   0   0   0   0   1   101    0    0   1.808     60  0.11
   39   87 A   0   5   0   0   1   0   0  14   1   0   4  17   1   0   0  34   4   4   5  11   140    0    0   1.999     66  0.22
   40   88 A   1  21   2   0   3   0   1   3   1  11  18   4   1   1   2   8   1   5  17   1   168    0    0   2.319     77  0.08
   41   89 A   5   0   0   0   0   0   0   0   0   1   1   2  89   0   0   0   0   0   0   0   238    0    0   0.507     16  0.80
   42   90 A  11  11   5   5   0   2   0   0   5   0  31   1   0   0  10   2   2  10   0   3   244    0    0   2.232     74  0.14
   43   91 A  11  21   5   0   2   0  10   0   2   0   0   7   1   3   1   3   7   4  16   6   274    0    0   2.439     81  0.10
   44   92 A   2   1   0   0   2   0   0   2   8   0   6   1   0   0   5   2   1  19  12  38   297    0    0   1.951     65  0.38
   45   93 A   4   1  10   0   0   0   1   8   2   2   2   3   0   0   1   2   0   1  58   4   315    0    0   1.646     54  0.36
   46   94 A   0   3   0   2   2   0   0  62   0   0   5   2   0   1   1   5   1   1   3  13   316    0    0   1.469     49  0.46
   47   95 A   0   1   0   0   0   0   1  37   2   8   0   5   0   1   1   0   2  13   6  21   344    0    0   1.909     63  0.39
   48   96 A   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   344    0    0   0.060      1  0.98
   49   97 A   1   1   1   1   1   5   0   1  15   0  10   1   0   0   5   1   9  27   1  21   344    0    0   2.075     69  0.27
   50   98 A   0   0   0   0   1   0   0   2   1   1  13   1   0  28   2   0  37   1   7   6   344    0  121   1.724     57  0.37
   51   99 A   1   1   2   0  43   0  17   0   1   0   3  16   0   1   1   2   5   4   1   2   344    0    0   1.823     60  0.23
   52  100 A   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   344    0    0   0.020      0  0.99
   53  101 A   4   2   6   2   0   2   2   1   1   0  18   7   0  15   6  17   6   5   3   4   344    0    0   2.514     83  0.14
   54  102 A   1   0   1   0   0   0   0   3   3  12   3   1   0   1   2   0   2  29   7  35   344    0    0   1.865     62  0.43
   55  103 A   7   1   2   1   3   0   0  17   1   1   8   6   0  11   3   6   2  14   5  12   344   34  128   2.497     83  0.19
   56  104 A  14   2   5   0   1   0   0   8   7   3   1   8   0   1   1   2  20  10   1  16   310   35  134   2.356     78  0.22
   57  105 A   0   8   1   0   0   1   0  14  10   0   9  11   0   1   6   2   3   3  29   2   307    4   25   2.196     73  0.21
   58  106 A   1   0   1   0   0   1   0  14   4   0  35   5   1   0  10  10   2   3   7   5   337    0    0   2.144     71  0.29
   59  107 A  13   2   3   0  16   0  27   4   1   0   0   2   0   3  29   0   0   0   0   0   343    0    0   1.838     61  0.13
   60  108 A  19   1   1   5   3   0   3   0   1   0  19  15   0   1   5   7   9   4   6   0   344    0    0   2.353     78  0.12
   61  109 A   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   344    0    0   0.000      0  1.00
   62  110 A   1   2   0   1   3   4   3   2   3   0  50   3   0   2  13   2   1   5   6   1   344    0    0   1.923     64  0.29
   63  111 A   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   344    0    0   0.000      0  1.00
   64  112 A   2  10   4   0   0   0   1   0  48  13   1   2   0  12   1   1   1   1   0   1   344    0    0   1.764     58  0.30
   65  113 A   4   3   1   1   3   0   0   0   8  13   9   2   0   3  10   6   5  21   2   8   344    0    0   2.484     82  0.17
   66  114 A   0   0   0   0   0   0   0  90   0   3   5   0   0   0   0   0   0   0   0   1   344    0    0   0.481     16  0.86
   67  115 A   0   0   0   0  12   9  78   0   0   0   0   0   0   1   0   0   0   0   0   0   344    0    0   0.723     24  0.92
   68  116 A   6   3   4   2   1   0   1   3   5   0   8  31   0   1   6  12   4   5   5   3   343    0    0   2.413     80  0.18
   69  117 A   0  62   3   0   0   0   0  33   0   0   0   0   0   0   0   0   1   1   0   0   340    0    0   0.866     28  0.32
   70  118 A   0  10   1   2   0   0   0  16  21   3  10   6   0   1   1   3  10   2   4  10   340    0    0   2.377     79  0.21
   71  119 A   3   3   1   2   0   0   0   1  11   4   6   8   0   3   6   2   2  10  13  24   340    0    0   2.434     81  0.23
   72  120 A   0   0   0   0   0   0   0   1   0   0   4   1  33   0   0   1   0   0  14  46   340    0    0   1.250     41  0.26
   73  121 A   0   0   0   0   0   0   0  45   0   1   6   2   0   3   1   2   7  24   3   5   340    0    0   1.725     57  0.43
   74  122 A  23   5   2   2   2   0   1   0   1   0   2   6   1   6  17  24   2   2   2   1   332    0    0   2.214     73  0.16
   75  123 A   4   0   0   1   0   0   0   1  10   0  41  10   0   0   5   6   2   3   8   9   330   27   20   2.001     66  0.29
   76  124 A  12   4   7   0   0   0   0   0   0   0   1   1  72   0   0   1   0   0   0   0   300    0    0   1.031     34  0.52
   77  125 A  15   3  16   5   0   0   0   1   7   0   2   9   0   0   2   3   4   6   4  20   304    0    0   2.407     80  0.17
   78  126 A   0   1   0   0   0   0   0   1  12  55  10   1   0   0   1   4   0   6   1   9   304    0    0   1.561     52  0.43
   79  127 A   3   0   2   1   0   0   0   3   4   0   2  34  28   3   0   9   6   5   1   0   304    0    0   1.962     65  0.20
   80  128 A  32   6   0   0   0   0   0  22  10   0   7   4   0   0   1   0   0   9   2   7   305    0    0   2.024     67  0.24
   81  129 A   2   1   1   6   0   0   0   1   1  24  13   4   0   0   5   5   2  19   5  12   311    0    0   2.232     74  0.21
   82  130 A   4   3   1   0  24   0  32   0   3   0   8   2   4   1   6   1   0   1   8   2   312    0    0   2.100     70  0.22
   83  131 A   1   0   1   0   0   0   0   1   7  74  14   1   0   0   1   1   0   0   0   0   312    0    0   0.936     31  0.66
   84  132 A   0   0   0   0   0   0   0   0   1   0   0   0  99   0   0   0   0   0   0   0   323    0    0   0.080      2  0.97
   85  133 A   0   0   0   0   0   0   0  75  12   0   2   2   0   0   0   0   3   3   0   1   295    0    0   0.972     32  0.69
   86  134 A   0   0   0   3   0   0   0   1   2   0   2   3   0   3  18  40   8   0  18   2   294    0    0   1.806     60  0.37
   87  135 A  19  16  28   2   1   0   0   6   1   1   1   2   0   3   2   0   8   0   7   1   243    0    0   2.170     72  0.26
   88  136 A   2   8   9   0   0   0   0   7   3  34   4  22   0   1   2   5   3   1   0   1   220    0    0   2.043     68  0.20
   89  137 A  25  28  24   5   0   0   0   0   0   0   5   3   0   0   0   9   0   0   0   0   200    0    0   1.777     59  0.43
   90  138 A   2   3   0   0   0   0   0  20  13   3   8   8   0   1   1   3   9  22   3   4   120    0    0   2.251     75  0.28
   91  139 A   0   0   0   0   0   0   0   0   0   0   0   0   0   7  74  15   2   0   1   0    97    0    0   0.827     27  0.71
   92          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
   93   16 B   3   0  96   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   558    0    0   0.216      7  0.96
   94   17 B  88   0  10   0   0   0   1   0   1   0   0   0   0   0   0   0   0   0   0   0   561    0    0   0.490     16  0.90
   95   18 B   0   0   0   0   0   0   0  96   0   0   0   0   0   0   0   0   0   0   2   1   562    0    0   0.225      7  0.93
   96   19 B   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   563    0    0   0.013      0  0.99
   97   20 B   4   1   1   1   3   1  39   0   1   0  10   5   0   2  10   5  10   5   1   2   564    0    0   2.148     71  0.04
   98   21 B   2   0   1   0   0   0   1   0   3   7   2  25   0   0   0   3   2  36   4  13   565    0    0   1.908     63  0.34
   99   22 B   6   0   2   0   0   0   0   0  23   0   4  12  52   0   0   0   0   0   0   0   565    1    0   1.349     45  0.41
  100   23 B   2   4   0   0   0   0   0   3  11   8   8  17   0   1   6  12  10  13   2   4   564    0    0   2.434     81  0.21
  101   24 B   3   2  18   1   1   0   0   1  11  18   1   1   0   1   6  13   2  15   2   5   565    0    0   2.317     77  0.15
  102   25 B   0   1   0   0   1   0   7  28   1   0   4   1   0  13   1   1   5   5  29   1   565    0    0   1.976     65  0.26
  103   26 B   0   1   0   1   0   0   1   2   6   0  44   1   0   1   1   3   4  21   7   6   565    0    0   1.836     61  0.33
  104   27 B  22   5   5   1  10  13   8   0   4   0   1   0  11   3   2   1  14   0   0   0   565    0    0   2.302     76  0.08
  105   28 B   0   0   0   0   0   0   0   1   2  93   1   1   0   0   0   2   0   0   0   0   567    0    0   0.353     11  0.90
  106   29 B   0   0   0   0   2  44  45   0   0   0   0   0   0   9   0   0   0   0   0   0   568    0    0   1.042     34  0.73
  107   30 B   2   2   2   5   0   0   0   0   0   0   0   1   0   0   0   0  88   0   0   0   569   11   79   0.568     18  0.75
  108   31 B  64   3   5   1   0   0   0   0  21   0   2   1   0   0   0   0   0   1   0   0   559    0    0   1.203     40  0.53
  109   32 B   1  12   2   2   1   0   2   1   3   0  64   1   0   0   3   0   3   1   1   1   567    0    0   1.480     49  0.34
  110   33 B   1  88   4   1   4   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   570    0    0   0.585     19  0.88
  111   34 B   5   2   7   0   4   1   2   1   0   0   2   3   0   3   5   3  18   1  41   1   570    0    0   2.076     69  0.18
  112   35 B   4   2   2   1   2   0  12   3   9   1  31   3   0   1   8   4   2   1  10   4   570  458   27   2.358     78  0.12
  113   36 B   2   1   1   0   4   0   0   4   9   4   7   5   0   4   2   6   2  44   4   3   113    0    0   2.096     69  0.23
  114   37 B   0   3   0   0   0   1   2  19   1   2  10   5   0   0   8   4   2  19  17   7   242    0    0   2.339     78  0.23
  115   38 B   0   1   1   0   1   0   1  65   1   0   5   1   0   1   2   2   2   1  11   3   543    1    0   1.462     48  0.47
  116   39 B   1   1   2   1   2   0  39   8   2   0  16   2   0   1   3   3   3  11   3   1   561    0    0   2.112     70  0.06
  117   40 B   1   1   1   0   1   0   1   9   2   2   2   0   0  67   4   2   3   2   2   0   572    0    0   1.447     48  0.44
  118   41 B   1   7  10   1  68   1   4   1   0   0   1   1   0   2   2   0   0   0   1   0   581    3   84   1.277     42  0.65
  119   42 B   0   0   0   0   0   0   0   1   0   0   0   0  99   0   0   0   0   0   0   0   578    0    0   0.041      1  0.99
  120   43 B   0   0   0   0   0   0   0  98   1   0   1   0   0   0   0   0   0   0   0   0   581    0    0   0.103      3  0.98
  121   44 B   0   0   0   0   0   0   0  91   9   0   0   0   0   0   0   0   0   0   0   0   581    0    0   0.318     10  0.90
  122   45 B   4   0   2   0   0   0   0   0   4   0  69  19   0   0   0   0   0   0   0   0   581    0    0   0.986     32  0.56
  123   46 B   2  66  32   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   581    0    0   0.717     23  0.76
  124   47 B  17  22  58   0   0   0   3   0   0   0   0   0   0   0   0   0   0   0   0   0   581    0    0   1.060     35  0.72
  125   48 B   0   0   0   0   0   0   0   2   4   0  43   5   0   4   0   1   0   0  35   5   581    0    3   1.484     49  0.43
  126   49 B   0   0   0   0   0   0   0   1   7   9  15   1   0   0   3   7   2  34   5  17   581    0    0   1.954     65  0.37
  127   50 B   0   1   0   0   6   2   6   1   0   0   3   3   1   1  12   4  29   6  18   8   581    0    0   2.226     74  0.18
  128   51 B   1   1   4   0   4  69  16   0   0   0   0   2   0   3   0   1   0   0   0   0   581    0    0   1.089     36  0.67
  129   52 B  72   2  25   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   581    0    0   0.708     23  0.85
  130   53 B  43  49   6   1   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   581    0    0   0.963     32  0.72
  131   54 B   0   0   0   0   0   0   0   0   0   0  46  54   0   0   0   0   0   0   0   0   581    0    0   0.713     23  0.57
  132   55 B   1   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   581    0    0   0.085      2  0.98
  133   56 B   0   0   0   0   0   0   0   5  92   0   1   1   0   0   0   0   0   0   0   0   581    0    0   0.339     11  0.91
  134   57 B   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   581    0    0   0.013      0  1.00
  135   58 B   0   0   0   0   0   0   0   0   0   0   0   1  99   0   0   0   0   0   0   0   581    0    0   0.093      3  0.97
  136   59 B  16  13  11   2   9   3  37   0   1   0   1   3   0   0   0   2   1   0   1   0   581    0    0   1.918     64  0.34
  137   60 B   3   3   7   1   2   1   8   2   3   2   3   2   0   5   5  34   8   4   3   5   581    0    0   2.443     81  0.13
  138   61 B   0   2   1   0   0   0   4  15   1   7  33   4   0   1   6   3   9   2   6   5   581  229  248   2.227     74  0.22
  139   61 B   6   4   4   1   0   2   0   3  37  18   3   8   0   1   5   3   0   2   1   3   352    0    0   2.191     73  0.25
  140   62 B   2   1   1   0   2   0   2   3   5   1  34   5   0   1   7  18   1   6   6   4   366    0    0   2.198     73  0.24
  141   63 B   1   5   1   2   1   0   2   3   2   0   7   3   0   3  39   8  10   2   5   6   570    0    0   2.209     73  0.21
  142   64 B  15  18  32   4  15   2   7   0   0   0   0   0   0   5   0   0   1   0   0   0   577    0    0   1.914     63  0.45
  143   65 B   3   2   3   1   0   0   1   1   2   0   6   7   0   1  12  12  29  14   3   1   577    0    0   2.272     75  0.21
  144   66 B  80   2  12   1   1   0   0   0   3   0   0   0   0   0   0   0   0   0   0   0   577    0    0   0.741     24  0.83
  145   67 B   7   3   5   1   1   0   1   1   1   0   1   2   0   2  71   2   2   0   0   0   577    0    0   1.280     42  0.46
  146   68 B  24  56   4   2   2   0   2   0   7   0   0   1   0   1   0   0   0   0   0   0   578    0    0   1.373     45  0.57
  147   69 B   0   1   0   0   0   0   0  92   1   0   2   0   0   0   1   0   0   0   3   1   578    0    0   0.442     14  0.85
  148   70 B   1   1   0   1   0   0   0   1   5   1  16   4   0   1   2   5   1  50   0  13   579    0    0   1.692     56  0.41
  149   71 B   2   5   0   0   1   1   8   0   0   1   6   9   0  50  10   0   2   1   3   2   579    1    0   1.843     61  0.26
  150   72 B   0   2   1   1   2   1   5   0   1   0   6   2   0   6   3   3   3   1  50  14   579    0    0   1.882     62  0.34
  151   73 B   3  16  38   3   2   1   1   0   1   0   7  10   0   5   7   3   3   1   1   0   579    0    0   2.115     70  0.21
  152   74 B   3   2   1   1   3   3   3   4  11   0   7   5   1   1   9   5   3  18  13   9   579    1    0   2.567     85  0.16
  153   75 B  33   3   4   1   1   0   2   2   4   1  12   3   0   1   5  12   5   8   2   2   578    0    0   2.319     77  0.14
  154   76 B   3  13   3   1   2   0   2  19   2   6   5  10   0   1   1   4   3  11  13   2   578  141   47   2.538     84  0.14
  155   77 B   1   1   0   0   0   0   0   2   0   0   2   2   0   0   0   1   0  78   2  10   438    0    0   0.976     32  0.71
  156   78 B   0   0   0   0   0   1   0  78   1   3   4   1   0   0   2   1   1   3   2   3   547    0    0   1.070     35  0.66
  157   79 B   3   1   1   0   2   0   1  10   1   4  13  31   0   2   1   1   5   1  18   3   555  128   39   2.218     74  0.24
  158   80 B   1   1   0   0   0   0   1   3   5   0   1   0   0   0   1   0   2  81   0   2   444    0    0   0.960     32  0.67
  159   81 B   5   1   3   5   0   0   0   0   4   1   1   3   0   1   2   3  64   6   0   0   457    0    0   1.522     50  0.40
  160   82 B  13   8  10   2  34   0   5   0   4   0   3   4   0   4   3   3   2   3   1   3   557    0    0   2.304     76  0.18
  161   83 B   9   2  44   3   2   0   8   0   3   0   2   1   1  12   9   1   1   1   0   0   567    0    0   1.943     64  0.23
  162   84 B   1   0   1   3   0   0   1   4   5   3  15   6   0   1   8   7   8   9  16  12   569    0    0   2.485     82  0.22
  163   85 B  44   2   7   0   0   0   0   1  18   1  25   2   0   0   0   0   0   0   0   0   574    0    0   1.488     49  0.36
  164   86 B   3   1   2   0   0   0   0   1  29   0  21   3   0   1   4   6   4  18   0   6   575    0    0   2.072     69  0.26
  165   87 B   8   1   1   2   0   0   0   1   6   0   5   2   0   0  19  37  10   5   2   2   576    0    0   2.061     68  0.28
  166   88 B  39   4  37   2   3   0   2   0   3   0   2   5   0   0   0   2   1   0   0   0   577    0    0   1.630     54  0.55
  167   89 B  10   2  67   0   2   0   5   0   0   0   1   2   0   2   2   2   1   2   0   0   578    0    0   1.368     45  0.55
  168   90 B  11   4  10   2   0   2   1   1   2   4   4   4   1   0  37  12   3   1   1   0   578    0    0   2.192     73  0.18
  169   91 B   0   1   0   0   0   0   1   0   0   0   0   0   0  91   0   0   0   0   5   0   579    0    0   0.443     14  0.86
  170   92 B   0   0   0   0   1   0   1   4   2  59   5   1   0   1   3   3   2  12   7   0   579    3    5   1.585     52  0.40
  171   93 B   0   3   0   0   0   1   1   7   1   0  17   1   0   1   9  18   7   3  22   8   576    0    0   2.241     74  0.25
  172   94 B   0   1   0   0  23   0  75   0   0   0   0   0   0   1   0   0   0   0   0   0   579    0    0   0.640     21  0.95
  173   95 B   4   2   1   0   0   0   1   1   1   0  19   4   0   2   3   3   3   1  39  17   579   55   67   1.918     64  0.32
  174   96 B   1   1   2   1   2   1   5   3   6   9  40   1   0   1  10   9   2   2   1   4   525    0    0   2.192     73  0.21
  175   97 B   2   2   3   2   2  13  11   1   4   2   4   4   0   1  14   7   4  10  10   7   533    0    0   2.640     88  0.08
  176   98 B   1   2   2   0   1   0   1   2   2   1   8  58   0   0   2   1   1   0  14   3   561    0    0   1.620     54  0.42
  177   99 B   5  29  17   7   8   0  20   0   1   0   3   2   0   2   0   2   2   0   2   0   566    0    0   2.087     69  0.34
  178  100 B   1   0   1   1   0   0   0   2   1   1   1   1   0   1   1   0   1   3  17  67   578   21   53   1.294     43  0.62
  179  101 B   0   0   0   0  10   0  16   0   1   0   6   0   1   6   2   1   0   0  56   1   558    0   12   1.484     49  0.32
  180  102 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   577    0    0   0.013      0  1.00
  181  103 B  14   3  79   0   3   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   579    0    0   0.714     23  0.86
  182  104 B   0   4   0  40   0   0   0   2  49   0   2   0   1   0   0   0   0   0   0   0   579    0    0   1.125     37  0.39
  183  105 B  13  81   4   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   580    0    0   0.646     21  0.84
  184  106 B  10  34  50   5   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   581    0    0   1.176     39  0.69
  185  107 B   1   2   0   0   0   0   0   0   0   0   0   1   0   1  21  63   3   8   0   0   581    0    0   1.184     39  0.58
  186  108 B   2  89   0   1   1   0   0   0   0   0   0   6   0   0   0   0   0   0   0   0   581    0    0   0.483     16  0.83
  187  109 B   1   0   0   0   1   0   0   1  10   0  43   2   0   1   4  19   3   7   3   4   581    0    0   1.890     63  0.31
  188  110 B   0   1   0   0   1   0   1   2   3   1  24  22   0   2   8  19   4   9   2   2   582    0    0   2.121     70  0.25
  189  111 B   0   0   0   0   0   0   1   1   9  73   6   1   0   0   3   2   0   1   1   2   582   50   25   1.173     39  0.61
  190  112 B  20  10  16   3   2   0   0   0  48   0   0   1   0   0   0   0   0   0   0   0   532    0    0   1.466     48  0.37
  191  113 B   9   1   5   0   0   0   0   1   4   3   7  43   0   1   5   6   5   5   3   2   537    0    0   2.093     69  0.27
  192  114 B   5  43  16   1  29   1   4   0   1   0   0   1   0   0   1   0   0   0   0   0   580    0    0   1.463     48  0.67
  193  115 B   0   0   0   0   0   0   0   6   2   0  20  11   0   1   9   1   0   1  46   4   581   18   72   1.677     55  0.36
  194  116 B   1   1   0   6   0   0   0   2  11   3  28   6   1   1   4   9  10   7   5   8   564    0    0   2.338     78  0.22
  195  117 B   0   1   1   0   3   1  28   3   3   0   7   6   0   4  16   4   2   1  18   2   572    0    0   2.247     74  0.10
  196  118 B  72   1  17   0   1   0   0   0   4   0   0   1   0   0   1   1   1   0   0   0   574    0    0   1.000     33  0.73
  197  119 B   3   5   1   0   1   0   0   2  21   0  16   2   0   3  10  10  22   1   3   1   576    0    0   2.198     73  0.19
  198  120 B   1   1   1   0   1   0   1   0   6  56   6  22   0   0   1   2   0   0   1   0   576    0    0   1.436     47  0.45
  199  121 B  43   2  37   0   0   0   0   0  17   0   0   0   0   0   0   0   0   0   0   0   577    0    0   1.146     38  0.60
  200  122 B   1   1   1   0   0   0   0   4  21  11  18   2  33   0   2   2   0   3   0   1   578    0    0   1.910     63  0.33
  201  123 B   2  94   1   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   580    0    0   0.306     10  0.94
  202  124 B   1   1   1   0   1   0   0   1   9  80   1   1   0   0   0   0   1   4   0   0   581    1    0   0.873     29  0.68
  203  124 B   1   1   0   0   1   0   0   1   5   3  25  19   0   1   7   7   4  12   3  10   580    0    0   2.244     74  0.24
  204  125 B   2   1   1   1   1   1   2   8  16   5  27   3   0   0   7  12   5   5   1   3   580    0    0   2.353     78  0.21
  205  126 B   5   2   0   1   1   0   0   8   3   5   5   4  37   1   2   1   1   5   4  15   580    0    0   2.183     72  0.14
  206  127 B  10   2   2   0   2   8   2   1  32  16   7   4   0   1   1   1   2   5   2   3   580    0    0   2.296     76  0.12
  207  128 B   2   2   3   1   1   0   1   3  27  16  16   7   0   0   2   4   1   6   2   5   580    0    0   2.302     76  0.24
  208  129 B  10   4   3   0   7   0   2   2  32   8   3   7   0   0   1   1   1  11   2   6   581    0    0   2.311     77  0.17
  209  130 B   1   2   2   0   0   0   2  52   5   7   9   3   0   0   3   3   1   4   2   3   582  478   17   1.896     63  0.35
  210  131 B   6  14   2   0   2   0   1   7   3   1   4  50   1   1   1   1   2   2   1   2   104    0    0   1.892     63  0.22
  211  131 B   5  58   2   7   7   2   2   1   3   0   2   1   0   0   0   0   2   2   2   4   122    0    0   1.699     56  0.44
  212  131 B   3  16   1  38   4   2   3   1   6   3   1   2   2   0   7   4   4   1   0   1   141    0    0   2.189     73  0.24
  213  132 B   4   0   0   0   0   0   0   3  12   7   5  50   0   0   2   1   0   4   4   6   422  206    5   1.825     60  0.38
  214  133 B   3   0   1   0   3   1   0  51   2   1   3   1   0   1   1   2  21   1   5   3   238    1    0   1.759     58  0.36
  215  134 B   2   2   0   3   1   0   2   3   3   1   8  40   0   1   3  17   4   3   1   6   375    0    0   2.115     70  0.24
  216  135 B   2   4   2  17   0   0   1   1   2   3  12  12   0   1   3   9  11  12   8   1   546    0    0   2.484     82  0.14
  217  136 B   5   4   1   0   0   1   0  17  12   0   3   1  57   0   0   0   0   0   0   0   558    0    0   1.376     45  0.39
  218  137 B  12  31  11   1   1   7   4   1   0   0   3  18   0   0   6   2   1   1   0   0   574    0    0   2.098     70  0.22
  219  138 B  66   1  30   0   0   0   0   0   2   0   0   1   0   0   0   0   0   0   1   0   581    0    0   0.847     28  0.82
  220  139 B   2   1   1   0   0   0   0   0   5   0  67  24   0   0   0   0   0   0   0   0   582    0    0   0.935     31  0.56
  221  140 B   0   0   0   1   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   582    0    0   0.045      1  0.98
  222  141 B   0   0   0   0  10  87   2   0   0   0   1   0   0   0   0   0   0   0   0   0   582    0    0   0.477     15  0.95
  223  142 B   0   0   0   0   0   0   0  99   0   0   1   0   0   0   0   0   0   0   0   0   582   89  158   0.055      1  0.99
  224  143 B   0   1   1   1   0   1   0   0   2   1   4  11   0   1  25   8   4   3  35   3   493    0    0   1.987     66  0.27
  225  144 B   5   9   6   1   0   0   1   1   2   1   5  60   1   0   1   2   1   4   0   1   548   99  170   1.618     54  0.41
  226  145 B   1   2   1  11   3   0   1   5   3   1  44   4   0   9   3   2   4   2   2   2   478    0    0   2.114     70  0.20
  227  146 B   3   1   2   2   4   1   2   6   1   2  33   3   0   1   1   0   1  30   4   3   513    0    0   2.033     67  0.24
  228  147 B   0   2   1   1   1   0   1  44   2   3  19   1   0   1   3   8   2   2   5   4   537    0    0   1.993     66  0.31
  229  149 B   8   2   1   0   1   1   3  41   8   1  14  12   1   0   1   1   2   3   1   1   548    0    0   2.030     67  0.33
  230  150 B   3   3   1   1   2   0   3   3  10   6  15   4   0   1  13   4   2   5  16   8   557    0    0   2.570     85  0.13
  231  151 B   2  14   3   2   3   0  26   2   7   5   9   4   0   1   1   0   7   1   3  10   563    0    0   2.393     79  0.06
  232  152 B   0   0   0   0   0   0   0   5   6  46  35   2   0   0   2   2   0   1   1   1   569    0    0   1.394     46  0.48
  233  153 B   2   1   1   0   2   0   1   1   4   3  11  14   1   0   3   3   2   5  14  32   570    0    0   2.207     73  0.26
  234  154 B  15  14   7   1   1   0   2   0   1   1   2  15   0   2  10  14   4   6   2   1   570    0    0   2.440     81  0.14
  235  155 B   2  97   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   578    0    0   0.184      6  0.96
  236  156 B   0   3   0   6   0   0   0   0   0   0   0   0   0   2  15  12  60   0   2   0   578    0    0   1.309     43  0.48
  237  157 B   2   0   1   8   1   0   2   1   5   0   2   1  42   1   3   9  11   9   0   1   579    0    0   2.054     68  0.06
  238  158 B  37  50   1   1   0   0   0   1   8   0   0   2   0   0   0   0   0   0   0   0   580    0    0   1.139     38  0.58
  239  159 B   2   1   3   1   0   1   1   0   4   1   6   8   0   2   3   6   6  21  16  20   580    0    0   2.340     78  0.28
  240  160 B  48  10  16   0   0   0   0   0  25   0   0   0   0   0   0   0   0   0   0   0   580    0    0   1.297     43  0.53
  241  161 B   0   0   0   0   0   0   1   1   1  85   1   1   0   0   1   2   3   1   1   3   580    0    0   0.773     25  0.73
  242  162 B  22  14  47   0   2   0   9   0   1   0   0   2   0   0   1   1   0   0   0   0   581    0    0   1.529     51  0.55
  243  163 B  38  45   9   3   1   1   1   0   1   0   0   0   0   1   0   0   0   0   0   0   582    1    0   1.295     43  0.64
  244  164 B   0   0   0   0   0   0   0   2   3   5  53   7   0   0   1   1   0   4   4  19   581    0    0   1.584     52  0.42
  245  165 B   1   4   1   0   1   2   2   0   2   2   3   5   0   4  19   3  12   3   8  28   581    0    0   2.299     76  0.21
  246  166 B   1   0   0   0   0   0   0   1  23   3  18   6   1   1   8   5   4  12  12   6   582    0    0   2.301     76  0.24
  247  167 B   6   1   2   0   1   0   1   0   5   0  14  15   0   0   4   6  11  13   0  20   582    0    0   2.247     74  0.22
  248  168 B   0   0   0   0   0   0   0   0   0   0   0   0  99   0   1   0   0   0   0   0   582    0    0   0.080      2  0.97
  249  169 B   0   1   0   1   2   0   1   0   3   0   8   1   0   2  15  20   6  14  19   7   582   34  208   2.239     74  0.27
  250  170 B   2   9   1   0   0   0  11   5  14   1  12   1   0   1   4   8   3   3  22   3   547    0    0   2.376     79  0.11
  251  171 B   2   2   0   1   1   0  11   2  20   0  45   1   1   1   3   4   1   2   1   1   578    0    0   1.886     62  0.24
  252  172 B   1   2   0   1   2   0  54   4   3   2  15   6   0   0   3   2   2   1   2   1   581    0    0   1.754     58  0.16
  253  173 B   1   1   1   1   3   2   8   8   4  44  12   1   0   1   3   3   1   1   4   2   581    1    0   2.093     69  0.17
  254  174 B   1   2   2   0  12   0   2  51   2   2   4   2   0   1   4   4   2   2   4   4   581    0    0   1.921     64  0.21
  255  175 B   2   2   6  15   2   0   2   8   3   2   6   5   0   0   8   9  16   7   2   6   582    0    0   2.615     87  0.12
  256  176 B  10   5  81   0   3   0   0   0   0   0   1   0   0   0   0   0   0   0   0   1   582    0    0   0.735     24  0.84
  257  177 B   0   1   0   0   0   0   1   1   1   2   7  78   0   2   1   3   1   0   1   1   582    0    0   1.017     33  0.64
  258  178 B   0   0   0   0   0   0   0   3   7   6  17   2   0   0   3   5   8  13  15  19   582    0    0   2.247     75  0.31
  259  179 B   0   0   1   0   0   0   1   3   8   0   8   7   0   1  13   1   1   1  53   4   582    0    0   1.635     54  0.39
  260  180 B   1   0   0  94   1   0   0   0   1   0   0   0   0   0   0   0   2   0   0   0   582    1    0   0.357     11  0.88
  261  181 B   8  17  26   5  44   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   581    0    0   1.392     46  0.65
  262  182 B   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   582    0    0   0.023      0  0.99
  263  183 B   7   7   1   0   0   0   0   2  82   0   1   0   0   0   0   0   0   0   0   0   582    0    0   0.720     24  0.73
  264  184 B   0   0   0   0   0   0   2  95   3   0   0   0   0   0   0   0   0   0   0   0   582   21    3   0.274      9  0.90
  265  185 B   3   4   1   0  31   0  42   1   4   1   2   1   0   1   2   1   1   0   2   2   561    0    0   1.785     59  0.42
  266  185 B   2  46   1   4   0   0   0   2   2   7   3   7   0   2   3   3   2   8   1   8   565    0    0   2.057     68  0.16
  267  185 B   0   1   0   0   1   0   0   6  11   2   9   5   0   1   1   4   4  49   3   4   582   50   47   1.878     62  0.38
  268  186 B   0   1   1   0   0   0   0  84   0   0   0   0   0   0   2   7   1   2   1   0   532    0    0   0.761     25  0.67
  269  187 B   0   2   0   0   0   0   0  80   0   3   2   0   0   0   3   3   5   1   1   0   537    0    0   0.956     31  0.62
  270  188 B   6   1   2   1   0   0   0   2   1   0   0   1   0   1  10  63   3   9   0   0   581    0    0   1.431     47  0.46
  271  189 B   0   0   0   0   0   0   0   1   0   0   1   0   0   0   0   0   0   0   0  98   582    0    0   0.145      4  0.96
  272  190 B   1   0   0   0   0   0   0   0  34   0  60   4   0   0   0   0   0   0   0   0   582    0    0   0.881     29  0.58
  273  191 B   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   582    0    0   0.013      0  1.00
  274  192 B   1   1   0   0   0   0   0   1   1   0   1   1   0   0   1   3  84   3   2   2   582    0    0   0.836     27  0.74
  275  193 B   1   0   0   0   0   0   1  96   1   0   0   0   0   0   1   0   0   0   1   0   582    0    0   0.229      7  0.93
  276  194 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   582    0    2   0.025      0  0.99
  277  195 B   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   582    0    0   0.063      2  0.98
  278  196 B   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   582    0    0   0.048      1  0.99
  279  197 B   0   0   0   0   0   0   0  98   0   0   2   0   0   0   0   0   0   0   0   0   582    0    0   0.092      3  0.98
  280  198 B   1   0   0   0   0   0   0   0   1  98   0   0   0   0   0   0   0   0   0   0   582    0    0   0.111      3  0.97
  281  199 B  39  40   0   3   5   0   1   0   2   0   0   0   0   9   0   0   0   0   0   0   582    0    0   1.367     45  0.50
  282  200 B  80   3   2   5   1   0   0   0   6   0   1   1   0   1   0   0   1   0   0   0   582    0    0   0.886     29  0.72
  283  201 B   8   2   2   2   1   0   2   1   8   0   5  11  54   1   1   1   0   0   0   3   582    0    0   1.745     58  0.33
  284  202 B   1   2   1   0   1   0   1   7   2   2   3   1   0   1  10   5   4   7  46   5   582    0    0   2.033     67  0.29
  285  203 B   4   1   0   0   8   0   3  54   2   0   3   1   0   1   3   2   1   2  10   5   582  376   78   1.786     59  0.29
  286  204 B   0   0   0   0   0   0   0  16   4   1   6   4   0   1   7  25   3   6  10  15   206    0    0   2.201     73  0.28
  287  205 B   2   0   0   0   0   0   0  29   0   0   7   1   0   1   2   3   6   5  12  31   208    0    0   1.877     62  0.42
  288  206 B   4   0   4   0   1   0   0   1   1   0   8  37   0   2  24  11   4   0   1   0   218    0    0   1.895     63  0.24
  289  207 B   1   2   0   0   7  43  29   1   0   0   2   2   0   3   1   4   0   0   3   0   227    0    0   1.760     58  0.49
  290  208 B  10   4   2   1  12   1   7   0   2   0   0   3   0   1   7   4  18  27   1   0   582    0    0   2.238     74  0.08
  291  209 B  15  66   6   0   1   0   0   0   1   0   0   0   0   0   0   0  12   0   0   0   582    0    0   1.064     35  0.59
  292  210 B  20   3   3   1   1   1   3   1   8   0   1  12   0   3   0   0  40   1   0   1   582    0    0   1.951     65  0.16
  293  211 B   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   582    0    0   0.000      0  1.00
  294  212 B  41   2  54   0   0   0   0   0   2   0   0   0   0   0   0   0   0   0   0   0   582    0    0   0.904     30  0.80
  295  213 B  89   0   5   0   0   0   0   0   0   0   0   6   0   0   0   0   0   0   0   0   582    0    0   0.455     15  0.86
  296  214 B   0   0   0   0   0   0   0   0   1   0  99   0   0   0   0   0   0   0   0   0   581    0    0   0.032      1  0.99
  297  215 B   0   0   0   0   6  91   1   0   0   0   0   1   0   0   0   0   0   0   0   0   582    0    0   0.408     13  0.92
  298  216 B   0   0   0   0   0   0   0  99   0   0   1   0   0   0   0   0   0   0   0   0   582    5   18   0.041      1  0.99
  299  217 B   9   1   7   1   2   0  35   1   3   0   2   1   0   3   3   3   3  18   3   4   577    0    0   2.201     73  0.09
  300  218 B   1   0   0   0   0   0   0  91   0   1   1   0   0   0   1   1   0   2   0   1   580    0    0   0.507     16  0.84
  301  220 B   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   582    0    0   0.076      2  0.98
  302  221 B   0   0   0   0   0   0   0  12  85   0   1   0   1   0   0   0   0   0   0   1   581    4    1   0.530     17  0.83
  303  222 B   2   9   1   2   1   1   0   1   2   0   1   1   1   0  31   3  27  14   2   1   578    0    0   1.986     66  0.25
  304  223 B   1   0   0   0   0   0   0   1   6  29   2   0   0   0  15  36   4   4   1   2   578    0    0   1.735     57  0.35
  305  223 B   0   0   0   0   1   0   2  40   0   0   0   0   0   0   3   4   1   1  35  11   582    0    0   1.553     51  0.42
  306  224 B   1   3   1   1   8   0  23   1   1   0   2   1   0   9   9  33   2   0   6   0   582    0    0   1.995     66  0.15
  307  225 B   0   0   0   0   3   0  14   0   0  82   0   0   0   0   0   0   0   0   0   0   582    1    0   0.585     19  0.50
  308  226 B   0   0   0   0   0   0   0  98   0   0   1   0   0   0   0   0   0   0   0   1   580    0    0   0.103      3  0.98
  309  227 B  86   0  12   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   581    0    0   0.506     16  0.89
  310  228 B   0   0   0   0   1   0  98   0   0   0   0   0   1   0   0   0   0   0   0   0   581    0    0   0.133      4  0.98
  311  229 B   2   0   2   0   0   0   0   2  25   0   4  64   0   0   0   0   0   0   0   0   581    0    0   1.051     35  0.59
  312  230 B   0   0   0   0   0   0   0   0   1   0   2   0   0   2  22  62   1   2   6   3   581    0    0   1.238     41  0.59
  313  231 B  91   3   3   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   581    0    0   0.418     13  0.91
  314  232 B   1   1   1   0   2   0   5   3   9   2  19  14  37   1   2   1   1   1   1   0   579    0    0   1.991     66  0.28
  315  233 B   3   3   5   2   0   0   6   1  15   0   4   2   0   3   8   5   2   3  37   1   579    0    0   2.214     73  0.19
  316  234 B   7   9   1   2  36   0  41   0   2   0   0   0   0   2   0   0   1   0   0   0   575    0    0   1.450     48  0.63
  317  235 B  24  23   7   1   0   0   1   0   1   0   4   6   0   2  16   3   1   0  10   0   573    0    0   2.095     69  0.19
  318  236 B   0   1   0   0   0   0   1   3   2   8  20   4   0   0   3  11   3   4   9  32   572    0    0   2.064     68  0.32
  319  237 B   0   0   0   0   1  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0   572    0    0   0.110      3  0.99
  320  238 B   4  11  84   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   569    0    0   0.593     19  0.88
  321  239 B   1   4   0   0   0   0   1   1   4   0   2   5   0   6  11  18  21  10   6  10   541    0    0   2.305     76  0.27
  322  240 B   0   0   0   0   0   0   0   1   2   0  21   7   0   0  11   8  11  14   9  15   528    0    0   2.164     72  0.28
  323  241 B   5   1   7   1   0   0   2   0   2   0   8  51   0   2   0   2   2   2  14   0   495    0    0   1.781     59  0.28
  324  242 B   7   6  39  43   1   0   0   0   1   0   0   2   0   0   1   0   0   0   0   0   452    0    0   1.316     43  0.60
  325  243 B   0   0   0   0   0   0   0   1  47   4  10   1   0   0   6  16   3   5   3   2   418    0    0   1.774     59  0.30
  326  244 B   0   0   0   0   0   0   0   1  33   0  25  12   0   0   0   3   2   6  13   4   369    0    0   1.828     61  0.34
  327  245 B   0   0   0   0   0   0   0   0   0   0   1   0   0   3  14   6   0   2  71   2   260    0    0   1.037     34  0.52
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
    42   113   252     1 sDe
    68   113   251     1 nDe
    69   113   251     1 nDe
    71    35   123     3 eFSKl
    73    35   164     4 eFSSVa
    76    35   123     3 dTTTv
    77   108   232     1 qAv
    79    35   123     3 dTTTv
    81    35   122     3 eTVKl
    82    35   123     2 eHDl
    83    35   122     3 eTVKl
    84    35   101     1 eFv
    84    55   122     1 qRd
    84    56   124     2 dGRk
    85    56   144     2 kKSv
    85    57   147     1 vQk
    86   223   243     1 gYl
    87    35   123     2 eYVl
    88    35   123     2 eRVl
    89    35   123     2 eRVl
    90    35   123     2 eRVl
    91    35   123     2 eRVl
    92    35   100     1 eFv
    92    55   121     2 kKSl
    92    56   124     1 lQk
    93    35    99     2 eRVl
    94    35   123     2 eRVl
    95    35   123     2 eHLl
    96   138    64     2 dVEv
    97    35   123     2 qYVl
    98    35   123     2 eKVl
    99    35   125     5 eLGKTDq
    99    54   149     1 gAd
   100    35   185     8 eLSSCDSLAl
   100    37   195     1 cLl
   100    51   210     7 sRKLCSLDn
   100    56   222     2 dQFc
   100    57   225     2 cREe
   100    58   228     2 eQNs
   101    35   123     2 eKVl
   102    36   123     1 rRt
   102    55   143     1 sKd
   102    56   145     1 dGl
   103    36   123     1 rRt
   103    55   143     1 sKd
   103    56   145     1 dGl
   104    36   123     1 rRt
   104    55   143     1 sKd
   104    56   145     1 dGl
   105    35   123     6 eTNTDDQl
   105    53   147     1 aGa
   106    35   123     2 eKVl
   107    35   123     2 eKVl
   108    35   123     6 eTAVDKNl
   108    53   147     1 qSe
   109    35   121     2 qYEl
   109    55   143     1 iSd
   109    56   145     1 dIn
   110    35   121     2 qYEl
   110    55   143     1 iSd
   110    56   145     1 dIn
   111    35   102     2 qYEl
   111    55   124     1 iSd
   111    56   126     1 dIn
   112    35   121     2 qYEl
   112    55   143     1 iSd
   112    56   145     1 dIn
   113    36   123     1 rRt
   113    55   143     1 sKd
   113    56   145     1 dGl
   114    35   123     2 eKVl
   115    35   123     6 eTAVAENl
   115    53   147     1 qSe
   116    17   104     1 aDs
   116    33   121     2 eKGl
   116    54   144     1 sGa
   117    17   105     1 aDs
   117    33   122     2 eKGl
   117    54   145     1 sGa
   118   173   139     2 nASf
   119   173   136     2 nATi
   120    35   123     2 eKVl
   121    35   123     2 eKVl
   122    35   149     6 eTNKNSLl
   122    52   172     1 hVe
   123    35   123     6 eTAVAENl
   123    53   147     1 qSe
   124    17   104     1 aDs
   124    33   121     2 eKGl
   124    54   144     1 sGa
   125    17   104     1 aDs
   125    33   121     2 eKGl
   125    54   144     1 sGa
   126    35    74     6 eTHKDDQl
   126    53    98     1 tGt
   127    17   103     1 gHs
   127    33   120     6 qEAFEDTl
   127    50   143     1 sAw
   128    17   103     1 gHs
   128    33   120     6 qEAFEDTl
   128    50   143     1 sAw
   129    35    74     6 eTHKDDQl
   129    53    98     1 tGt
   130    35   123     6 eTDKQSQl
   130    53   147     1 pGa
   131    35   143     6 eTHKDDQl
   131    53   167     1 tGt
   132    35   143     6 eTYKDDQl
   132    53   167     1 tGt
   133    35   143     6 eTYKDDQl
   133    53   167     1 tGt
   134   173   129     2 nATi
   135   173   129     2 nASi
   136    35   144     6 eTYKDDQl
   136    53   168     1 tGa
   137    35    46     6 eKNKNDQl
   137    53    70     1 vGs
   138    35   143     6 eTYKDDQl
   138    53   167     1 tGa
   139    35   143     6 eTYKDDQl
   139    53   167     1 tGt
   140    35   123     6 eTNKNSLl
   140    52   146     1 hVe
   141    35    97     6 eTNKSQQl
   141    52   120     1 rGd
   142    35   121     6 eMYKDDQl
   142    53   145     1 mGa
   143    35   121     6 eMYKDDQl
   143    53   145     1 tGa
   144    17   105     1 aDs
   144    33   122     2 eKGl
   144    54   145     1 sGv
   145    35   149     6 eKNKDDQl
   145    53   173     1 aGa
   146    35   121     6 eKNKDDQl
   146    53   145     1 aGa
   147    35   121     6 eTNKNDQl
   147    52   144     1 hMe
   148    35   123     6 eKNKSSQl
   148    52   146     1 kPd
   149    35   121     6 eTNKKSQl
   149    52   144     1 hAe
   150    35    73     6 eTNKDDQl
   150    53    97     1 aGt
   151    35   150     6 eTNKDDQl
   151    53   174     1 aGt
   152    35   143     6 eTNKDDQl
   152    53   167     1 aGt
   153    35   121     6 eTNKDDQl
   153    53   145     1 aGt
   154    35   118     6 eKNKDDQl
   154    53   142     1 aGa
   155    35   122     6 eKNKNDQl
   155    53   146     1 vGs
   156    35   100     3 eIGRf
   156    56   124     1 gTs
   157   117    57     1 yTc
   157   137    78     2 rKPa
   157   208   151     1 sRt
   158   138    69     2 rKPa
   158   209   142     1 sRt
   159    35   132     6 eFDLNIAl
   159    53   156     1 eLs
   160    35   121     6 eTNKKSQl
   160    52   144     1 hAe
   162    34   130     2 kIEv
   162    55   153     2 eNSt
   163    35   127     3 eISKl
   164    35   115     5 eTNKKDl
   164    53   138     1 hAe
   165    35   141     5 eTNLRDm
   165    54   165     1 sSt
   166    35   124     6 eKSKNEQl
   166    53   148     1 vGt
   167    35   123     6 eIGPETKl
   167    53   147     1 pTt
   168    35   151     5 eTNKKDl
   168    53   174     1 hAe
   170    14    80     1 sAq
   170    33   100     5 eLDSTTv
   170    53   125     2 eGGr
   171    34   121     5 eLDSTTv
   171    53   145     1 dEg
   171    54   147     1 gGr
   172    35   123     6 eISKASQl
   172    52   146     1 nSe
   173    35   123     6 eISKASQl
   173    52   146     1 nSe
   174    35   151     6 eTNKKDQl
   174    52   174     1 hAe
   175    35   145     5 eTNLRDm
   175    54   169     1 sSt
   176    35   124     6 eKSKNEQl
   176    53   148     1 vGt
   177    35   123     6 eTNKKDQl
   177    52   146     1 hAe
   178     6    92     2 pFNp
   178    35   123     6 eTNKNSQl
   178    52   146     1 nAe
   179    35   128     6 qINKSAQl
   179    53   152     1 vGd
   180    35   136     6 eTNKDDQl
   180    53   160     1 vGt
   181    35   127     6 eTNKKDLl
   181    52   150     1 rAe
   182    35   123     6 eTDKKDQl
   182    52   146     1 hAe
   183    35   123     6 eTDKDSLl
   183    52   146     1 nPe
   185    35   124     6 eKNKNEQl
   185    53   148     1 vGt
   186    33   143     2 eHEv
   186    53   165     1 dLk
   186    54   167     1 kNq
   187    35   123     6 eTNRSALl
   187    53   147     1 kGd
   188    17   108     1 gNt
   188    33   125     3 eTNKm
   188    53   148     1 rGn
   189    35   125     3 eFEQq
   189    57   150     2 aFGr
   190    17   104     1 gNt
   190    33   121     5 eTKAEDf
   190    51   144     1 sGa
   191    14    17     1 hYh
   191    50    54     7 sNPCLNGGt
   192    35   123     6 eTNKNDQl
   192    52   146     1 hVe
   194    34    54     3 qYEVs
   194    53    76     1 dPd
   194    54    78     1 dLn
   195    34    43     3 qYEVs
   195    53    65     1 dPd
   195    54    67     1 dLn
   196    33   143     2 gHEv
   196    53   165     1 dLq
   196    54   167     1 qNq
   198    33   127     3 qNEVm
   198    52   149     2 vQGs
   198    53   152     2 sNGk
   199    35   125     4 eNDQTl
   199    52   146     1 gYt
   199    71   166     1 dKc
   200    35   125     4 eNDQTl
   200    52   146     1 gYt
   200    71   166     1 dKc
   201    34   121     1 dQp
   201    55   143     1 gDd
   201    56   145     1 dGl
   202    14   101     1 iPd
   202    33   121     3 dQEHk
   202    55   146     2 aFGr
   203    35   131     3 dKVRl
   203    55   154     1 fPd
   204    14    99     1 sAe
   204    33   119     5 eLEYRSv
   204    52   143     1 dAa
   204    53   145     1 aGr
   205   108    29     1 qQv
   205   139    61     1 gPv
   205   249   172     5 rASTEQv
   206   137    86     2 gTSa
   207   137    86     2 gTSa
   208    14   105     1 sAe
   208    33   125     5 eLEYRSv
   208    52   149     1 dAa
   208    53   151     1 aGr
   209    35   125     5 eTNLRDm
   209    54   149     1 sSt
   210    34   130     3 gYEVv
   210    53   152     1 pMn
   210    54   154     1 nSt
   211    35   131     3 dKVRl
   211    55   154     1 fPd
   212    15   101     1 tTq
   212    35   122     6 eQSIGDVl
   213   114    25     8 yPPWDKNFTa
   213   133    52     1 tRe
   213   149    69     1 nWk
   213   199   120     5 gNLFETw
   213   243   169     3 pEDSk
   213   261   190     2 nPQd
   214   138    65     3 kIKNw
   214   249   179     5 lQQSRKv
   215    35   129     4 qTDKSq
   215    52   150     1 sTa
   216   139    73     2 rKQa
   216   174   110     1 hKp
   217    94    11     1 fHc
   217   114    32     2 kLRr
   217   130    50     1 tSe
   217   221   142     2 rNQk
   218    34   123     2 sQEv
   218    55   146     2 eEAa
   218    56   149     2 aAGg
   218    57   152     2 gRRg
   219    94    11     1 fHc
   219   114    32     2 kLRr
   219   130    50     1 tSe
   219   221   142     2 rNQk
   220    35   133     4 eTDQTv
   220    52   154     1 gYq
   220    71   174     1 vKc
   221    97     5     1 fFc
   221   117    26     4 eAKVGk
   221   168    81     1 pEv
   221   228   142     3 rLAHp
   222    97     5     1 fFc
   222   117    26     4 ePGVRk
   222   133    46     2 gAFe
   222   168    83     1 pEv
   222   228   144     3 rRAHp
   223   138    46     1 gSa
   223   241   150     2 nSAy
   224    34   121     2 nYEv
   224    54   143     1 dPa
   224    55   145     1 aKq
   225    15   101     1 tTq
   225    35   122     5 eQSIGDv
   226    35   126     4 qTDKSq
   226    52   147     1 sTa
   227    18   107     1 sYg
   227    34   124     8 qHESSKCHPl
   228    34   121     2 nYEv
   228    54   143     1 dPa
   228    55   145     1 aKq
   229   117    50     1 hQc
   229   190   124     1 rSs
   229   217   152     1 tVn
   231   138    76     1 gSa
   231   188   127     2 sGSs
   231   214   155     1 tTs
   231   238   180     2 nSAy
   232   138    76     1 gSa
   232   188   127     2 sGSs
   232   214   155     1 tTs
   232   238   180     2 nSAy
   233   138    76     1 gSa
   233   188   127     2 sGSs
   233   214   155     1 tTs
   233   238   180     2 nSAy
   234   138    76     1 gSa
   234   188   127     2 sGSs
   234   214   155     1 tTs
   234   238   180     2 nSAy
   235   138    76     1 gSa
   235   188   127     2 sGSs
   235   214   155     1 tTs
   235   238   180     2 nSAy
   236   138    76     1 gSa
   236   188   127     2 sGSs
   236   214   155     1 tTs
   236   238   180     2 nSAy
   237   138    76     1 gSa
   237   188   127     2 sGSs
   237   214   155     1 tTs
   237   238   180     2 nSAy
   238   138    76     1 gSa
   238   188   127     2 sGGs
   238   214   155     1 tTs
   238   238   180     2 nSAy
   239   138    76     1 gSa
   239   188   127     2 sGSs
   239   214   155     1 tTs
   239   238   180     2 nSAy
   240   138    76     1 gSa
   240   188   127     2 sGSs
   240   214   155     1 tTs
   240   238   180     2 nSAy
   241   138    76     1 gSa
   241   188   127     2 sGSs
   241   214   155     1 tTs
   241   238   180     2 nSAy
   242    34   133     2 qNEv
   242    54   155     1 eGd
   243    34   121     2 eYNv
   243    54   143     1 gEd
   243    55   145     1 dGq
   244    34   121     2 eYNv
   244    54   143     1 gEd
   244    55   145     1 dGq
   245    14   100     1 sAe
   245    33   120     5 eLEYQTv
   245    52   144     1 nSa
   245    53   146     1 aGr
   246    14    82     1 sAe
   246    33   102     5 eLEYQTv
   246    52   126     1 nSa
   246    53   128     1 aGr
   247    14   101     1 sAe
   247    33   121     5 eLEYQTv
   247    52   145     1 nSa
   247    53   147     1 aGr
   248    35   120     4 eKDETl
   248    52   141     1 gYt
   248    71   161     1 tKc
   249    35   120     4 eKDETl
   249    52   141     1 gYt
   249    71   161     1 tKc
   250    17   104     1 gNa
   250    33   121     5 eTKVEDf
   250    51   144     1 sRe
   251    35   131     3 dKVRl
   251    55   154     1 fPd
   252    35   119     4 eKDETl
   252    52   140     1 gYi
   253    46   110     7 nENGGCEQy
   253    52   123     1 tGa
   254    17   102     1 gNa
   254    33   119     5 eTKVEDf
   254    51   142     1 sRe
   255    15   101     1 tTq
   255    35   122     5 eQSIGDv
   257    14   101     1 sAe
   257    33   121     5 eLEYQTv
   257    52   145     1 nSa
   257    53   147     1 aGq
   258    34   121     2 nYEv
   258    54   143     1 dPa
   258    55   145     1 aKq
   259    15   101     1 tTq
   259    35   122     5 eQSIGDv
   259    54   146     1 qNg
   263   103    13     1 fFc
   263   123    34     4 eGEVTk
   263   139    54     2 gIFe
   263   234   151     1 rRa
   264   115    37     1 lLc
   264   135    58     7 yNGQDYTNp
   264   170   100     1 nQw
   266   117    59     1 fHc
   266   137    80     2 rLKr
   266   153    98     1 tTd
   266   245   191     2 rTMk
   266   279   227     1 tGg
   268   108    25     3 mARLs
   268   114    34     1 fYc
   268   134    55     2 gFMw
   268   240   163     2 rNTs
   268   276   201     1 rEd
   269   117    48     1 hQc
   269   217   149     1 tVs
   270   117    30     1 hQc
   270   190   104     1 rSs
   270   215   130     1 gNt
   271   218   151     1 tKs
   273   138    76     1 gSa
   273   188   127     2 sGSs
   273   214   155     1 tTs
   273   238   180     2 nSAy
   274   117    55     1 lIc
   274   137    76     1 gSa
   274   187   127     2 sGSs
   274   213   155     1 tTt
   274   237   180     2 nSAy
   275   138    76     1 gSa
   275   188   127     2 sGSs
   275   214   155     1 tTs
   275   238   180     2 nSAy
   276   138    76     1 gSa
   276   188   127     2 sGSs
   276   214   155     1 tTs
   276   238   180     2 nSAy
   277   138    76     1 gSa
   277   188   127     2 sGSs
   277   214   155     1 tTs
   277   238   180     2 nSAy
   278   138    76     1 gSa
   278   188   127     2 sGSs
   278   214   155     1 tTs
   278   238   180     2 nSAy
   279   138    76     1 gSa
   279   188   127     2 sGSs
   279   214   155     1 tTs
   279   238   180     2 nSAy
   280   138    76     1 gSa
   280   188   127     2 sGSs
   280   214   155     1 tTs
   280   238   180     2 nSAy
   281   216   156     2 gNIr
   281   218   160     1 sSd
   282    35   129     5 dKEYQTv
   282    54   153     1 nSa
   282    55   155     1 aGr
   283    34   121     2 dQPl
   283    54   143     1 gAd
   283    55   145     1 dGl
   284    34   118     2 dQPl
   284    54   140     1 gAd
   284    56   143     1 gLt
   285   214   137     3 gSLRp
   286   214   143     1 gSl
   287   214   150     1 gSl
   288    35   120     7 eKASPDETl
   288    52   144     1 gYt
   288    71   164     1 tKc
   289    35   120     7 eKASPDETl
   289    52   144     1 gYt
   289    71   164     1 tKc
   290    35   120     7 eKASPDETl
   290    52   144     1 gYt
   290    71   164     1 tKc
   291    35   120     7 eKASPDETl
   291    52   144     1 gYt
   291    71   164     1 tKc
   292    35   120     7 eKASPDETl
   292    52   144     1 gYt
   292    71   164     1 tKc
   293    35   120     7 eKASPDETl
   293    52   144     1 gYt
   293    71   164     1 tKc
   295   117    44     1 fHc
   295   137    65     2 kLRr
   295   153    83     1 tSe
   295   244   175     2 rNQk
   296   215   147     1 gNt
   297    34   124     7 aMAKNECHl
   298    34    54     7 aMAKNECHl
   299   117    25     8 yPPWDKNFTv
   299   136    52     1 nMe
   299   152    69     1 nWr
   299   202   120     6 gNLKEMWt
   299   246   170     3 pEEGk
   299   264   191     2 nPYn
   300   113    21     1 rKs
   300   139    48     8 yPPWDKNFTe
   300   158    75     1 nIe
   300   174    92     1 nWr
   300   224   143     6 gNLKETWt
   300   268   193     3 pDEGk
   300   286   214     2 sPFn
   301   119    63     1 lLc
   301   139    84     8 yPPWDKNFTe
   301   158   111     1 nIe
   301   174   128     1 nWr
   301   224   179     5 gNLKETw
   301   226   186     1 tAn
   301   268   229     3 pDEGk
   301   286   250     2 sPFn
   302   138    76     2 qAIv
   302   243   183     2 nDAy
   303    34   124     7 aMAKNECHl
   304   117    48     1 hQc
   304   215   147     1 gNt
   305   117    48     1 hQc
   305   217   149     1 tVs
   306   108    17     3 qVALi
   306   113    25     1 gHd
   306   139    52     3 iTKDk
   306   221   137     1 gAl
   306   247   164     2 sHQq
   306   283   202     3 nPENp
   307   115    32     3 gTMMp
   307   200   120     1 gKr
   307   226   147     1 rKa
   307   244   166     1 nSs
   307   262   185     8 nPLPATPKGq
   308   137    73     2 gLSa
   308   189   127     1 gSa
   308   215   154     1 tTs
   308   257   197     1 nVg
   309   217   149     1 tSg
   310   137    81     2 gLSa
   310   189   135     1 eQt
   310   242   189     1 nTn
   311   117    45     1 fHc
   311   137    66     2 rLKr
   311   153    84     1 aTe
   311   244   176     2 rNMk
   312   108    17     1 qVa
   312   116    26     1 fFc
   312   136    47     4 sSSSQa
   312   242   157     2 nRPq
   312   278   195     4 tPNGKp
   319   108    59     1 qVa
   319   218   170     5 gKLNKRh
   319   240   197     1 rDv
   319   276   234     1 dRh
   320   173   104     2 nINn
   321   240   169     2 nGAn
   322   218   152     1 gSt
   322   244   179     2 nSPr
   323   108    16     1 qVs
   323   137    46     2 nKSk
   323   276   187     3 kKDNq
   324   138    74     2 qLTa
   325   117    53     1 fTc
   325   137    74     2 wTEf
   325   214   153     2 gLLr
   325   238   179     1 nKl
   328   117    26     1 fHc
   328   137    47     2 rLKr
   328   156    68     1 gVp
   328   244   157     2 rKMk
   329   108    17     1 mAg
   329   137    47     2 gLDm
   329   153    65     1 vKe
   329   244   157     2 qKTk
   329   280   195     1 gKd
   330   137    74     2 gQTa
   330   189   128     1 dQk
   330   216   156     2 gYLk
   330   241   183     3 nKLYe
   330   259   204     1 aDg
   332   117    35     1 fHc
   332   137    56     2 nLKr
   332   156    77     1 gTp
   332   244   166     2 rKMk
   333   215   147     1 gNt
   334   218   150     2 gNMr
   335   107    18     1 qVs
   335   214   126     1 gNt
   336   215   145     1 gNt
   337   217   162     1 tLs
   339   215   147     1 gNt
   340    35   125     8 eNVLYHADQt
   340    53   151     1 gYt
   340    72   171     1 dKc
   341    35   125     8 eNGEEHADQt
   341    53   151     1 gYt
   341    72   171     1 dKc
   342   215   147     1 gNt
   343   216   147     1 tVs
   344   138    76     1 gSa
   344   188   127     2 sGSs
   344   214   155     1 tTs
   344   238   180     2 nSAy
   345   138    76     1 gSa
   345   189   128     1 gGs
   345   215   155     1 tTs
   345   239   180     2 nSAy
   348    34   126     8 eSGKQTNTSv
   348    53   153     1 pGg
   349    34   119     5 dQRKSTl
   349    54   144     1 gAd
   349    55   146     1 dGl
   350   214   143     6 gSLRPSDe
   350   216   151     5 gCEETHs
   351    34   108     1 dQp
   351    55   130     1 sSd
   351    56   132     1 dGl
   352    34   119     1 dQp
   352    55   141     1 sSd
   352    56   143     1 dGl
   353    34   125     1 dQp
   353    55   147     1 sSd
   353    56   149     1 dGl
   354    34   120     1 dQp
   354    55   142     1 sSd
   354    56   144     1 dGl
   355   216   139     3 gSLRp
   357   217   148     1 tLs
   358   117    47     1 fYc
   358   137    68     2 gFMw
   358   154    87     1 tVr
   358   218   152     1 tLs
   358   242   177     2 rKTk
   358   260   197     1 kTg
   358   278   216     2 rKHd
   359   138    86     2 nYPa
   359   170   120     2 rTGf
   359   175   127     1 pEn
   359   206   159     1 pEg
   359   216   170     2 gNLq
   359   240   196     2 sKAy
   360   138    79     1 ySp
   360   170   112     2 eKTk
   360   175   119     1 pIn
   360   218   163     1 tTi
   360   242   188     3 nKAYe
   361   244   163     1 eKa
   362   241   178     1 aRr
   363   217   158     1 tLs
   364    34   122     2 eYEi
   364    54   144     1 pDe
   364    55   146     1 eEq
   365   217   148     1 tLs
   366    34   134     2 qYNv
   366    54   156     1 sDg
   366    55   158     1 gGa
   367    20   110     3 gFLLq
   367    27   120     7 tGSAFYTVl
   367    47   147     1 gNf
   368   139    75     2 gETp
   368   171   109     1 sKe
   368   189   128     2 pASd
   368   216   157     1 tTk
   368   240   182     1 qRa
   369   117    34     1 fYc
   369   137    55     2 gFMw
   369   153    73     1 dAv
   369   243   164     3 sSETn
   369   261   185     1 gVg
   369   279   204     1 rPd
   370   117    34     1 fHc
   370   137    55     2 rLKr
   370   156    76     1 tEa
   370   244   165     2 rSMk
   371   117    55     1 fTc
   371   137    76     2 rLSp
   371   153    94     1 pTt
   371   173   115     2 tNNn
   371   188   132     1 sEd
   371   240   185     2 rRAg
   371   276   223     2 nNEt
   372   217   148     1 tSs
   373   216   139     3 gSLRp
   374   108    16     4 qLSFQe
   374   138    50     5 gDDYENp
   374   244   161     1 rAd
   375   108    44     1 lVa
   375   137    74     2 eQNh
   375   240   179     2 dLSl
   377   117    48     1 hQc
   377   214   146     1 gNt
   380   117    25     8 yPPWNKNFTa
   380   136    52     1 qTe
   380   152    69     1 nWk
   380   202   120     5 gNLYETw
   380   246   169     3 pEDSi
   380   264   190     2 nPEd
   382   138    69     3 dYFSp
   382   190   124     1 nGr
   382   243   178     3 sDSYv
   383   138    49     4 kYENDi
   383   170    85     1 nDr
   383   190   106     1 tAc
   383   243   160     6 nKNYTIPg
   384   168    96     1 gDs
   384   259   188     1 gIg
   385   108    29     2 qISl
   385   113    36     1 yHe
   385   139    63     3 gKGGr
   385   245   172     2 nQKt
   386   108    27     1 qVa
   386   138    58     3 rKGRr
   386   220   143     1 gKm
   386   282   206     4 iEHNGr
   389   215   142     1 gNt
   390   137    72     2 gQSa
   390   189   126     1 dQt
   390   216   154     3 gYLQe
   390   240   181     3 dQLYs
   390   258   202     1 aNg
   391   108    42     2 qVSv
   391   136    72     1 gAt
   391   241   178     2 qANy
   393   215   146     1 gNm
   394   173   101     2 nINn
   395   139    64     2 gETa
   395   174   101     1 hRp
   396   139    59     2 sKRp
   396   155    77     1 sLt
   396   174    97     1 nSr
   396   221   145     1 tLs
   396   245   170     2 eQAy
   397   139    47     2 nKLp
   397   174    84     1 sSp
   398   139    53     2 kKTp
   398   158    74     1 sTv
   398   174    91     1 sKp
   399   108    50     2 qAYl
   399   118    62     1 fQc
   399   190   135     1 dGk
   399   217   163     2 gATs
   400   137    74     2 gQTa
   400   189   128     1 nQk
   400   216   156     3 gYLEe
   400   240   183     3 nELYs
   400   258   204     1 aNg
   401   108    50     2 qAYl
   401   118    62     1 fQc
   401   190   135     1 dGk
   401   217   163     2 gATs
   402   137    72     2 gQSa
   402   189   126     1 dQt
   402   216   154     3 gYLQe
   402   240   181     3 dQLYs
   402   258   202     1 aNg
   403   137    84     1 dNd
   403   216   164     3 gYTQn
   403   239   190     1 rEs
   404    34   132     7 aMAKNECHl
   406   108    19     7 qVTLLIRRt
   406   113    31     1 gKv
   406   139    58     3 dKYPa
   406   247   169     2 nSLr
   406   283   207     2 vKNs
   409   137    72     2 gQSa
   409   189   126     1 dQt
   409   216   154     3 gYLQe
   409   240   181     3 dQLYs
   409   258   202     1 aNg
   410   137    72     2 gQSa
   410   189   126     1 dQt
   410   216   154     3 gYLQe
   410   240   181     3 dQLYs
   410   258   202     1 aNg
   411   215   145     1 gNt
   412   173   100     2 nINn
   413   124    33     8 nPVTSDPILk
   413   270   187     2 qRTe
   414   108    20     1 qVa
   414   138    51     2 qYPn
   414   173    88     2 tEEv
   414   178    95     1 nDy
   414   189   107     4 kNGRCa
   414   264   186     1 qTg
   415   191   119     2 nLNs
   415   218   148     1 tLs
   415   242   173     2 nAAs
   416   108    16     1 qAm
   416   113    22     1 iRp
   416   119    29     1 yFc
   416   139    50     4 eLGVTe
   416   155    70     2 gVLe
   416   190   107     1 pEv
   416   224   142     1 gAq
   416   250   169     3 rDSHp
   417   173   100     2 nINn
   418   215   146     1 gNt
   419   215   146     1 gNt
   420   173   100     2 nINn
   421   138    73     3 dLFSp
   421   190   128     1 nGk
   421   243   182     3 sDSYv
   423   217   149     1 tSs
   425   138    76     2 gVGi
   425   216   156     2 tNIy
   425   240   182     3 aSSSy
   426    34    54     7 aMAKNECHl
   427   217   147     1 tSs
   428   108    49     2 qAYl
   428   118    61     1 yQc
   428   138    82     1 dNi
   428   190   135     1 dGv
   428   218   164     2 gATs
   429   137    72     2 gQSa
   429   189   126     1 dQt
   429   216   154     3 gYLQe
   429   240   181     3 dQLYs
   429   258   202     1 aNg
   430   137    74     2 gQTa
   430   189   128     1 nQk
   430   216   156     3 gYLEe
   430   240   183     3 nELYs
   430   258   204     1 aNg
   431   138    65     2 gMNl
   431   244   173     2 qKIf
   432    96     7     1 mVa
   432   101    13     1 sHq
   432   127    40     2 dKRt
   432   143    58     1 pSl
   432   177    93     4 kADMRd
   432   181   101     2 gNSg
   432   233   155     4 eQVFHi
   432   269   195     1 mEs
   432   282   209     2 gIDg
   433    35   128     6 eTDQTVCl
   433    50   149     1 gYh
   434   215   146     1 gNt
   441   138    76     5 lEHNTMl
   441   217   160     2 gATq
   442   215   148     1 gNt
   443   108    38     2 qVSi
   443   136    68     1 rIk
   443   187   120     2 hFGk
   443   213   148     3 gQTAe
   443   274   212     2 sKAg
   444   191   124     1 dNh
   444   218   152     1 tLs
   445   138    47     3 kHLDv
   445   216   128     1 gFt
   445   242   155     2 nAEd
   446   215   146     1 gNt
   447   173    91     2 nIDn
   447   215   135     1 tQs
   448   117    46     1 fHc
   448   137    67     2 rLKr
   448   153    85     1 aSe
   448   244   177     2 rSMk
   449   217   148     1 tLs
   450   108    16     1 qVs
   450   137    46     3 nKNIr
   450   215   127     2 gITr
   450   276   190     3 kKDNq
   451   217   148     1 tLs
   452   215   146     1 gNt
   455   217   139     4 gYTAId
   456   215   123     1 gNi
   457   217   146     5 gNIYTDq
   458   108    39     2 qASi
   458   220   153     2 vTWl
   459   217   148     1 tLs
   460   217   148     1 tLs
   461   215   147     1 gNt
   462    34   128     7 aMAKNECHl
   463   138    76     1 gSa
   463   188   127     2 aGGs
   463   214   155     1 tTs
   463   238   180     2 nSAy
   464   138    70     2 gLNk
   464   206   140     1 dDg
   464   216   151     2 gNLr
   464   240   177     2 sNAy
   465   138    76     1 gSa
   465   188   127     2 aGGs
   465   214   155     1 tTs
   465   238   180     2 nSAy
   466   138    76     1 gSa
   466   188   127     2 aGGs
   466   214   155     1 tTs
   466   238   180     2 nSAy
   467   138    76     1 gSa
   467   188   127     2 aGGs
   467   214   155     1 tTs
   467   238   180     2 nSAy
   469   215   146     1 gNt
   470   217   148     1 tLs
   471   137    51     3 sLENp
   471   153    70     1 iNe
   471   218   136     1 gYr
   471   243   162     1 qAr
   472    35   124     6 aFAKNECh
   472    50   145     1 gSd
   473   217   151     1 tLs
   474   139    49     3 yNADv
   474   281   194     1 eEs
   475    35    66     4 qEDLTl
   475    52    87     1 gYv
   475    71   107     1 nTc
   477   215   145     1 gNt
   478   217   148     1 tLs
   480   214   144     6 gSLRPSDe
   480   216   152     6 gCEETHSs
   481    35    53     4 eKDETl
   481    52    74     1 gYt
   481    71    94     1 tKc
   482    35   122     4 eKDETl
   482    52   143     1 gYt
   482    71   163     1 tKc
   483   117    42     1 fHc
   483   137    63     2 rLKr
   483   153    81     1 nTd
   483   244   173     2 rKMk
   485   138    53     7 ePLNNPKIw
   485   242   164     2 nSKq
   486   215   147     1 gNt
   487    34   122     3 qYEAn
   487    53   144     1 dPt
   487    54   146     2 tLSq
   488    35   124     6 nFAKNECq
   488    50   145     1 gSe
   489   138    71     2 sYPa
   489   170   105     2 kTNi
   489   175   112     1 pVn
   489   206   144     1 pEg
   489   216   155     2 gDLe
   489   240   181     2 nKAy
   490   138    83     2 sYPa
   490   170   117     2 kTNi
   490   175   124     1 pEn
   490   206   156     1 tEg
   490   216   167     2 gATr
   490   240   193     2 sKAy
   491   108    16     1 qIh
   491   137    46     2 sKNa
   491   216   127     5 gTTVPQr
   491   272   188     3 kKTRk
   492   217   149     1 tLs
   493   217   148     1 tLs
   494   217   145     1 tLs
   495   217   147     1 tLt
   496   137    84     1 dNd
   496   216   164     3 gYTQn
   496   239   190     1 rEs
   500   117    34     1 fHc
   500   137    55     2 rLKr
   500   153    73     1 aSe
   500   244   165     2 rSMk
   502   138    47     1 gSa
   502   189    99     1 gGs
   502   215   126     1 tTs
   502   239   151     2 nSAy
   503   217   148     1 tLs
   504   217   148     1 tLs
   505   217   147     1 tLs
   508    35   119     4 eKDETl
   508    52   140     1 gYt
   508    71   160     1 tKc
   509    34   431     4 dQRKSa
   509    55   456     1 sSd
   509    57   459     1 gLa
   510   217   148     1 tLs
   511   215   146     1 gNt
   512   218   149     1 tLs
   513   218   148     5 gNLRSDh
   514   218   148     2 gNMr
   515   217   148     1 tLs
   516   219   135     2 tASs
   517   218   148     2 gNMr
   518   217   148     1 tLs
   519    96     4     1 lIc
   519   116    25     8 yPPWDKNYTt
   519   135    52     1 qQe
   519   151    69     1 nWr
   519   201   120     5 gNLHETw
   519   245   169     3 pDEPn
   519   263   190     2 sPDd
   520    96     4     1 lLc
   520   116    25     8 yPPWNKNFTi
   520   135    52     1 gTe
   520   151    69     1 nWk
   520   201   120     5 gNLYETw
   520   245   169     3 pEEQk
   520   263   190     2 sPDd
   523   217   149     1 tLs
   524   216   149     1 tLs
   525   219   149     2 tNLg
   526   217   146     5 gNIYTDq
   528   173   101     2 nINn
   529   138    74     4 wLKKPl
   529   170   110     1 nKr
   529   190   131     1 tVc
   529   217   159     2 gATk
   529   241   185     5 aKGYPPs
   530   138    81     5 rDVIGSp
   530   188   136     2 sAGg
   530   215   165     2 gATr
   530   239   191     1 qAs
   531   215   146     1 gNt
   532   217   148     1 tLs
   533   215   147     1 gNt
   534   216   148     1 vLk
   535   216   148     1 vLk
   536   108    16     5 qLSFQEt
   536   137    50     5 gDDYENp
   536   243   161     1 rDd
   537   215   131     1 gNt
   538   217   148     1 tAs
   539    96    11     1 qAy
   539   107    23     1 fQc
   539   179    96     1 dGk
   540    35   129     7 dKEISPRSs
   540    53   154     1 tSe
   540    54   156     1 eTt
   541   137    74     2 gQDa
   541   205   144     1 yDg
   541   241   181     2 nKAy
   542   217   148     1 tLs
   543   117    48     1 yIc
   543   137    69     2 rPFd
   543   169   103     2 vSSt
   544   108    39     3 qAGLl
   544   114    48     1 fIc
   544   134    69     2 nPFd
   544   166   103     2 lSAa
   545    43    85     7 dGACQNGGt
   546   139    53     2 qTSa
   546   174    90     1 gKp
   547   215   146     1 gNt
   548   217   141     1 tLs
   549   138    55     5 hMSSWDv
   549   157    79     1 tRh
   549   245   168     4 kAKYGn
   550   138    76     2 sISa
   550   215   155     2 gTTk
   550   239   181     3 aSKEy
   551   138    76     3 tLSGv
   551   175   116     1 qDy
   551   216   158     1 tTs
   552   108    49     6 qVSVRRRn
   552   117    64     1 hSc
   552   137    85     2 nRQe
   552   191   141     2 dSQr
   552   242   194     1 qTa
   553   108    26     4 qVMFWt
   553   135    57     4 rNDIRv
   553   206   132     1 rDf
   553   210   137     1 gEv
   553   222   150     1 lTe
   553   264   193     1 qEi
   554   217   146     1 gNi
   555   138    67     3 dFPNa
   555   154    86     1 wFs
   555   157    90     1 sGe
   555   173   107     1 nKg
   555   220   155     2 gYTr
   555   245   182     1 sNq
   556     6     7     2 gIHg
   556    16    19     1 pGt
   556    25    29     2 gFVl
   556    51    57     1 tNg
   557   108    40     1 qVs
   557   238   171     1 kKs
   558   217   149     1 mSa
   559   215   134     1 gNt
   560   215   137     1 gNt
   561   117    57     1 lVc
   561   214   155     3 gLINe
   561   238   182     1 qKi
   562   173    81     2 nINn
   563   173    81     2 nINn
   564   108    44     2 qAAl
   564   136    74     3 lFGTe
   564   214   155     1 tLs
   564   238   180     2 fKAy
   565   138    71     8 sVENYKKYPa
   565   170   111     1 rEe
   565   175   117     1 dEf
   565   217   160     2 eQIm
   566   113    22     1 lQk
   566   119    29     1 fQc
   567   221   151     2 gVTr
   568   137    45     2 gVTa
   569   217   148     1 tQs
   570   108    21     1 qVs
   570   137    51     2 nKSe
   570   188   104     2 kLGa
   570   214   132     2 gINr
   570   275   195     3 kKDNq
   571   133    42     7 kASDPKEWs
   571   208   124     1 tLk
   571   232   149     2 nSEe
   571   268   187     1 dYk
   572    35   129     7 dKEISPRSs
   572    53   154     1 tSe
   572    54   156     1 eTt
   574   117    44     1 lTc
   574   137    65     3 gEKTl
   574   243   174     2 rKVy
   574   287   220     1 gAq
   575   217   155     1 tLs
   576   218   150     5 gNVLGYn
   576   285   222     1 gGr
   577   217   149     1 tLs
   578   217   148     1 tLs
   580   217   156     1 tLs
   581   173   104     2 nIDn
   581   215   148     1 tQs
   582   190   120     2 eETa
   582   215   147     4 gNSAPd
   583   217   141     1 tLs
   584   138    58     3 kARDp
   584   217   140     1 tLk
   584   241   165     2 nSEe
   584   277   203     1 dYk
   585   215   146     3 gNTQs
   586   214   144     1 gNt
   587   138    47     3 eYVHg
   587   157    69     1 sLi
   587   193   106     2 nETd
   587   220   135     6 gATYEKGk
   587   240   161     2 nGRy
   588   217   148     1 tLs
   589   215   146     1 gNt
   590   217   148     1 tAs
   591   217   151     1 tLs
   592   217   151     1 tLs
   594   138    49     4 gSKKEl
   594   169    84     2 nSVr
   594   214   131     1 gYr
   594   239   157     2 sNPs
   595    17   105     1 eTt
   595    33   122     5 qTEVEDf
   595    51   145     1 sGe
   596   217   149     1 tLs
   599   173    90     2 sATt
   599   178    97     3 gTISn
   599   245   167     7 nKNLQEVLh
   600   217   149     1 tLs
   602   117    35     1 fLc
   602   219   138     1 gKk
   602   274   194     1 gNa
   603   217   149     1 tLs
   604   217   147     1 tSt
   605   217   148     1 tLs
   606   215   143     1 gNt
   607     6  1758     2 lPSl
   607    27  1781     4 gYSADl
   607    34  1792     1 lDl
   609   217   150     1 vQs
   610   217   147     3 gNTAk
   611   138    76     5 tSLIGSv
   611   170   113     2 iDDd
   611   188   133     2 sAGg
   611   215   162     2 gATr
   611   239   188     1 qSq
   612   217   148     2 gETq
   613   217   148     2 gETq
   614   217   146     1 tLs
   615   108    16     1 iVm
   615   116    25     1 fYc
   615   136    46     7 sFTPQQLLa
   615   180    97     2 eAGg
   615   231   150     2 rKSs
   616   117    34     1 fTc
   616   137    55     2 rSSa
   616   242   162     2 kRSg
   616   278   200     2 nPSt
   617   217   154     1 tLs
   618   217   148     1 tLs
   619   117    35     1 fLc
   619   219   138     1 gKk
   619   278   198     1 gNa
   620   108    18     1 iAa
   620   115    26     1 fLc
   620   135    47     1 gDi
   620   154    67     1 tKe
   620   189   103     1 kSa
   620   242   157     2 qSPs
   621   138    71    11 sVENYKKYPAYPa
   621   170   114     1 rEe
   621   175   120     1 dQf
   621   217   163     2 eQIm
   622   138    71     8 sVENYKKYPa
   622   170   111     1 rEe
   622   175   117     1 dEf
   622   217   160     2 eQIm
   623   215   146     1 gNt
   624   217   149     1 mSa
   625   217   146     1 tLs
   626   217   148     1 tLs
   627   217   148     1 tLs
   628   217   148     1 tLs
   629   170   101     1 nEv
   629   217   149     1 tLs
   630   220   150     1 tLs
   631   217   148     1 tLs
   632   217   147     1 tSt
   633   217   147     1 tSt
   634   217   150     1 tLs
   636   215   131     1 gNt
   637   215   146     2 gNTk
   638   217   148     1 tQs
   639   217   150     1 tLs
   640   217   148     1 tAs
   641   217   146     1 tLs
   642   215   138     5 gNLSGSs
   643   217   148     1 tLs
   644   138    75     4 eGYSDt
   644   217   158     2 gATy
   644   241   184     1 qSa
   644   259   203     1 gVg
   645   217   150     1 tLs
   646   108    39     3 qAGLl
   646   114    48     1 lIc
   646   134    69     2 nPFd
   646   166   103     2 lSAa
   647   108    39     3 qAGLl
   647   114    48     1 fIc
   647   134    69     2 nPFd
   647   166   103     2 lSAa
   648    14    55     1 iPs
   648    34    76     1 eTv
   648    41    84     7 sNPCQNNAe
   648    46    96     1 aGs
   649   119    36     1 iVc
   649   139    57    11 rNNPSRTGCVVPd
   649   177   106     2 kLTn
   649   188   119     1 pIt
   649   246   178     1 rAn
   649   282   215     3 dPRVt
   650   139    48     5 tKPPGAs
   650   243   157     2 eEQy
   650   292   208     1 sYn
   651   139    50     2 dKNp
   651   158    71     1 sVe
   651   174    88     2 gSPk
   651   221   137     1 tLs
   652   118    27     1 hNc
   652   138    48     7 qRPYAYIPl
   652   173    90     2 kLGg
   652   178    97     2 tGDy
   652   282   203     1 rGd
   653    43    46     7 sDPCQNGAt
   654   138    72     4 yTDSEp
   654   218   156     1 tLy
   654   242   181     2 sQAy
   655   138    72     2 nKNa
   655   241   177     2 aEAn
   655   259   197     1 eEg
   656   108    39     1 qAs
   656   116    48     1 yIc
   656   136    69     2 rPFd
   656   154    89     1 qHv
   657    35   575     7 lSNINELGl
   657    50   597     7 sSPCINASs
   658   116    45     1 fSc
   659   108    43     6 vVQLRRRs
   659   117    58     1 qTc
   659   137    79     2 nRQa
   659   205   149     2 gYTq
   659   229   175     1 qDt
   660   137    73     2 sRDv
   660   185   123     2 yDAt
   660   189   129     1 tQa
   660   239   180     2 qLDy
   661   138    76     2 gASa
   661   215   155     5 gTTTSGs
   661   237   182     3 eSEYy
   662   118    28     1 hGc
   662   138    49     2 dIDw
   662   154    67     2 qDGn
   662   157    72     1 qVg
   662   173    89     1 aSg
   662   281   198     1 aAd
   663   113    21     1 nLa
   663   119    28     1 hGc
   663   139    49     3 gMTNp
   663   174    87     2 tASa
   663   179    94     1 pRn
   663   219   135     2 gVYd
   663   221   139     1 iQs
   663   245   164     3 sQNYi
   663   281   203     2 sPDg
   663   294   218     1 gEq
   664   138    58     2 sKEl
   664   243   165     2 nSTs
   664   279   203     2 dNTd
   664   292   218     1 gSv
   665   138    48     3 gQSNp
   665   243   156     2 nSAq
   665   270   185    10 sFFITLSKKGDs
   666   217   148     1 tLs
   667   138    47     4 gRDANi
   667   241   154    11 qKFLNQGPIKNKv
   668   138    46     4 sEELLp
   668   217   129     2 gQTn
   668   278   192     2 tESd
   669   138    48     4 gTLNKp
   669   156    70     1 pRs
   669   172    87     1 sWk
   669   219   135     2 gSTr
   669   245   163     5 sRLYWWg
   670   212   120     2 vLQf
   671   217   138     1 tLs
   672   108    53     7 tVHILTHVs
   672   122    74     6 sLDSTNAs
   672   135    93     6 vNNRLVNa
   672   151   115     1 lNe
   672   160   125     1 vLa
   672   169   135     5 dVSMENd
   672   181   152     2 qHSe
   672   208   181     2 gLTr
   672   244   219     2 dMSg
   673   221   133     3 gYNNl
   673   245   160     2 nSSm
   674   108    26     5 qVSVRRt
   674   139    62     2 dLLv
   674   155    80     1 vQe
   674   158    84     1 yPf
   674   246   173     5 kDMFLKa
   674   282   214     1 gRd
   675   217   150     1 tLs
   676   117    50     1 fIc
   676   137    71     2 sLKv
   676   174   110     3 eGSSg
   676   218   157     2 tQEg
   676   242   183     9 eDMYESSFGYs
   677   217   150     1 tLs
   678   217   145     1 tSa
   679   217   146     5 gNIYTDq
   680    34   127     8 aFAESECHPl
   680    47   148     1 gPe
   681   217   150     1 tLs
   682   217   145     1 tSa
   683   216   148     1 mVs
   684   216   148     1 mVs
   685   215   128     1 gNt
   686   153    61     2 vAFq
   686   156    66     1 hLn
   686   219   130     2 gTIr
   686   245   158     1 kCs
   687   108    32     7 qVQRYITAr
   687   137    68     3 qPYPt
   687   187   121     4 iNGRCa
   687   220   158     2 tAFq
   687   244   184     2 aTRs
   687   280   222     1 aTn
   688    43   511     7 sQPCGNQGi
   689   138    76     2 kIDa
   689   173   113     2 iMWy
   689   214   156     2 tIYe
   689   238   182     3 rSDEy
   690   224   152     4 eDRLQx
   691   108    31     5 qVSVRRt
   691   139    67     2 dLLt
   691   155    85     1 vQe
   691   158    89     1 lPy
   691   246   178     5 kSMFLRa
   691   282   219     1 gKd
   692   117    33     1 fIc
   692   217   134     1 tTs
   692   241   159     1 qAc
   692   286   205     1 gDy
   693   215   138    11 gNTKSSGSKSHGn
   693   217   151     5 tVPRSEn
   694   117    43     1 iRc
   694   137    64     3 sAVQw
   694   153    83     2 aDNe
   694   211   143     1 eEd
   694   222   155     1 tTs
   695   108    47     5 qLSFQEk
   695   137    81     5 gDDYDNp
   695   174   123     3 dLLDn
   695   214   166     6 gTTSEGRn
   695   234   192     1 rSd
   696   108    38     1 qVa
   696   137    68     5 lRLFPTl
   696   169   105     1 qDc
   696   174   111     2 sPDy
   697    34    84     8 aFAESECHPl
   697    47   105     1 gPe
   698   116    44     1 iSc
   699   108    48     2 qVSv
   699   113    55     1 sKs
   699   174   117     2 yLTn
   699   205   150     1 tAp
   699   241   187     2 sQLy
   699   259   207     1 eKg
   700   117    47     1 lIc
   700   137    68     2 gASa
   700   216   149     2 gALt
   700   240   175     2 sSDy
   701   108    33     2 qVSl
   701   113    40     1 sSh
   701   119    47     1 lLc
   701   139    68     4 rYGNSt
   701   190   123     4 pEEQCa
   701   222   159     3 gDTGr
   701   261   201     2 hEHk
   701   279   221     1 rPg
   702   108    33     2 qVSl
   702   113    40     1 sSh
   702   119    47     1 lLc
   702   139    68     4 rYGNSt
   702   190   123     4 pEEQCa
   702   222   159     3 gDTGr
   702   261   201     2 hEHk
   702   279   221     1 rPg
   703   108    33     2 qVSl
   703   113    40     1 sSh
   703   119    47     1 lLc
   703   139    68     4 rYGNSt
   703   190   123     4 pEEQCa
   703   222   159     3 gDTGr
   703   261   201     2 hEHk
   703   279   221     1 rPg
   704   108    33     2 qVSl
   704   113    40     1 sSh
   704   119    47     1 lLc
   704   139    68     4 rYGNSt
   704   190   123     4 pEEQCa
   704   222   159     3 gDTGr
   704   261   201     2 hEHk
   704   279   221     1 rPg
   705   217   148     1 tLs
   706   217   148     1 tLs
   707   137    80     2 gLSa
   707   185   130     3 kMSTg
   707   215   163     2 tLSs
   707   239   189     3 nANYg
   707   257   210     1 nVg
   708   160    97     1 kEi
   708   163   101     2 tISd
   708   210   150     3 gVLHq
   708   249   192     1 gEy
   709   115    62     1 gRg
   709   135    83     7 pKEHEAQSn
   709   151   106     2 lMKl
   709   167   124     1 rQd
   709   172   130     2 nFEg
   709   203   163     1 dLg
   709   213   174     4 gVMEEk
   709   233   198     5 eNWLRGk
   709   269   239     2 dPNt
   710   173    84     2 dPTs
   710   178    91     3 dQAPn
   710   179    95     8 nPAPPSHDSd
   710   220   144     1 tSs
   710   260   185     2 aTAg
   710   287   214     1 gMq
   711   215   146     1 gNt
   712   217   150     1 tLs
   713   217   148     1 tLs
   714   217   150     1 tLs
   716   137    80     2 gLSa
   716   185   130     3 kMSTg
   716   215   163     2 tLSs
   716   239   189     3 nANYg
   716   257   210     1 nVg
   717   108    17     1 qAm
   717   139    49     2 gEQp
   717   155    67     1 kTv
   717   178    91     2 eMAn
   717   222   137     2 gSLs
   717   246   163     1 dTg
   717   282   200     1 dTn
   718    43    77     7 gNPCANGGt
   719   108    19     2 qVSm
   719   139    52     2 dERa
   719   221   136     1 tNy
   719   245   161     3 hATYl
   720   108    20     2 qVEi
   720   113    27     1 tPn
   720   139    54     4 tYNNIs
   720   174    93     2 vVGd
   720   179   100     2 pGDy
   720   247   170     2 nANd
   720   283   208     1 nAd
   721    43    80     7 gNPCANGGt
   722    14    14     1 aEk
   722    43    44     7 gDPCANGGt
   723    43    46     7 gDPCANGGt
   724   108    27     2 qVSi
   724   136    57     2 dKSv
   724   213   136     5 gNTEEEn
   724   215   143     1 tAi
   724   239   168     4 sSAKYg
   725   138    53     2 dKLp
   725   215   132     4 gYTNGp
   725   235   156     1 lKv
   726   137    79     2 sASv
   726   185   129     2 yNSt
   726   240   186     2 tLAy
   727   108    39     1 qAa
   727   116    48     1 fKc
   727   136    69     2 nPFd
   727   168   103     1 vKp
   727   212   148     2 gEFg
   728   108    43     6 vVQLRRRs
   728   117    58     1 qTc
   728   137    79     2 nREa
   728   186   130     3 pLPLa
   728   214   161     2 gYTk
   728   238   187     1 qEa
   728   255   205     1 sEg
   729    43   132     7 sGPCQHGGa
   729    68   164     1 gTn
   730    17    17     1 gEt
   730    41    42     7 qTPCQNGGt
   731   138    49     7 iYKNPKLWm
   731   212   130     2 gALk
   731   236   156     2 nQVn
   731   272   194     1 rDr
   732   139    68     2 gRKp
   732   171   102     2 nFEe
   732   188   121     2 kQSs
   732   213   148     1 gAd
   732   239   175     3 aSASy
   733   138    58     6 sGTNKIPv
   733   157    83     1 pAa
   733   173   100     1 rCg
   733   208   136     1 gYs
   733   222   151     5 gWLGEDr
   733   246   180     5 sEWYASq
   733   282   221     2 sRPg
   734   154    67     1 sSn
   734   157    71     1 sNr
   734   173    88     1 aQg
   734   191   107     1 rNg
   734   216   133     2 gWNd
   734   241   160     5 eKRFLAa
   735   108    40     2 qAAl
   735   135    69     5 gKTQASv
   735   151    90     1 aTa
   735   185   125     3 pITNv
   735   199   142     1 sPa
   735   203   147     1 yAg
   735   214   159     1 tTs
   736   138    46     2 gAGa
   736   243   153     2 nKAy
   737   108    24     7 qASIRFRVp
   737   113    36     1 tEg
   737   119    43     1 hNc
   737   139    64     2 dRDa
   737   174   101     1 sLy
   737   190   118     4 vNGRCa
   737   222   154     3 gVTNe
   737   248   183     4 kSRYNk
   737   284   223     1 nSe
   738   117    26     1 lRc
   738   170    80     2 qGSg
   738   215   127     3 gMTNq
   738   283   198     2 gATe
   739   158    89     1 fEq
   739   219   151     2 gVTq
   740    17   230     1 gGg
   740    41   255     7 sQPCLNGGq
   741   108    16     4 qVRLHi
   741   137    49     2 sTSt
   741   153    67     1 sPn
   741   277   192     1 nNd
   742    43   344     7 dGPCFNGGt
   742    48   356     1 eGt
   742    49   358     1 tGg
   743    34   122     8 eSGKQTNTSv
   743    53   149     1 pGg
   744   170    99     1 nFk
   744   218   148     2 gVTq
   745   219   149     2 gVTq
   746    14    18     1 qSn
   746    41    46     7 fTPCQNGGt
   747   219   149     2 gVTq
   748    43   160     7 sSPCQNGGt
   748    49   173     1 rGe
   749   136    56     4 eQKHDa
   749   169    93     1 tHd
   749   218   143     2 gLTq
   749   241   168     6 tAAYEKPp
   749   258   191     1 eSg
   749   276   210     2 dNEt
   749   289   225     1 gSm
   750   138    63     2 gASv
   750   211   138     2 gALs
   750   235   164     1 rRv
   751    18   337     1 eSg
   751    34   354     2 eHSl
   751    40   362     7 dSPCFHKGk
   751    46   375     1 dNg
   751    47   377     1 gRs
   752    18   337     1 eSg
   752    34   354     2 eHSl
   752    40   362     7 dSPCFHKGk
   752    46   375     1 dNg
   752    47   377     1 gRs
   753   138    52     2 gTSv
   753   221   137     2 tTSs
   753   245   163     1 rDs
   754    41   115     6 dNPCQHGs
   754    46   126     1 qSg
   755   137    73     2 gGTv
   755   153    91     1 nAe
   755   184   123     3 dSSYa
   755   211   153     2 gATr
   755   272   216     1 dEn
   756   119   396     1 lLc
   756   139   417     8 yPPWDKNFTe
   756   155   441     1 yEr
   756   174   461     1 nWr
   756   224   512     2 gNLr
   756   226   516     4 eTWTAs
   756   265   559     4 gKSPVa
   756   268   566     3 gLGVg
   756   277   578     8 pDEGKRGDAc
   756   286   595     6 fVMKSPFn
   757   138    47     3 nRNIa
   757   173    85     1 sIk
   757   246   159     4 vAALLt
   757   282   199     1 nKk
   757   299   217    10 gRGWRNNMQEDn
   758     5   115     1 eLp
   758    14   125     1 vYd
   758    34   146     1 eRk
   758    48   161     2 nGGq
   758    53   168     1 eNg
   758    54   170     2 gFAr
   759    10    43     1 eNt
   759    38    72     7 pAPCLHGGt
   760   117    34     1 fIc
   760   137    55     2 gSDr
   760   153    73     1 pKe
   760   170    91     1 lNv
   760   175    97     1 iTn
   760   241   164     3 hNQTq
   760   277   203     2 dTEa
   761   108    35     2 qVSv
   761   113    42     1 sKs
   761   244   174     2 sQLy
   761   262   194     1 eKg
   762   115   143     1 gRg
   762   135   164     9 pKEHNKENNVn
   762   151   189     2 iKKl
   762   169   209     7 dEPNNFEGd
   762   199   246     1 dKd
   762   209   257     4 gITEDk
   762   229   281     5 qRWLRTk
   762   245   302     2 dPTl
   762   263   322     2 dRSr
   763    14    51     1 nIr
   763    41    79     6 sNPCRVGn
   763    47    91     1 dEg
   763    48    93     1 gFg
   763    66   112     1 dTl
   764   212   143     1 gNt
   765   215   131     1 gNt
   766    14   138     1 tSv
   766    18   143     1 gTs
   766    42   168     7 nNPCKHGGt
   767   139    48     2 gRQa
   767   155    66     1 tSe
   767   209   121     1 nAd
   767   224   137     1 iQs
   767   248   162     2 rDSs
   768    43   350     7 dGPCFNGGt
   768    48   362     1 kGs
   768    49   364     1 sGs
   769    42    42     7 nKPCLNGGs
   770     5    86     1 eQp
   770    42   124     7 tMPCRNGGt
   771    43    84     7 sCPCKNGGs
   772   108    16     2 qAAl
   772   137    47     5 kHSSRNp
   772   172    87     2 iPGn
   772   177    94     2 pGDy
   772   245   164     2 fIDr
   772   281   202     1 gDd
   773    35   109     2 eKDl
   773    48   124     2 hGGt
   773    53   131     1 eYg
   774    13    13     1 eVt
   774    41    42     7 sNPCLNGGr
   775    43   127     7 gNPCANGGt
   776   113    24     1 yAe
   776   139    51     3 rSRNp
   776   173    88     3 mPSSf
   776   213   131     1 gYq
   776   238   157     3 nSILh
   776   272   194     2 sRIr
   777    43   350     7 dGPCFNGGt
   777    48   362     1 kGs
   777    49   364     1 sGs
   778   108    39     1 qAs
   778   137    69     2 kVYs
   778   196   130     5 gAIGYEk
   779   137    46     4 sSTSSa
   779   172    85     2 tSSk
   779   214   129     2 gSMa
   779   238   155     2 nRPe
   779   274   193     4 tPNGLh
   780   138    58     2 qISp
   780   172    94     2 dGSn
   781    43  1439     7 sSPCLNRAy
   782    43  1259     7 sNPCLNRAy
   783   163    94     1 dAt
   783   205   137     2 nTRk
   784    35   154     8 eKNINDCNRm
   784    37   164     1 tRk
   784    51   179     2 nGGt
   785    43    56     7 sSPCQFGGt
   786    37    69     1 gKd
   786    51    84     7 sDPCQNGGt
   787     6    91     2 nNGg
   787    26   113     4 gYALNg
   787    33   124     1 dDi
   788   108    16     3 qAMLw
   788   201   112     1 rRa
   789   138    90     2 sTNa
   789   176   130     3 rGKRf
   789   177   134     2 fANd
   789   187   146     4 sVDQAv
   789   191   154     1 sGt
   789   207   171     1 dYh
   789   211   176     1 rGt
   789   221   187     4 gVEDAq
   789   244   214     3 nAAWg
   789   261   234     3 tATEg
   789   279   255     3 kEDGs
   789   292   271     1 gPf
   790    43    88     7 gSPCQNGGt
   791   113    30     1 kIa
   791   139    57     2 rVEp
   791   215   135     1 gTt
   791   241   162     3 aSKNy
   792   113    48     1 dAn
   792   139    75     2 gSNp
   792   189   127     2 kQSs
   792   214   154     1 gTk
   792   240   181     3 aSKTy
   793   139    74     2 yKDl
   793   189   126     2 kQSs
   793   214   153     1 gTk
   793   240   180     3 aSNTy
   794     5    99     1 qSp
   794    14   109     1 mYd
   794    34   130     1 eRk
   794    48   145     2 nGGq
   794    53   152     1 dQg
   794    54   154     2 gFAl
   795    43   350     7 dGPCFNGGt
   795    48   362     1 kGs
   795    49   364     1 sGs
   796   108    54     4 qVLINi
   796   113    63     1 sDd
   796   119    70     1 tIc
   796   126    78     7 kVQSEENSs
   796   139    98     6 aNETLIDk
   796   176   141     3 dMLTy
   796   221   189     6 tAAIKYVs
   796   245   219     2 sRSs
   796   261   237     2 kSYg
   796   279   257     1 aKt
   797    14    18     1 lIe
   797    41    46     7 sNPCQNGGt
   798   138    52     6 sGTNKIPi
   798   157    77     1 pAa
   798   173    94     1 kCg
   798   208   130     1 gYs
   798   222   145     5 gWLGEDr
   798   246   174     5 dEWYASq
   798   282   215     2 sYPa
   799   108    25     3 qASLr
   799   139    59     4 lLGTDp
   799   174    98     2 rSGf
   799   218   144     2 iDSg
   799   242   170     9 dEEYHIDSPFd
   800     5    99     1 qSp
   800    14   109     1 mYd
   800    34   130     1 eRk
   800    48   145     2 nGGq
   800    53   152     1 dQg
   800    54   154     2 gFAl
   801   136    63     8 pKGGFGPQDl
   801   152    87     2 iEKl
   801   173   110     1 dDf
   801   174   112     2 fNAd
   801   217   157     2 gEEr
   801   239   181     5 qAWLRKh
   801   255   202     2 dQAq
   801   273   222     2 dDHs
   802     5   227     2 mDHg
   802    15   239     1 pSs
   802    24   249     4 gYKLNa
   803     5    99     1 qSp
   803    14   109     1 mYd
   803    34   130     1 eRk
   803    48   145     2 nGGq
   803    53   152     1 dQg
   803    54   154     2 gFAl
   804   138    80     3 nTSEt
   804   156   101     1 pHa
   804   173   119     5 gMASSAd
   804   214   165    11 gSPSEQDLLPNPr
   804   231   193     9 nLLYGKDAEFg
   805   138    81     3 nTSEt
   805   156   102     1 pHa
   805   173   120     5 gMASSAd
   805   214   166    11 gSPSEQDLLPNPr
   805   231   194     9 nLLYGKDAEFg
   806    18   732     1 tSg
   806    34   749     2 qTNi
   806    40   757     7 sNPCLNQGt
   806    46   770     1 vAg
   807    18   773     1 tSg
   807    34   790     2 qTNi
   807    40   798     7 sNPCLNQGt
   807    46   811     1 vAg
   808     5    99     1 qSp
   808    14   109     1 mYd
   808    34   130     1 eRk
   808    48   145     2 nGGq
   808    53   152     1 dQg
   808    54   154     2 gFAl
   809   115   486     1 gRg
   809   135   507     7 pKGHNKESn
   809   151   530     2 iEKl
   809   169   550     7 dEPNNFEGd
   809   199   587     1 dKs
   809   209   598    10 gITEDKLAFSLr
   809   223   622     5 rRWLQTk
   809   238   642     3 gDPTl
   809   256   663     2 dRDr
   810    18   319     1 dSg
   810    34   336     2 eHGl
   810    40   344     7 dSPCFHSGk
   810    46   357     1 dNg
   810    47   359     1 gRs
   811    18   332     1 eNd
   811    42   357     7 dGPCFNGGt
   811    48   370     1 vVg
   812     5    99     1 qSp
   812    14   109     1 mYd
   812    34   130     1 eRk
   812    48   145     2 nGGq
   812    53   152     1 dQg
   812    54   154     2 gFAl
   813    18   194     1 tSg
   813    34   211     2 qTNi
   813    40   219     7 sNPCLNQGt
   813    46   232     1 vAg
   814    14   804     1 qNd
   814    34   825     2 eMSl
   814    45   838     2 nGGt
   814    51   846     2 qAGe
   814    52   849     2 eGSg
   815    18   753     1 tSg
   815    34   770     2 qTNi
   815    40   778     7 sNPCLNQGt
   815    46   791     1 vAg
   816   108    28     2 qVSl
   816   139    61     4 pDVKDl
   816   174   100     2 qIGa
   816   218   146     2 vDNd
   816   242   172     9 dAEYHTGLHTg
   817    18   641     1 tSg
   817    34   658     2 qTNi
   817    40   666     7 sNPCLNQGt
   817    46   679     1 vAg
   818     5    99     1 qSp
   818    14   109     1 mYd
   818    34   130     1 eRk
   818    48   145     2 nGGq
   818    53   152     1 dQg
   818    54   154     2 gFAl
   819    43   375     7 dGACQNGGt
   820   138    59     3 nTSEt
   820   156    80     1 pHs
   820   173    98     5 gMASSAd
   820   214   144    11 gSPSEQDHLPNPr
   820   231   172     9 nLLYSTDTASs
   821     5   305     1 rQp
   821    14   315     1 iNt
   821    42   344     7 sNPCSNGGs
   821    47   356     1 tSq
   822     5   301     1 rQp
   822    14   311     1 iNt
   822    42   340     7 sNPCSNGGs
   822    47   352     1 tSq
   823     5   286     1 rQp
   823    14   296     1 iNt
   823    42   325     7 sNPCSNGGs
   823    47   337     1 tSq
   824     5    99     1 qSp
   824    14   109     1 mYd
   824    34   130     1 eRk
   824    48   145     2 nGGq
   824    53   152     1 dQg
   824    54   154     2 gFAl
   825    18   773     1 tSg
   825    34   790     2 qTNi
   825    40   798     7 sNPCLNQGt
   825    46   811     1 vAg
   826     5    99     1 qSp
   826    14   109     1 mYd
   826    34   130     1 eRk
   826    48   145     2 nGGq
   826    53   152     1 dQg
   826    54   154     2 gFAl
   827   108    32     2 mAHl
   827   119    45     1 wRc
   827   139    66     5 tQPPPNi
   827   172   104     2 kVTh
   827   221   155     2 vGTd
   827   260   196     2 dMSg
   827   291   229     2 gSQg
   828    18   341     1 eTg
   828    34   358     2 eHRl
   828    40   366     7 dSPCFHGGe
   828    46   379     1 dNg
   828    47   381     1 gRs
   829    18   341     1 eTg
   829    34   358     2 eHRl
   829    40   366     7 dSPCFHGGe
   829    46   379     1 dNg
   829    47   381     1 gRs
   830    18   333     1 eTg
   830    34   350     2 eHRl
   830    40   358     7 dSPCFHGGe
   830    46   371     1 dNg
   830    47   373     1 gRs
   831    18   344     1 eTg
   831    34   361     2 eHRl
   831    40   369     7 dSPCFHGGe
   831    46   382     1 dNg
   831    47   384     1 gRs
   832    14    50     1 sAd
   832    41    78     7 sQPCANGAt
   833   138    70    11 lSCSSLTEISVCs
   833   154    97     2 dSNk
   833   157   102     1 tVh
   833   173   119     1 sVq
   833   178   125     3 tNTRy
   833   179   129     7 ySYVTYDYd
   833   220   177     2 gYTv
   833   244   203     2 nRIs
   834    18   335     1 eTg
   834    34   352     2 eHSl
   834    40   360     7 dLPCFHGGk
   834    46   373     1 dNg
   834    47   375     1 gRs
   835    35    89     8 sTVAFIQYLf
   835    37    99     1 qQe
   835    51   114     7 pNPCSNGGt
   836    18   158     1 tSg
   836    34   175     2 qTNi
   836    40   183     7 sNPCLNQGt
   836    46   196     1 vAg
   837    18   773     1 tSg
   837    34   790     2 qTNi
   837    40   798     7 sNPCLNQGt
   837    46   811     1 vAg
   838     6   266     2 nISn
   838    26   288     4 gYELDs
   838    33   299     1 iDi
   838    51   318     1 tNg
   839     6    45     2 yNGg
   839    26    67     3 gFILy
   839    33    77     1 eDi
   839    51    96     1 tAg
   840   139    70     2 aFAp
   840   155    88     1 aRq
   840   169   103     1 pAh
   840   174   109     2 eRGs
   840   185   122     3 aTSAs
   841     5    93     1 nPp
   841    14   103     1 vYd
   841    34   124     1 eRk
   841    48   139     2 nGGq
   841    53   146     1 eNg
   841    54   148     2 gFAk
   842     5    99     1 qSp
   842    14   109     1 vYd
   842    34   130     1 eRk
   842    48   145     2 nGGl
   842    53   152     1 dQg
   842    54   154     2 gFAl
   843    14    18     1 kAn
   843    41    46     7 sSPCENGGt
   844    17   337     1 eTg
   844    33   354     2 eHNl
   844    39   362     7 dSPCFHGGk
   844    45   375     1 dNg
   844    46   377     1 gRs
   845    18   773     1 tSg
   845    34   790     2 qTNi
   845    40   798     7 sNPCLNQGt
   845    46   811     1 vAg
   846   108    46     2 mASl
   846   242   182     3 cLKYl
   847   108    23     5 qVSVRRt
   847   139    59     2 dLLt
   847   155    77     1 vQe
   847   158    81     1 lPy
   847   246   170     5 kSMFLRa
   847   282   211     1 gKd
   848    18   315     1 eTg
   848    34   332     2 eHSl
   848    40   340     7 dLPCFHGGk
   848    46   353     1 dNg
   848    47   355     1 gRs
   849    35   316     2 eHSl
   849    41   324     7 dSPCFHKGr
   849    47   337     1 dNg
   849    48   339     1 gRs
   850    35   354     2 eHSl
   850    41   362     7 dSPCFHKGr
   850    47   375     1 dNg
   850    48   377     1 gRs
   851     5    93     1 qSp
   851    14   103     1 mYd
   851    34   124     1 eRk
   851    48   139     2 nGGq
   851    53   146     1 dQg
   851    54   148     2 gFAl
   852    44    48     7 rKPCLNGGf
   852    49    60     2 fDRt
   852    50    63     2 tKGn
   853    44    47     7 rKPCLNGGf
   853    49    59     2 fDRt
   853    50    62     2 tKGn
   854    44    47     7 rKPCLNGGf
   854    49    59     2 fDRt
   854    50    62     2 tKGn
   855    44    46     7 rKPCLNGGf
   855    49    58     2 fDRn
   855    50    61     2 nKGn
   856    44    48     7 rKPCLNGGf
   856    49    60     2 fDRt
   856    50    63     2 tKGn
   857   216   128     1 gTt
   857   287   200     1 gMq
   858   108    21     1 qVa
   858   116    30     1 lYc
   858   215   130     5 gATTSPe
   858   282   202     1 gMe
   859   139    73     2 sYTa
   859   189   125     2 rESs
   859   214   152     1 gTk
   859   216   155     1 cFl
   859   240   180     3 aSNEf
   860    43    77     7 sGPCQNGAt
   861   138    47     6 dSYSSTNe
   861   154    69     2 kEDf
   861   157    74     1 qTr
   861   170    88     1 kSm
   861   173    92     2 lEGi
   861   178    99     2 pPDf
   861   246   169     2 nLVn
   862     5   207     2 sGDp
   862    41   245     7 gSPCLNGGt
   862    46   257     1 gNq
   863     5   184     1 iVp
   863    14   194     1 hLt
   863    34   215     2 tKDl
   863    40   223     7 tHAPWQNGa
   863    45   235     1 tGp
   864   108    44     6 qVSLRANd
   864   135    77     4 pDVADp
   864   170   116     2 qDGa
   864   237   185     9 dLKYHKGLITg
   865   108    29     2 mVTi
   865   139    62     3 rQPDp
   865   236   162    11 mTESKGHTNSRFk
   865   272   209     1 sRd
   866   119    37     1 fVc
   866   145    64     1 hKn
   866   157    77     2 eDNd
   866   209   131     3 lSNVs
   866   245   170     1 rEd
   867   113    22     1 kVn
   867   139    49     4 gMGLYp
   867   155    69     2 nSYd
   867   194   110     1 vHg
   867   221   138     1 gLt
   867   245   163     2 nKPs
   867   281   201     1 kAd
   868    43   175     7 sSPCQNGGt
   869    50    50     7 sTPCQNGGt
   870     8   234     3 pACYn
   870    32   261     8 eIGCGGNRFg
   870    34   271     1 rDc
   870    48   286     5 aCAGRVf
   870    53   296     1 dPq
   871    43    45     7 sVICQNGGi
   872     6     9     2 aNGg
   872    26    31     4 gHNLNv
   872    33    42     1 dDi
   873    43   132     7 eTTCDNGGt
   874    13    13     1 gNs
   874    37    38     7 sNPCRNGGn
   875   108   121     7 mALLIYKNi
   875   113   133     1 sIs
   875   119   140     1 fKc
   875   139   161     3 gLTKt
   875   171   196     1 yQd
   875   174   200     2 rVEe
   875   179   207     2 hEDy
   875   180   210     7 yNVLLFQNd
   875   190   227     1 mNl
   875   223   261     2 gVTd
   875   248   288     2 vKMy
   875   265   307     3 tTNRi
   875   283   328     4 vKFDGd
   875   296   345     1 gSr
   876     5    99     1 qSp
   876    14   109     1 vYd
   876    34   130     1 eRk
   876    48   145     2 nGGq
   876    53   152     1 nQg
   876    54   154     2 gFAl
   877     5    99     1 qSp
   877    14   109     1 vYd
   877    34   130     1 eRk
   877    48   145     2 nGGq
   877    53   152     1 nQg
   877    54   154     2 gFAl
   878    43   136     7 pQPCAEGRi
   878    48   148     1 rGn
   878    67   168     1 pLk
   879     9   888     1 rLc
   879    28   908     4 gFLLAa
   879    42   926     1 aQr
   879    47   932     1 eCa
   879    48   934     1 aNi
   879    49   936     2 iYGs
   880    43   233     7 sRPCKNNGt
   880    48   245     1 eMd
   881   139    47     2 dAVh
   881   190   100     3 aSTKa
   881   215   128     2 tTSe
   881   239   154     1 qAl
   881   275   191     3 sSNSa
   882    27   204     2 gFTf
   882    41   220     7 eGVPCSDGl
   883   108    58     7 vVSLQRKFl
   883   135    92     2 yDNa
   883   186   145     3 pLNVl
   883   218   180     7 gTTSASGDr
   883   237   206     5 nAAYSGe
   883   253   227     2 gAPg
   883   271   247     4 pADGNv
   884    14   830     1 qNd
   884    34   851     2 eMSl
   884    45   864     2 nGGt
   884    50   871     2 gAGe
   884    51   874     1 eGa
   885    14   930     1 qNd
   885    34   951     2 eMSl
   885    45   964     2 nGGt
   885    50   971     2 gAGe
   885    51   974     1 eGa
   886   138    80     3 nTSEt
   886   156   101     1 pHa
   886   173   119     5 gMASSAd
   886   214   165    11 gSSSEQDRLPNPr
   886   231   193     9 nLLYSKDAEFg
   887   138    81     3 nTSEt
   887   156   102     1 pHa
   887   173   120     5 gMASSAd
   887   214   166    11 gSSSEQDRLPNPr
   887   231   194     9 nLLYSKDAEFg
   888   113    22     1 vRr
   888   119    29     1 hVc
   888   139    50     4 pGLGDl
   888   173    88     2 aQGa
   888   215   132     4 gDAVAk
   888   239   160     9 dAKYHAGLYTg
   889    43   222     7 sRPCKNNGt
   889    48   234     1 eMd
   890   154    70     1 sSe
   890   221   138     2 lSEn
   890   245   164     7 nGMLQNKLs
   891     5    99     1 qSp
   891    14   109     1 vYd
   891    34   130     1 eRk
   891    48   145     2 nGGq
   891    53   152     1 nQg
   891    54   154     2 gFAl
   892     5   136     1 qSp
   892    14   146     1 mYd
   892    34   167     1 eRk
   892    48   182     2 nGGq
   892    53   189     1 nQg
   892    54   191     2 gFAl
   893     5   110     1 qPp
   893    14   120     1 vYe
   893    34   141     1 eRk
   893    48   156     2 nGGq
   893    53   163     1 dQg
   893    54   165     2 gFAk
   894   138    81     3 nTSEt
   894   156   102     1 pHa
   894   173   120     5 gMASSAd
   894   214   166    11 gSSSEQDRLPNPr
   894   231   194     9 nLLYSKDAEFg
   895     5   173     1 hKp
   895    14   183     1 fNt
   895    34   204     2 eKQl
   895    40   212     7 hHPCLHGGi
   895    45   224     1 dNg
   895    46   226     1 gTg
   896     9   386     1 rLc
   896    28   406     4 gFRLAe
   896    42   424     1 tQr
   896    47   430     1 eCa
   896    48   432     1 aNi
   896    49   434     2 iYGs
   897   138    51     7 dMTHPEKWt
   897   201   121     1 pYn
   897   211   132     2 gALt
   897   235   158     2 nREe
   897   271   196     1 dSr
   898     8    69     4 nPVCLn
   898    37   102     6 pPCKNGGh
   899   123   490     1 iAd
   899   136   504     4 hKGQQv
   899   152   524     7 mINSPLYAe
   899   165   544     3 dDLSy
   899   166   548     2 yNNd
   899   204   588     9 pRFFPFFRLVs
   899   206   599     6 gFGLVNDn
   899   230   629     9 nDSFNLLKERk
   899   246   654     2 tPEg
   900     5     9     2 gNDs
   900    25    31     4 gHRLQa
   900    32    42     1 qAi
   900    50    61     1 mGp
   901   138    80     3 nTSEt
   901   156   101     1 pHa
   901   173   119     5 gMASSAd
   901   214   165    11 gSPSEEDLLPEPr
   901   231   193     9 nLLYSKDTEFg
   902   108    56     5 qVLLSVe
   902   113    66     1 rVp
   902   139    93    11 sQRRDNTVVAVVp
   902   155   120     1 kRs
   902   220   186    11 gISSLNSSSFTRp
   902   222   199     6 sSPSTPSs
   902   246   229     5 qASYTSr
   902   282   270     2 dGVs
   902   295   285     2 gGPg
   903   143    52     1 cAh
   903   165    75     2 aAGp
   903   169    81     1 sTn
   903   196   109     4 gITEEr
   903   219   136     2 nSPs
   904   138    47     2 eHDp
   904   178    89     2 iPDw
   904   220   133     1 gRr
   904   245   159     1 nKg
   904   281   196     1 aNd
   905    43    81     7 tNPCLNGGt
   906    35   260     2 gTDi
   906    41   268     7 pNPCMNGGt
   907    14    21     1 eLe
   907    18    26     1 gIe
   907    42    51     7 sAPCQNEGt
   907    47    63     2 nKMp
   908    14   933     1 qNn
   908    34   954     1 eNi
   908    42   963     7 sDPCVNGAt
   908    48   976     1 dYs
   909    14  1231     1 sDs
   909    18  1236     1 tYa
   909    34  1253     2 eTEl
   909    40  1261     7 sSPCANGGa
   909    45  1273     1 dSt
   909    47  1276     1 gFq
   910     6   587     2 lNGg
   910    26   609     2 gYQs
   910    33   618     4 dATLTi
   910    35   624     1 fLd
   911   108    94     2 mVLi
   911   119   107     1 lSc
   911   139   128    11 fLGPRLTLTGVVl
   911   155   155     4 eGELSc
   911   158   162     1 pRs
   911   194   199     1 tLd
   911   249   255     2 qAAy
   911   265   273     1 gVq
   911   283   292     4 gRTVAg
   911   296   309     1 gSk
   912   108   132     3 mALIq
   912   119   146     1 tAc
   912   139   167     6 gAVLEKVg
   912   155   189    13 pNIDCYHEGSFRFCn
   912   175   222     1 nAd
   912   176   224     5 dQNRRHd
   912   242   295     3 sSTFg
   912   258   314     1 gEd
   912   276   333     3 lFQDs
   913     6   185     2 gMIl
   913    27   208     5 lDGTDEl
   913    29   215     1 sTc
   913    48   235     1 tSw
   914    13    46     1 mPs
   914    42    76     6 sPCLNHGf
   915     5    99     1 qTp
   915    14   109     1 vYd
   915    34   130     1 eRk
   915    48   145     2 nGGq
   915    53   152     1 dQg
   915    54   154     2 gFAl
   916   138    80     3 nTSEt
   916   156   101     1 pHa
   916   173   119     5 gTASSAd
   916   214   165    11 gSPSEEDLLPEPr
   916   231   193     9 nLLYSKDTEFg
   917    34    87     2 eNNi
   917    40    95     7 sNPCQNGGv
   918    41    69     7 rFACANGGs
   919    43    43     7 rKPCLNGGf
   919    48    55     2 fDRt
   919    49    58     2 tKGn
   920    43    43     7 rKPCLNGGf
   920    48    55     2 fDRt
   920    49    58     2 tKGn
   921   108    44     6 qVSLRANd
   921   135    77     4 pDVADp
   921   171   117     2 dGAd
   921   214   162     2 iDNg
   921   238   188     9 dLKYHKGLITg
   922   117    33     1 lRc
   922   169    86     2 qGAy
   922   214   133     3 gTTNk
   922   282   204     2 gSVg
   923    18    18     1 gLe
   923    42    43     7 sKPCLNKGt
   923    47    55     2 iNGl
   924   108    41     6 qVSLRANe
   924   135    74     4 pTIADp
   924   167   110     2 yATq
   924   168   113     3 qNGAd
   924   209   157     4 gNIDNd
   924   233   185     9 dLKYHKGVYTg
//