Complet list of 1xka hssp fileClick here to see the 3D structure Complete list of 1xka.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      1XKA
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2014-05-12
HEADER     BLOOD COAGULATION FACTOR                19-MAR-98   1XKA
COMPND     MOL_ID: 1; MOLECULE: BLOOD COAGULATION FACTOR XA; CHAIN: L; FRAGMENT: 
SOURCE     MOL_ID: 1; ORGANISM_SCIENTIFIC: HOMO SAPIENS; ORGANISM_COMMON: HUMAN; 
AUTHOR     K.KAMATA,S.H.KIM
DBREF      1XKA L   45   139  UNP    P00742   FA10_HUMAN      85    179
DBREF      1XKA C   16   245  UNP    P00742   FA10_HUMAN     235    469
SEQLENGTH   326
NCHAIN        2 chain(s) in 1XKA data set
NALIGN     1505
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : FA10_HUMAN  2W3K    1.00  1.00   93  327  235  469  235    0    0  488  P00742     Coagulation factor X OS=Homo sapiens GN=F10 PE=1 SV=2
    2 : H2Q7T9_PANTR        1.00  1.00   93  327  235  469  235    0    0  488  H2Q7T9     Coagulation factor X OS=Pan troglodytes GN=F10 PE=2 SV=1
    3 : Q5JVE7_HUMAN        1.00  1.00   93  327  235  469  235    0    0  488  Q5JVE7     Coagulation factor X OS=Homo sapiens GN=F10 PE=2 SV=1
    4 : B7ZBK1_HUMAN        0.99  0.99    1   91   89  179   91    0    0  334  B7ZBK1     Factor X light chain OS=Homo sapiens GN=F10 PE=2 SV=1
    5 : FA10_HUMAN  2W3K    0.99  0.99    1   91   89  179   91    0    0  488  P00742     Coagulation factor X OS=Homo sapiens GN=F10 PE=1 SV=2
    6 : G3RDY3_GORGO        0.99  0.99    1   91  101  191   91    0    0  500  G3RDY3     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101135856 PE=3 SV=1
    7 : G3RDY3_GORGO        0.99  1.00   93  327  247  481  235    0    0  500  G3RDY3     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101135856 PE=3 SV=1
    8 : H2Q7T9_PANTR        0.99  0.99    1   91   89  179   91    0    0  488  H2Q7T9     Coagulation factor X OS=Pan troglodytes GN=F10 PE=2 SV=1
    9 : Q5JVE7_HUMAN        0.99  0.99    1   91   89  179   91    0    0  488  Q5JVE7     Coagulation factor X OS=Homo sapiens GN=F10 PE=2 SV=1
   10 : Q5JVE8_HUMAN        0.99  0.99    1   91   89  179   91    0    0  332  Q5JVE8     Factor X light chain OS=Homo sapiens GN=F10 PE=2 SV=1
   11 : G1QI58_NOMLE        0.98  0.99    1   91   89  179   91    0    0  488  G1QI58     Uncharacterized protein OS=Nomascus leucogenys GN=F10 PE=3 SV=1
   12 : G1QI58_NOMLE        0.98  1.00   93  327  235  469  235    0    0  488  G1QI58     Uncharacterized protein OS=Nomascus leucogenys GN=F10 PE=3 SV=1
   13 : H2NKD5_PONAB        0.98  0.99    1   91   89  179   91    0    0  488  H2NKD5     Uncharacterized protein OS=Pongo abelii GN=F10 PE=3 SV=1
   14 : H2NKD5_PONAB        0.98  1.00   93  327  235  469  235    0    0  488  H2NKD5     Uncharacterized protein OS=Pongo abelii GN=F10 PE=3 SV=1
   15 : A9X172_PAPAN        0.97  0.99    1   91   89  179   91    0    0  488  A9X172     Coagulation factor X (Predicted) OS=Papio anubis GN=F10 PE=3 SV=1
   16 : G7PVR7_MACFA        0.97  0.99    1   91   89  179   91    0    0  488  G7PVR7     Coagulation factor X OS=Macaca fascicularis GN=EGM_08638 PE=3 SV=1
   17 : A0N065_MACMU        0.96  0.99   93  327  235  469  235    0    0  488  A0N065     Coagulation factor X protein OS=Macaca mulatta PE=2 SV=1
   18 : A0N065_MACMU        0.96  0.99    1   91   89  179   91    0    0  488  A0N065     Coagulation factor X protein OS=Macaca mulatta PE=2 SV=1
   19 : A9X172_PAPAN        0.96  0.99   93  327  235  469  235    0    0  488  A9X172     Coagulation factor X (Predicted) OS=Papio anubis GN=F10 PE=3 SV=1
   20 : F6SHG6_MACMU        0.96  0.99    1   91   89  179   91    0    0  487  F6SHG6     Uncharacterized protein OS=Macaca mulatta GN=F10 PE=3 SV=1
   21 : F6SHG6_MACMU        0.96  0.99   93  327  235  468  235    1    1  487  F6SHG6     Uncharacterized protein OS=Macaca mulatta GN=F10 PE=3 SV=1
   22 : F7HM21_MACMU        0.96  0.99    1   91   89  179   91    0    0  474  F7HM21     Uncharacterized protein OS=Macaca mulatta GN=F10 PE=3 SV=1
   23 : F7HM21_MACMU        0.96  0.99   93  307  235  449  215    0    0  474  F7HM21     Uncharacterized protein OS=Macaca mulatta GN=F10 PE=3 SV=1
   24 : G7NJN2_MACMU        0.96  0.99    1   91   89  179   91    0    0  488  G7NJN2     Coagulation factor X OS=Macaca mulatta GN=EGK_09476 PE=3 SV=1
   25 : G7NJN2_MACMU        0.96  0.99   93  327  235  469  235    0    0  488  G7NJN2     Coagulation factor X OS=Macaca mulatta GN=EGK_09476 PE=3 SV=1
   26 : G7PVR7_MACFA        0.96  0.99   93  327  235  469  235    0    0  488  G7PVR7     Coagulation factor X OS=Macaca fascicularis GN=EGM_08638 PE=3 SV=1
   27 : I2CVN8_MACMU        0.96  0.99   93  327  235  469  235    0    0  488  I2CVN8     Coagulation factor X preproprotein OS=Macaca mulatta GN=F10 PE=2 SV=1
   28 : I2CVN8_MACMU        0.96  0.99    1   91   89  179   91    0    0  488  I2CVN8     Coagulation factor X preproprotein OS=Macaca mulatta GN=F10 PE=2 SV=1
   29 : B0KW84_CALJA        0.91  0.96    1   91   89  179   91    0    0  488  B0KW84     Coagulation factor X (Predicted) OS=Callithrix jacchus GN=F10 PE=2 SV=1
   30 : B0KW84_CALJA        0.91  0.98   93  327  235  469  235    0    0  488  B0KW84     Coagulation factor X (Predicted) OS=Callithrix jacchus GN=F10 PE=2 SV=1
   31 : B1MTD3_CALMO        0.91  0.97   93  327  235  469  235    0    0  488  B1MTD3     Coagulation factor X preproprotein (Predicted) OS=Callicebus moloch GN=F10 PE=3 SV=1
   32 : B1MTD3_CALMO        0.91  0.95    1   91   89  179   91    0    0  488  B1MTD3     Coagulation factor X preproprotein (Predicted) OS=Callicebus moloch GN=F10 PE=3 SV=1
   33 : B5SNI2_OTOGA        0.88  0.95   93  327  234  468  235    0    0  487  B5SNI2     Coagulation factor X preproprotein (Predicted) OS=Otolemur garnettii GN=F10 PE=4 SV=1
   34 : FA10_MOUSE          0.88  0.97   93  327  232  466  235    0    0  481  O88947     Coagulation factor X OS=Mus musculus GN=F10 PE=1 SV=1
   35 : Q3TBR2_MOUSE        0.88  0.97   93  327  232  466  235    0    0  481  Q3TBR2     Coagulation factor X OS=Mus musculus GN=F10 PE=2 SV=1
   36 : Q3TDB9_MOUSE        0.88  0.97   93  327  244  478  235    0    0  492  Q3TDB9     Putative uncharacterized protein (Fragment) OS=Mus musculus GN=F10 PE=2 SV=1
   37 : Q3U3V1_MOUSE        0.88  0.97   93  327  244  478  235    0    0  493  Q3U3V1     Coagulation factor X OS=Mus musculus GN=F10 PE=2 SV=1
   38 : Q4FJS7_MOUSE        0.88  0.97   93  327  232  466  235    0    0  481  Q4FJS7     F10 protein OS=Mus musculus GN=F10 PE=2 SV=1
   39 : G3TXA1_LOXAF        0.87  0.96   93  327  235  469  235    0    0  477  G3TXA1     Uncharacterized protein OS=Loxodonta africana GN=F10 PE=3 SV=1
   40 : F1Q4A3_CANFA        0.86  0.95   93  327  252  486  235    0    0  497  F1Q4A3     Uncharacterized protein (Fragment) OS=Canis familiaris GN=F10 PE=3 SV=2
   41 : F6TDH5_HORSE        0.86  0.97   93  327  241  475  235    0    0  481  F6TDH5     Uncharacterized protein (Fragment) OS=Equus caballus GN=F10 PE=3 SV=1
   42 : FA10_RAT            0.86  0.95   93  327  232  467  236    1    1  482  Q63207     Coagulation factor X OS=Rattus norvegicus GN=F10 PE=2 SV=1
   43 : G1U6I7_RABIT        0.86  0.94   93  327  303  537  235    0    0  560  G1U6I7     Coagulation factor X OS=Oryctolagus cuniculus GN=F10 PE=3 SV=2
   44 : I3N821_SPETR        0.86  0.95   93  327  234  468  235    0    0  483  I3N821     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=F10 PE=3 SV=1
   45 : L5KUM3_PTEAL        0.86  0.94   93  327   39  273  235    0    0  288  L5KUM3     Coagulation factor X OS=Pteropus alecto GN=PAL_GLEAN10013698 PE=3 SV=1
   46 : FA10_RABIT          0.85  0.94   93  327  233  467  235    0    0  490  O19045     Coagulation factor X OS=Oryctolagus cuniculus GN=F10 PE=2 SV=1
   47 : M3WKC7_FELCA        0.85  0.94   93  327  247  481  235    0    0  483  M3WKC7     Uncharacterized protein (Fragment) OS=Felis catus GN=F10 PE=3 SV=1
   48 : FA10_BOVIN  1IOD    0.84  0.93   93  327  234  468  235    0    0  492  P00743     Coagulation factor X OS=Bos taurus GN=F10 PE=1 SV=1
   49 : Q3MHW2_BOVIN        0.84  0.93   93  327  225  459  235    0    0  483  Q3MHW2     F10 protein (Fragment) OS=Bos taurus GN=F10 PE=2 SV=1
   50 : D2I5N8_AILME        0.83  0.93   93  327  215  449  235    0    0  450  D2I5N8     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_021023 PE=3 SV=1
   51 : F1RN41_PIG          0.83  0.94   93  327  235  469  235    0    0  479  F1RN41     Uncharacterized protein OS=Sus scrofa GN=F10 PE=3 SV=1
   52 : G1LUQ6_AILME        0.83  0.93   93  327  250  484  235    0    0  499  G1LUQ6     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=F10 PE=3 SV=1
   53 : B5SNI2_OTOGA        0.82  0.91    1   91   89  179   91    0    0  487  B5SNI2     Coagulation factor X preproprotein (Predicted) OS=Otolemur garnettii GN=F10 PE=4 SV=1
   54 : F1RN41_PIG          0.82  0.92    1   91   89  179   91    0    0  479  F1RN41     Uncharacterized protein OS=Sus scrofa GN=F10 PE=3 SV=1
   55 : Q19AZ6_PIG          0.82  0.92    1   91   89  179   91    0    0  479  Q19AZ6     Coagulation factor X protein OS=Sus scrofa PE=2 SV=1
   56 : Q19AZ6_PIG          0.82  0.94   93  327  235  469  235    0    0  479  Q19AZ6     Coagulation factor X protein OS=Sus scrofa PE=2 SV=1
   57 : S7QD05_MYOBR        0.82  0.92   93  325  128  360  233    0    0  424  S7QD05     Coagulation factor X OS=Myotis brandtii GN=D623_10030960 PE=3 SV=1
   58 : W5PD84_SHEEP        0.82  0.92   93  326  241  474  234    0    0  509  W5PD84     Uncharacterized protein (Fragment) OS=Ovis aries GN=F10 PE=4 SV=1
   59 : G3TXA1_LOXAF        0.80  0.91    1   91   89  179   91    0    0  477  G3TXA1     Uncharacterized protein OS=Loxodonta africana GN=F10 PE=3 SV=1
   60 : H0V549_CAVPO        0.80  0.92   93  327  239  473  235    0    0  488  H0V549     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=F10 PE=3 SV=1
   61 : G1Q5N3_MYOLU        0.78  0.88    1   91   83  173   91    0    0  378  G1Q5N3     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
   62 : I3N821_SPETR        0.78  0.93    1   91   89  179   91    0    0  483  I3N821     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=F10 PE=3 SV=1
   63 : D2I5N8_AILME        0.77  0.92    1   91   66  156   91    0    0  450  D2I5N8     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_021023 PE=3 SV=1
   64 : F1Q4A3_CANFA        0.77  0.90    1   91  101  191   91    0    0  497  F1Q4A3     Uncharacterized protein (Fragment) OS=Canis familiaris GN=F10 PE=3 SV=2
   65 : F6TDH5_HORSE        0.77  0.89    1   91   94  184   91    0    0  481  F6TDH5     Uncharacterized protein (Fragment) OS=Equus caballus GN=F10 PE=3 SV=1
   66 : G1LUQ6_AILME        0.77  0.92    1   91  101  191   91    0    0  499  G1LUQ6     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=F10 PE=3 SV=1
   67 : L7N1Q3_MYOLU        0.77  0.89   96  325  238  467  230    0    0  487  L7N1Q3     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
   68 : D3Z215_MOUSE        0.76  0.88    1   91   89  179   91    0    0  321  D3Z215     Coagulation factor X OS=Mus musculus GN=F10 PE=2 SV=1
   69 : D3Z521_MOUSE        0.76  0.88    1   91   89  179   91    0    0  319  D3Z521     Coagulation factor X OS=Mus musculus GN=F10 PE=2 SV=1
   70 : FA10_MOUSE          0.76  0.88    1   91   89  179   91    0    0  481  O88947     Coagulation factor X OS=Mus musculus GN=F10 PE=1 SV=1
   71 : FA10_RAT            0.76  0.89    1   91   89  179   91    0    0  482  Q63207     Coagulation factor X OS=Rattus norvegicus GN=F10 PE=2 SV=1
   72 : G1QAT0_MYOLU        0.76  0.87    1   89   89  177   89    0    0  286  G1QAT0     Uncharacterized protein OS=Myotis lucifugus PE=4 SV=1
   73 : M3WKC7_FELCA        0.76  0.88    1   91   98  188   91    0    0  483  M3WKC7     Uncharacterized protein (Fragment) OS=Felis catus GN=F10 PE=3 SV=1
   74 : Q3TBR2_MOUSE        0.76  0.88    1   91   89  179   91    0    0  481  Q3TBR2     Coagulation factor X OS=Mus musculus GN=F10 PE=2 SV=1
   75 : Q3TDB9_MOUSE        0.76  0.88    1   91  101  191   91    0    0  492  Q3TDB9     Putative uncharacterized protein (Fragment) OS=Mus musculus GN=F10 PE=2 SV=1
   76 : Q3U3V1_MOUSE        0.76  0.88    1   91  101  191   91    0    0  493  Q3U3V1     Coagulation factor X OS=Mus musculus GN=F10 PE=2 SV=1
   77 : Q4FJS7_MOUSE        0.76  0.88    1   91   89  179   91    0    0  481  Q4FJS7     F10 protein OS=Mus musculus GN=F10 PE=2 SV=1
   78 : Q80Y26_MOUSE        0.76  0.88    1   91  101  191   91    0    0  340  Q80Y26     F10 protein OS=Mus musculus GN=F10 PE=2 SV=1
   79 : G1U6I7_RABIT        0.75  0.90    1   91  159  249   91    0    0  560  G1U6I7     Coagulation factor X OS=Oryctolagus cuniculus GN=F10 PE=3 SV=2
   80 : M3YFR2_MUSPF        0.74  0.91    1   91   66  156   91    0    0  634  M3YFR2     Uncharacterized protein (Fragment) OS=Mustela putorius furo GN=F10 PE=3 SV=1
   81 : F7FYL8_ORNAN        0.73  0.89   93  327  231  466  236    1    1  492  F7FYL8     Uncharacterized protein OS=Ornithorhynchus anatinus GN=F10 PE=3 SV=1
   82 : FA10_RABIT          0.73  0.88    1   91   89  179   91    0    0  490  O19045     Coagulation factor X OS=Oryctolagus cuniculus GN=F10 PE=2 SV=1
   83 : Q9GMD9_ORNAN        0.73  0.89   93  327  231  466  236    1    1  469  Q9GMD9     Coagulation factor X OS=Ornithorhynchus anatinus PE=2 SV=1
   84 : G3WXN7_SARHA        0.71  0.87    1   91   89  179   91    0    0  474  G3WXN7     Uncharacterized protein OS=Sarcophilus harrisii GN=F10 PE=3 SV=1
   85 : G3WXN7_SARHA        0.71  0.87   93  327  237  471  235    0    0  474  G3WXN7     Uncharacterized protein OS=Sarcophilus harrisii GN=F10 PE=3 SV=1
   86 : G5AVW1_HETGA        0.71  0.86    1   91  223  313   91    0    0  620  G5AVW1     Coagulation factor X OS=Heterocephalus glaber GN=GW7_08588 PE=3 SV=1
   87 : H0V549_CAVPO        0.71  0.87    1   91   95  185   91    0    0  488  H0V549     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=F10 PE=3 SV=1
   88 : F7DSP2_MONDO        0.70  0.88    1   91  130  220   91    0    0  515  F7DSP2     Uncharacterized protein OS=Monodelphis domestica GN=F10 PE=3 SV=2
   89 : L5LII3_MYODS        0.70  0.80   93  325  151  349  233    1   34  369  L5LII3     Coagulation factor X OS=Myotis davidii GN=MDA_GLEAN10006801 PE=3 SV=1
   90 : S7Q6R4_MYOBR        0.70  0.85    1   91   86  175   91    1    1  630  S7Q6R4     Coagulation factor X OS=Myotis brandtii GN=D623_10030961 PE=3 SV=1
   91 : L7N1Q3_MYOLU        0.68  0.82    1   84   86  168   84    1    1  487  L7N1Q3     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=3 SV=1
   92 : F7FYL8_ORNAN        0.67  0.80    1   91   89  179   91    0    0  492  F7FYL8     Uncharacterized protein OS=Ornithorhynchus anatinus GN=F10 PE=3 SV=1
   93 : L5LKW8_MYODS        0.67  0.76   93  325   97  291  233    1   38  303  L5LKW8     Coagulation factor X OS=Myotis davidii GN=MDA_GLEAN10006803 PE=4 SV=1
   94 : Q9GMD9_ORNAN        0.66  0.80    1   91   89  179   91    0    0  469  Q9GMD9     Coagulation factor X OS=Ornithorhynchus anatinus PE=2 SV=1
   95 : FA10_BOVIN  1IOD    0.65  0.82    1   91   89  179   91    0    0  492  P00743     Coagulation factor X OS=Bos taurus GN=F10 PE=1 SV=1
   96 : G1NPS1_MELGA        0.65  0.82   93  327  218  452  235    0    0  452  G1NPS1     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100549606 PE=3 SV=1
   97 : Q3MHW2_BOVIN        0.65  0.82    1   91   80  170   91    0    0  483  Q3MHW2     F10 protein (Fragment) OS=Bos taurus GN=F10 PE=2 SV=1
   98 : S9XFE4_9CETA        0.64  0.75   93  327  234  445  237    4   27  467  S9XFE4     Coagulation factor X OS=Camelus ferus GN=CB1_000287035 PE=4 SV=1
   99 : H0ZFN5_TAEGU        0.63  0.79   93  324  217  448  233    2    2  448  H0ZFN5     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
  100 : H0ZFN9_TAEGU        0.62  0.81  107  320    1  214  214    0    0  214  H0ZFN9     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=F10 PE=3 SV=1
  101 : G5E3K0_9PIPI        0.61  0.80   93  325   94  322  233    2    4  325  G5E3K0     Putative coagulation factor 10 (Fragment) OS=Pipa carvalhoi PE=2 SV=1
  102 : K7GAU0_PELSI        0.57  0.71    1   91   92  182   91    0    0  488  K7GAU0     Uncharacterized protein OS=Pelodiscus sinensis GN=F10 PE=3 SV=1
  103 : Q6PAG2_XENLA        0.57  0.75    1   91   88  178   91    0    0  462  Q6PAG2     MGC68454 protein OS=Xenopus laevis GN=f10 PE=2 SV=1
  104 : T1RTT5_CARAU        0.56  0.74   93  286   17  210  194    0    0  210  T1RTT5     Coagulation factor X (Fragment) OS=Carassius auratus PE=2 SV=1
  105 : K4GL55_CALMI        0.55  0.78    1   87   90  174   87    1    2  468  K4GL55     F10 protein (Fragment) OS=Callorhynchus milii PE=2 SV=1
  106 : L9JAY1_TUPCH        0.55  0.72    1   91  182  263   92    4   11 1731  L9JAY1     Cullin-4A OS=Tupaia chinensis GN=TREES_T100021092 PE=3 SV=1
  107 : Q5FW21_XENTR        0.54  0.75    1   91   88  178   91    0    0  464  Q5FW21     MGC107878 protein OS=Xenopus tropicalis GN=f10 PE=2 SV=1
  108 : U3JP32_FICAL        0.54  0.76    1   91  114  207   94    2    3  499  U3JP32     Uncharacterized protein OS=Ficedula albicollis GN=F10 PE=3 SV=1
  109 : FAXD1_DEMVE         0.53  0.69    1   91   89  179   91    0    0  473  A6MFK7     Venom prothrombin activator vestarin-D1 OS=Demansia vestigiata PE=1 SV=1
  110 : F7DJ67_CALJA        0.52  0.69    1   88   96  182   89    2    3  461  F7DJ67     Uncharacterized protein OS=Callithrix jacchus GN=F9 PE=4 SV=1
  111 : H0WHD0_OTOGA        0.52  0.67    1   90   68  159   92    2    2  435  H0WHD0     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=F9 PE=3 SV=1
  112 : H0ZFN5_TAEGU        0.52  0.76    1   91   67  160   94    2    3  448  H0ZFN5     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
  113 : K4FTA0_CALMI        0.52  0.71    1   88   87  175   89    1    1  481  K4FTA0     Coagulation factor X OS=Callorhynchus milii PE=2 SV=1
  114 : FA10_CHICK          0.51  0.71    1   91   89  182   94    2    3  475  P25155     Coagulation factor X OS=Gallus gallus GN=F10 PE=1 SV=1
  115 : FAXD2_DEMVE         0.51  0.67    1   91   89  179   91    0    0  471  A6MFK8     Venom prothrombin activator vestarin-D2 OS=Demansia vestigiata PE=1 SV=1
  116 : G3SX39_LOXAF        0.51  0.68    1   90   96  184   91    2    3  462  G3SX39     Uncharacterized protein OS=Loxodonta africana GN=F9 PE=3 SV=1
  117 : G3W4I8_SARHA        0.51  0.69    1   89   89  176   90    2    3  453  G3W4I8     Uncharacterized protein OS=Sarcophilus harrisii GN=F9 PE=3 SV=1
  118 : M3ZVN6_XIPMA        0.51  0.75   94  325  113  343  233    2    3  367  M3ZVN6     Uncharacterized protein OS=Xiphophorus maculatus PE=4 SV=1
  119 : Q1RLV2_DANRE        0.51  0.66    1   87   91  178   88    1    1  507  Q1RLV2     Uncharacterized protein OS=Danio rerio GN=f9b PE=2 SV=1
  120 : V9KTG2_CALMI        0.51  0.70    7   89    1   84   84    1    1  389  V9KTG2     Coagulation factor X (Fragment) OS=Callorhynchus milii PE=2 SV=1
  121 : W5PLL0_SHEEP        0.51  0.70    1   89   96  183   90    2    3  441  W5PLL0     Coagulation factor IX OS=Ovis aries GN=F9 PE=4 SV=1
  122 : W5PLL2_SHEEP        0.51  0.70    1   89   96  183   90    2    3  462  W5PLL2     Coagulation factor IX OS=Ovis aries GN=F9 PE=4 SV=1
  123 : F2RM35_HUMAN        0.50  0.70    1   91   96  185   92    2    3  461  F2RM35     Serine protease (Precursor) OS=Homo sapiens GN=factor IX F9 PE=2 SV=1
  124 : F2RM37_HUMAN        0.50  0.70    1   91   96  185   92    2    3  461  F2RM37     Coagulation factor IX (Precursor) OS=Homo sapiens GN=F9 p22 PE=2 SV=1
  125 : F7GHR4_MACMU        0.50  0.68    1   91   96  185   92    2    3  461  F7GHR4     Uncharacterized protein OS=Macaca mulatta GN=F9 PE=3 SV=1
  126 : FA9_HUMAN   1IXA    0.50  0.70    1   91   96  185   92    2    3  461  P00740     Coagulation factor IX OS=Homo sapiens GN=F9 PE=1 SV=2
  127 : FA9_PANTR           0.50  0.70    1   91   96  185   92    2    3  461  Q95ND7     Coagulation factor IX OS=Pan troglodytes GN=F9 PE=2 SV=1
  128 : G1NPS1_MELGA        0.50  0.70    1   91   66  159   94    2    3  452  G1NPS1     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=LOC100549606 PE=3 SV=1
  129 : G1QRY9_NOMLE        0.50  0.70    1   91   96  185   92    2    3  461  G1QRY9     Uncharacterized protein OS=Nomascus leucogenys GN=F9 PE=3 SV=1
  130 : G3QEB7_GORGO        0.50  0.70    1   91   96  185   92    2    3  461  G3QEB7     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101128865 PE=3 SV=1
  131 : G3TV86_LOXAF        0.50  0.66    1   90   91  184   94    3    4  445  G3TV86     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=F9 PE=3 SV=1
  132 : G5BE76_HETGA        0.50  0.70    1   89   96  183   90    2    3  462  G5BE76     Coagulation factor IX OS=Heterocephalus glaber GN=GW7_05625 PE=3 SV=1
  133 : G7NRQ5_MACMU        0.50  0.68    1   91   96  185   92    2    3  461  G7NRQ5     Putative uncharacterized protein OS=Macaca mulatta GN=EGK_20999 PE=3 SV=1
  134 : G7Q1U2_MACFA        0.50  0.68    1   91   96  185   92    2    3  461  G7Q1U2     Putative uncharacterized protein OS=Macaca fascicularis GN=EGM_19249 PE=3 SV=1
  135 : H2R4I6_PANTR        0.50  0.70    1   91   68  157   92    2    3  433  H2R4I6     Coagulation factor IX (Fragment) OS=Pan troglodytes GN=F9 PE=3 SV=1
  136 : H2SXW9_TAKRU        0.50  0.67    1   89   86  173   90    2    3  423  H2SXW9     Uncharacterized protein OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  137 : H2SXX0_TAKRU        0.50  0.67    1   89   89  176   90    2    3  438  H2SXX0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  138 : H2SXX2_TAKRU        0.50  0.67    1   89   90  179   90    1    1  449  H2SXX2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  139 : L5JUP8_PTEAL        0.50  0.68    1   91   96  185   92    2    3  481  L5JUP8     Coagulation factor IX OS=Pteropus alecto GN=PAL_GLEAN10007722 PE=3 SV=1
  140 : Q95ND6_PANTR        0.50  0.70    1   91   96  185   92    2    3  461  Q95ND6     Coagulation factor XI OS=Pan troglodytes GN=F9 PE=3 SV=1
  141 : U3I5A6_ANAPL        0.50  0.73    1   91  101  194   94    2    3  485  U3I5A6     Uncharacterized protein (Fragment) OS=Anas platyrhynchos GN=F10 PE=3 SV=1
  142 : W5K1W8_ASTMX        0.50  0.66    1   87   91  178   88    1    1  495  W5K1W8     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  143 : A8CZ27_MACMU        0.49  0.68    1   91   96  185   92    2    3  461  A8CZ27     Coagulation factor IX protein OS=Macaca mulatta PE=2 SV=1
  144 : E7F301_DANRE        0.49  0.66    1   88   87  175   89    1    1  503  E7F301     Uncharacterized protein OS=Danio rerio GN=f9a PE=4 SV=2
  145 : F1MFL4_BOVIN        0.49  0.68    1   91   96  185   92    2    3  462  F1MFL4     Coagulation factor IX OS=Bos taurus GN=F9 PE=3 SV=1
  146 : F6RFT9_HORSE        0.49  0.71    1   91   96  185   92    2    3  457  F6RFT9     Uncharacterized protein OS=Equus caballus GN=F9 PE=3 SV=1
  147 : FA101_PSETE         0.49  0.71    1   91   89  179   91    0    0  483  Q1L659     Coagulation factor X isoform 1 OS=Pseudonaja textilis GN=F10 PE=2 SV=1
  148 : FA102_PSETE         0.49  0.73    1   91   89  179   91    0    0  463  Q1L658     Coagulation factor X isoform 2 OS=Pseudonaja textilis GN=F10 PE=2 SV=1
  149 : FA9_BOVIN   1J34    0.49  0.68    1   91   50  139   92    2    3  416  P00741     Coagulation factor IX (Fragment) OS=Bos taurus GN=F9 PE=1 SV=1
  150 : FA9_FELCA           0.49  0.68    1   91   96  185   92    2    3  466  Q6SA95     Coagulation factor IX OS=Felis catus GN=F9 PE=3 SV=1
  151 : FAXC_OXYMI          0.49  0.71    1   91   89  179   91    0    0  467  Q58L95     Omicarin-C catalytic subunit OS=Oxyuranus microlepidotus PE=2 SV=1
  152 : FAXC_OXYSU          0.49  0.71    1   91   89  179   91    0    0  467  Q58L96     Oscutarin-C catalytic subunit OS=Oxyuranus scutellatus PE=1 SV=1
  153 : FAXC_PSETE          0.49  0.71    1   91   89  179   91    0    0  467  Q56VR3     Venom prothrombin activator pseutarin-C catalytic subunit OS=Pseudonaja textilis PE=1 SV=2
  154 : G1KG10_ANOCA        0.49  0.76    1   91   89  179   91    0    0  483  G1KG10     Uncharacterized protein OS=Anolis carolinensis GN=F10 PE=3 SV=2
  155 : G1PHP1_MYOLU        0.49  0.68    1   90   96  184   91    2    3  462  G1PHP1     Uncharacterized protein OS=Myotis lucifugus GN=F9 PE=3 SV=1
  156 : G1U9U2_RABIT        0.49  0.72    1   91   96  185   92    2    3  462  G1U9U2     Coagulation factor IX OS=Oryctolagus cuniculus GN=F9 PE=3 SV=1
  157 : H2PWY7_PONAB        0.49  0.68    1   91   96  185   92    2    3  461  H2PWY7     Uncharacterized protein OS=Pongo abelii GN=F9 PE=3 SV=1
  158 : H2SXW7_TAKRU        0.49  0.66    1   89   90  179   91    3    3  479  H2SXW7     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  159 : H2SXW8_TAKRU        0.49  0.66    1   89   97  184   91    4    5  463  H2SXW8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  160 : H2SXX1_TAKRU        0.49  0.66    1   89   95  184   91    3    3  500  H2SXX1     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  161 : H2SXX3_TAKRU        0.49  0.66    1   89   89  178   91    3    3  483  H2SXX3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101068927 PE=3 SV=1
  162 : H3ARD0_LATCH        0.49  0.73    1   87   96  183   88    1    1  453  H3ARD0     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
  163 : I3MG53_SPETR        0.49  0.67    1   91   96  185   92    2    3  464  I3MG53     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=F9 PE=3 SV=1
  164 : K7RW47_OXYMI        0.49  0.71    1   91   65  155   91    0    0  443  K7RW47     Prothrombin activator (Fragment) OS=Oxyuranus microlepidotus PE=3 SV=1
  165 : L8IH10_9CETA        0.49  0.68    1   91   96  185   92    2    3  462  L8IH10     Coagulation factor IX OS=Bos mutus GN=M91_15720 PE=3 SV=1
  166 : M3XGM1_LATCH        0.49  0.73    1   87   89  176   88    1    1  451  M3XGM1     Uncharacterized protein OS=Latimeria chalumnae PE=3 SV=1
  167 : M3ZDZ0_XIPMA        0.49  0.65    1   90   99  188   91    2    2  544  M3ZDZ0     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
  168 : Q6IT10_PSETT4BXS    0.49  0.73    1   91   89  179   91    0    0  463  Q6IT10     Factor X-like protease OS=Pseudonaja textilis textilis PE=1 SV=1
  169 : S7NGX9_MYOBR        0.49  0.68    1   90   89  177   91    2    3  455  S7NGX9     Coagulation factor IX OS=Myotis brandtii GN=D623_10016643 PE=3 SV=1
  170 : U3ISB8_ANAPL        0.49  0.72    1   88   94  180   90    3    5  293  U3ISB8     Uncharacterized protein (Fragment) OS=Anas platyrhynchos PE=3 SV=1
  171 : W5NDF1_LEPOC        0.49  0.70    1   90   97  187   92    3    3  473  W5NDF1     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=4 SV=1
  172 : A0JLY3_MOUSE        0.48  0.70    1   90   95  183   91    2    3  470  A0JLY3     F9 protein (Fragment) OS=Mus musculus GN=F9 PE=2 SV=1
  173 : A4VCE8_XENLA        0.48  0.72    1   88   89  177   89    1    1  461  A4VCE8     LOC100049721 protein OS=Xenopus laevis GN=f9 PE=2 SV=1
  174 : D2HEC6_AILME        0.48  0.66    1   91   68  157   92    2    3  431  D2HEC6     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_009140 PE=3 SV=1
  175 : F7ABW7_HORSE        0.48  0.62    1   89   89  180   92    2    3  446  F7ABW7     Uncharacterized protein OS=Equus caballus GN=F7 PE=3 SV=1
  176 : FA9_CANFA           0.48  0.68    1   91   89  178   92    2    3  452  P19540     Coagulation factor IX OS=Canis familiaris GN=F9 PE=1 SV=1
  177 : FA9_MOUSE           0.48  0.70    1   90   96  184   91    2    3  471  P16294     Coagulation factor IX OS=Mus musculus GN=F9 PE=2 SV=3
  178 : G1K2D7_CANFA        0.48  0.68    1   91   96  185   92    2    3  459  G1K2D7     Coagulation factor IX (Fragment) OS=Canis familiaris GN=F9 PE=3 SV=1
  179 : G3PS22_GASAC        0.48  0.65   93  322   19  249  232    2    3  264  G3PS22     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  180 : K4FY05_CALMI        0.48  0.70    1   87   90  174   87    1    2  474  K4FY05     F10 protein OS=Callorhynchus milii PE=2 SV=1
  181 : Q5M8Y0_XENTR        0.48  0.74    1   88   89  177   89    1    1  463  Q5M8Y0     Coagulation factor 9 OS=Xenopus tropicalis GN=f9 PE=2 SV=1
  182 : R0JLH6_ANAPL        0.48  0.72    1   88   69  155   89    2    3  268  R0JLH6     Coagulation factor IX (Fragment) OS=Anas platyrhynchos GN=Anapl_05259 PE=3 SV=1
  183 : V8PHG1_OPHHA        0.48  0.71    1   91  502  592   91    0    0 1232  V8PHG1     Coagulation factor X isoform 1 (Fragment) OS=Ophiophagus hannah GN=F10 PE=4 SV=1
  184 : F1M1M6_RAT          0.47  0.69    1   90   89  177   91    2    3  462  F1M1M6     Coagulation factor IX OS=Rattus norvegicus GN=F9 PE=4 SV=2
  185 : F1RQ75_PIG          0.47  0.66    1   91   96  185   92    2    3  462  F1RQ75     Coagulation factor IX OS=Sus scrofa GN=F9 PE=3 SV=2
  186 : F6VQC9_MONDO        0.47  0.65    1   90   89  177   91    2    3  455  F6VQC9     Uncharacterized protein OS=Monodelphis domestica GN=F9 PE=3 SV=2
  187 : FA10_TROCA          0.47  0.70    1   91   89  179   91    0    0  483  Q4QXT9     Coagulation factor X OS=Tropidechis carinatus GN=F10 PE=2 SV=1
  188 : FA9_PIG     1X7A    0.47  0.66    1   91   51  140   92    2    3  409  P16293     Coagulation factor IX (Fragment) OS=Sus scrofa GN=F9 PE=1 SV=2
  189 : FAXD_PSEPO          0.47  0.68    1   91   89  179   91    0    0  454  Q58L93     Venom prothrombin activator porpharin-D OS=Pseudechis porphyriacus PE=2 SV=1
  190 : G1NPS2_MELGA        0.47  0.63    1   89   89  180   92    2    3  425  G1NPS2     Uncharacterized protein OS=Meleagris gallopavo GN=LOC100549606 PE=3 SV=1
  191 : H0VZY3_CAVPO        0.47  0.70    1   90   96  184   91    2    3  472  H0VZY3     Coagulation factor IX (Fragment) OS=Cavia porcellus GN=F9 PE=3 SV=1
  192 : H2ZV68_LATCH        0.47  0.74    1   90   86  175   90    0    0  475  H2ZV68     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
  193 : H3DHF7_TETNG        0.47  0.64    1   91   88  179   92    1    1  440  H3DHF7     Uncharacterized protein OS=Tetraodon nigroviridis PE=4 SV=1
  194 : H9GLB1_ANOCA        0.47  0.69    1   88   32  118   89    2    3  402  H9GLB1     Uncharacterized protein OS=Anolis carolinensis GN=F9 PE=3 SV=2
  195 : I3J3H4_ORENI        0.47  0.64    1   90   96  186   91    1    1  505  I3J3H4     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100704957 PE=3 SV=1
  196 : K7FZH5_PELSI        0.47  0.72    1   88   91  177   89    2    3  458  K7FZH5     Uncharacterized protein OS=Pelodiscus sinensis GN=F9 PE=3 SV=1
  197 : M3XRR0_MUSPF        0.47  0.68    1   91   96  185   92    2    3  459  M3XRR0     Uncharacterized protein OS=Mustela putorius furo GN=F9 PE=3 SV=1
  198 : M7BIA4_CHEMY        0.47  0.72    1   88   74  160   89    2    3  440  M7BIA4     Coagulation factor IX OS=Chelonia mydas GN=UY3_07322 PE=3 SV=1
  199 : R4G7L4_9SAUR        0.47  0.70    1   91   89  179   91    0    0  244  R4G7L4     FX-Sut-7 (Fragment) OS=Suta fasciata PE=2 SV=1
  200 : U6CMS8_NEOVI        0.47  0.68    1   91   96  185   92    2    3  459  U6CMS8     Coagulation factor IX OS=Neovison vison GN=FA9 PE=2 SV=1
  201 : W5UKN2_ICTPU        0.47  0.66    2   87   87  174   89    3    4  518  W5UKN2     Coagulation factor X OS=Ictalurus punctatus GN=F10 PE=2 SV=1
  202 : F1P2T9_CHICK        0.46  0.62    1   89   89  180   92    2    3  425  F1P2T9     Uncharacterized protein OS=Gallus gallus GN=F7 PE=3 SV=1
  203 : F6S689_ORNAN        0.46  0.68    1   90   91  179   91    2    3  471  F6S689     Uncharacterized protein OS=Ornithorhynchus anatinus GN=F9 PE=3 SV=1
  204 : FAXD_RHING          0.46  0.68    1   91   89  179   91    0    0  455  B5G6G5     Venom prothrombin activator nigrarin-D OS=Rhinoplocephalus nigrescens PE=2 SV=1
  205 : G1MCN7_AILME        0.46  0.63    1   91   96  188   95    4    6  462  G1MCN7     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=F9 PE=3 SV=1
  206 : G1PP05_MYOLU        0.46  0.60    1   89  115  206   92    2    3  472  G1PP05     Uncharacterized protein (Fragment) OS=Myotis lucifugus GN=F7 PE=3 SV=1
  207 : H2L6N4_ORYLA        0.46  0.63    2   91   74  163   92    2    4  476  H2L6N4     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101163720 PE=3 SV=1
  208 : Q804X7_CHICK        0.46  0.62    1   89   89  180   92    2    3  425  Q804X7     Coagulation factor VII OS=Gallus gallus GN=F7 PE=2 SV=1
  209 : U3I7N5_ANAPL        0.46  0.64    1   87   65  155   91    3    4  401  U3I7N5     Uncharacterized protein (Fragment) OS=Anas platyrhynchos GN=F7 PE=3 SV=1
  210 : V9LHL5_CALMI        0.46  0.60    1   89    7   98   92    2    3  178  V9LHL5     Vitamin K-dependent protein C-like protein (Fragment) OS=Callorhynchus milii PE=2 SV=1
  211 : B4DPM2_HUMAN        0.45  0.61    1   89   40  131   92    2    3  397  B4DPM2     cDNA FLJ55738, highly similar to Coagulation factor VII (EC 3.4.21.21) OS=Homo sapiens PE=2 SV=1
  212 : E3TDE7_9TELE        0.45  0.59    2   90   87  177   93    6    6  456  E3TDE7     Coagulation factor VII OS=Ictalurus furcatus GN=FA7 PE=2 SV=1
  213 : E3TF85_ICTPU        0.45  0.60    2   90   87  177   93    6    6  456  E3TF85     Coagulation factor VII OS=Ictalurus punctatus GN=FA7 PE=2 SV=1
  214 : F1NWP1_CHICK        0.45  0.72    1   88   89  175   89    2    3  471  F1NWP1     Coagulation factor IX OS=Gallus gallus GN=F9 PE=3 SV=1
  215 : F5H8B0_HUMAN        0.45  0.61    1   89   40  131   92    2    3  397  F5H8B0     Factor VII heavy chain OS=Homo sapiens GN=F7 PE=2 SV=1
  216 : F6T4X3_XENTR        0.45  0.60    1   89  107  198   92    2    3  448  F6T4X3     Uncharacterized protein OS=Xenopus tropicalis GN=f7 PE=3 SV=1
  217 : FA7_BOVIN           0.45  0.61    1   89   89  180   92    2    3  447  P22457     Coagulation factor VII OS=Bos taurus GN=F7 PE=1 SV=2
  218 : FA7_HUMAN   4JZE    0.45  0.61    1   89  109  200   92    2    3  466  P08709     Coagulation factor VII OS=Homo sapiens GN=F7 PE=1 SV=1
  219 : FA7_PANPA           0.45  0.62    1   89  109  200   92    2    3  466  Q2F9P4     Coagulation factor VII OS=Pan paniscus GN=F7 PE=3 SV=1
  220 : FA7_PANTR           0.45  0.62    1   89  109  200   92    2    3  466  Q2F9P2     Coagulation factor VII OS=Pan troglodytes GN=F7 PE=3 SV=1
  221 : FA9_CAVPO           0.45  0.68   93  319   59  285  229    3    4  285  P16295     Coagulation factor IX (Fragment) OS=Cavia porcellus GN=F9 PE=2 SV=1
  222 : FA9_CHICK           0.45  0.72    1   88   89  175   89    2    3  471  Q804X6     Coagulation factor IX OS=Gallus gallus GN=F9 PE=2 SV=1
  223 : FA9_RAT             0.45  0.69   93  319   56  282  229    3    4  282  P16296     Coagulation factor IX (Fragment) OS=Rattus norvegicus GN=F9 PE=2 SV=1
  224 : FAXD1_NOTSC         0.45  0.68    1   91   89  179   91    0    0  455  P82807     Venom prothrombin activator notecarin-D1 OS=Notechis scutatus scutatus PE=1 SV=2
  225 : FAXD2_NOTSC         0.45  0.66    1   91   89  179   91    0    0  453  Q58L94     Venom prothrombin activator notecarin-D2 OS=Notechis scutatus scutatus PE=1 SV=1
  226 : FAXD_HOPST          0.45  0.66    1   91   89  179   91    0    0  455  P83370     Venom prothrombin activator hopsarin-D OS=Hoplocephalus stephensii PE=1 SV=2
  227 : FAXD_TROCA          0.45  0.68    1   91   89  179   91    0    0  455  P81428     Venom prothrombin activator trocarin-D OS=Tropidechis carinatus PE=1 SV=2
  228 : G1MXL5_MELGA        0.45  0.71    1   88   89  175   89    2    3  472  G1MXL5     Uncharacterized protein OS=Meleagris gallopavo GN=F9 PE=3 SV=2
  229 : G1QI28_NOMLE        0.45  0.62    1   89  110  201   92    2    3  467  G1QI28     Uncharacterized protein OS=Nomascus leucogenys GN=F7 PE=3 SV=1
  230 : G3PS14_GASAC        0.45  0.65    2   89   67  159   94    5    7  402  G3PS14     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  231 : G3PS25_GASAC        0.45  0.65    2   89   88  180   94    5    7  440  G3PS25     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  232 : G3RDW8_GORGO        0.45  0.62    1   89  109  200   92    2    3  466  G3RDW8     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101136216 PE=3 SV=1
  233 : H0YVC1_TAEGU        0.45  0.66    1   88   88  173   89    3    4  465  H0YVC1     Uncharacterized protein OS=Taeniopygia guttata GN=F9 PE=3 SV=1
  234 : H2Q7T8_PANTR        0.45  0.62    1   89  109  200   92    2    3  466  H2Q7T8     Coagulation factor VII OS=Pan troglodytes GN=F7 PE=3 SV=1
  235 : I3JPK6_ORENI        0.45  0.58    1   90   97  186   92    4    4  528  I3JPK6     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100710669 PE=3 SV=1
  236 : K4FTA3_CALMI        0.45  0.60    1   90   87  179   93    3    3  422  K4FTA3     Vitamin K-dependent protein C-like protein OS=Callorhynchus milii PE=2 SV=1
  237 : K4GAZ1_CALMI        0.45  0.60    1   90   87  179   93    3    3  422  K4GAZ1     Vitamin K-dependent protein C-like protein OS=Callorhynchus milii PE=2 SV=1
  238 : K4GDU4_CALMI        0.45  0.60    1   90   68  160   93    3    3  403  K4GDU4     Vitamin K-dependent protein C-like protein OS=Callorhynchus milii PE=2 SV=1
  239 : K4GHX9_CALMI        0.45  0.60    1   90   87  179   93    3    3  422  K4GHX9     Vitamin K-dependent protein C-like protein OS=Callorhynchus milii PE=2 SV=1
  240 : L5LH02_MYODS        0.45  0.59    1   89   89  180   92    2    3  446  L5LH02     Coagulation factor VII OS=Myotis davidii GN=MDA_GLEAN10017027 PE=3 SV=1
  241 : L9JEU6_TUPCH        0.45  0.63    1   89   63  154   92    2    3  356  L9JEU6     Coagulation factor VII OS=Tupaia chinensis GN=TREES_T100021091 PE=3 SV=1
  242 : Q0V9B6_XENTR        0.45  0.60    1   89  111  202   92    2    3  452  Q0V9B6     Coagulation factor VII OS=Xenopus tropicalis GN=f7 PE=2 SV=1
  243 : Q2F9N4_PONPY        0.45  0.63    1   89   87  178   92    2    3  444  Q2F9N4     Cogulation factor VII (Fragment) OS=Pongo pygmaeus GN=F7 PE=3 SV=1
  244 : Q2F9N5_PONPY        0.45  0.63    1   89   87  178   92    2    3  444  Q2F9N5     Cogulation factor VII (Fragment) OS=Pongo pygmaeus GN=F7 PE=3 SV=1
  245 : R4FK22_9SAUR        0.45  0.66    1   91   89  179   91    0    0  280  R4FK22     FX-Hop-1 (Fragment) OS=Hoplocephalus bungaroides PE=2 SV=1
  246 : W5L9T4_ASTMX        0.45  0.61    2   90   90  180   93    6    6  464  W5L9T4     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  247 : B3XZY8_LAMJA        0.44  0.69    1   87   88  174   89    4    4  471  B3XZY8     Coagulation factor X-2 OS=Lampetra japonica GN=Factor X-2 PE=2 SV=1
  248 : C1FXS4_DASNO        0.44  0.60    1   88   89  179   91    2    3  448  C1FXS4     Coagulation factor VII (Predicted) OS=Dasypus novemcinctus GN=F7 PE=3 SV=1
  249 : F1QPL4_DANRE        0.44  0.61    2   91   88  179   94    5    6  443  F1QPL4     Uncharacterized protein OS=Danio rerio GN=f7i PE=4 SV=1
  250 : F1QUI0_DANRE        0.44  0.61    2   91   89  180   94    5    6  445  F1QUI0     Uncharacterized protein (Fragment) OS=Danio rerio GN=f7i PE=4 SV=1
  251 : F7FYM3_ORNAN        0.44  0.70    1   85   90  175   88    5    5  408  F7FYM3     Uncharacterized protein OS=Ornithorhynchus anatinus GN=PROZ PE=3 SV=1
  252 : FA7_RABIT           0.44  0.60    1   88   88  178   91    2    3  444  P98139     Coagulation factor VII OS=Oryctolagus cuniculus GN=F7 PE=1 SV=2
  253 : FA9_RABIT           0.44  0.69   93  319   49  275  229    3    4  275  P16292     Coagulation factor IX (Fragment) OS=Oryctolagus cuniculus GN=F9 PE=2 SV=1
  254 : FA9_SHEEP           0.44  0.66   93  316   49  272  226    3    4  274  P16291     Coagulation factor IX (Fragment) OS=Ovis aries GN=F9 PE=2 SV=1
  255 : G1U5G9_RABIT        0.44  0.60    1   88   12  102   91    2    3  368  G1U5G9     Coagulation factor VII (Fragment) OS=Oryctolagus cuniculus GN=F7 PE=3 SV=1
  256 : G3PYM9_GASAC        0.44  0.66    1   89   87  176   90    1    1  494  G3PYM9     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  257 : G3QAX5_GASAC        0.44  0.65    1   90   96  185   91    2    2  547  G3QAX5     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  258 : G3SX87_LOXAF        0.44  0.61    6   89   94  180   87    2    3  448  G3SX87     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=F7 PE=3 SV=1
  259 : H3C5I8_TETNG        0.44  0.64    1   90   92  181   91    2    2  532  H3C5I8     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
  260 : H3CLF2_TETNG        0.44  0.64    1   90   91  180   91    2    2  480  H3CLF2     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
  261 : Q4SVF9_TETNG        0.44  0.64    1   90   67  156   91    2    2  497  Q4SVF9     Chromosome 7 SCAF13760, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00012000001 PE=3 SV=1
  262 : Q8JHC9_DANRE        0.44  0.61    2   91   88  179   94    5    6  443  Q8JHC9     Coagulation factor VIIi OS=Danio rerio GN=f7i PE=2 SV=1
  263 : S4RYM8_PETMA        0.44  0.69    1   87   89  175   89    4    4  472  S4RYM8     Uncharacterized protein OS=Petromyzon marinus PE=3 SV=1
  264 : S9X985_9CETA        0.44  0.63    1   89  861  952   93    4    5 1218  S9X985     Uncharacterized protein OS=Camelus ferus GN=CB1_000287034 PE=3 SV=1
  265 : V9KVM8_CALMI        0.44  0.69    2   89   92  182   91    2    3  452  V9KVM8     Coagulation factor VII-like protein OS=Callorhynchus milii PE=2 SV=1
  266 : A0N0C5_MACMU        0.43  0.62    1   89  115  206   92    2    3  472  A0N0C5     Coagulation factor VII protein OS=Macaca mulatta PE=2 SV=2
  267 : A4FUL1_DANRE        0.43  0.61    2   91   88  179   94    5    6  444  A4FUL1     F7i protein OS=Danio rerio GN=f7i PE=2 SV=1
  268 : A9X171_PAPAN        0.43  0.62    1   89   87  178   92    2    3  444  A9X171     Coagulation factor VII (Predicted) OS=Papio anubis GN=F7 PE=3 SV=1
  269 : B5SNI1_OTOGA        0.43  0.61    1   89   87  178   92    2    3  444  B5SNI1     Coagulation factor VII isoform a (Predicted) OS=Otolemur garnettii GN=F7 PE=4 SV=1
  270 : F1Q9R2_DANRE        0.43  0.57    1   88   87  173   89    2    3  501  F1Q9R2     Uncharacterized protein OS=Danio rerio GN=f9a PE=3 SV=1
  271 : F1RN40_PIG          0.43  0.62    1   89   87  178   92    2    3  445  F1RN40     Uncharacterized protein OS=Sus scrofa GN=F7 PE=3 SV=2
  272 : F7FNL1_CALJA        0.43  0.61    1   89   39  130   92    2    3  396  F7FNL1     Uncharacterized protein OS=Callithrix jacchus GN=F7 PE=3 SV=1
  273 : F7FP08_CALJA        0.43  0.61    1   89  116  207   92    2    3  473  F7FP08     Uncharacterized protein OS=Callithrix jacchus GN=F7 PE=3 SV=1
  274 : F7FP19_CALJA        0.43  0.61    1   89  109  200   92    2    3  466  F7FP19     Uncharacterized protein OS=Callithrix jacchus GN=F7 PE=3 SV=1
  275 : F7FP26_CALJA        0.43  0.61    1   89   87  178   92    2    3  444  F7FP26     Uncharacterized protein OS=Callithrix jacchus GN=F7 PE=3 SV=1
  276 : F7HK40_MACMU        0.43  0.62    1   89   84  175   92    2    3  441  F7HK40     Uncharacterized protein OS=Macaca mulatta GN=F7 PE=3 SV=1
  277 : G1Q886_MYOLU        0.43  0.68    2   85   51  134   84    0    0  360  G1Q886     Uncharacterized protein (Fragment) OS=Myotis lucifugus GN=PROZ PE=3 SV=1
  278 : G3PYM1_GASAC        0.43  0.64    1   89   66  157   92    2    3  425  G3PYM1     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  279 : H2S877_TAKRU        0.43  0.62   93  327   33  269  239    4    6  269  H2S877     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  280 : H2S878_TAKRU        0.43  0.62   93  327   24  260  238    3    4  260  H2S878     Uncharacterized protein OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  281 : H2SDJ5_TAKRU        0.43  0.67    2   91   85  174   90    0    0  465  H2SDJ5     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f10 PE=3 SV=1
  282 : H2SDJ6_TAKRU        0.43  0.67    2   91  100  189   90    0    0  440  H2SDJ6     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f10 PE=3 SV=1
  283 : H2SDJ7_TAKRU        0.43  0.67    2   91   91  180   90    0    0  464  H2SDJ7     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f10 PE=3 SV=1
  284 : H2SDJ9_TAKRU        0.43  0.67    2   91   95  184   90    0    0  475  H2SDJ9     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f10 PE=3 SV=1
  285 : H2SDK0_TAKRU        0.43  0.67    2   91   92  181   90    0    0  481  H2SDK0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f10 PE=3 SV=1
  286 : H2SDK1_TAKRU        0.43  0.67    2   91   82  171   90    0    0  455  H2SDK1     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f10 PE=3 SV=1
  287 : H2SDK2_TAKRU        0.43  0.67    2   91   90  179   90    0    0  470  H2SDK2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f10 PE=3 SV=1
  288 : H2SDK3_TAKRU        0.43  0.67    2   91   84  173   90    0    0  467  H2SDK3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f10 PE=3 SV=1
  289 : H2SDK4_TAKRU        0.43  0.67    2   91   87  176   90    0    0  460  H2SDK4     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f10 PE=3 SV=1
  290 : H2ZX40_LATCH        0.43  0.65    1   89   98  189   92    2    3  439  H2ZX40     Uncharacterized protein OS=Latimeria chalumnae PE=3 SV=2
  291 : H3B6B5_LATCH        0.43  0.66    2   85   77  161   87    5    5  444  H3B6B5     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
  292 : Q19AZ7_PIG          0.43  0.62    1   89   87  178   92    2    3  445  Q19AZ7     Coagulation factor VII isoform b protein OS=Sus scrofa PE=2 SV=1
  293 : Q4SB50_TETNG        0.43  0.64  115  324    1  209  210    1    1  211  Q4SB50     Chromosome undetermined SCAF14677, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00021131001 PE=3 SV=1
  294 : Q504J5_DANRE        0.43  0.61    2   91   89  180   94    5    6  445  Q504J5     F7i protein (Fragment) OS=Danio rerio GN=f7i PE=2 SV=1
  295 : Q804W9_TAKRU        0.43  0.67    2   91   74  163   90    0    0  475  Q804W9     Coagulation factor X OS=Takifugu rubripes GN=F10 PE=2 SV=1
  296 : S4RD89_PETMA        0.43  0.71    1   90   92  180   90    1    1  470  S4RD89     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
  297 : U3IWA9_ANAPL        0.43  0.60    2   85   67  151   87    5    5  467  U3IWA9     Uncharacterized protein (Fragment) OS=Anas platyrhynchos PE=4 SV=1
  298 : U3JP47_FICAL        0.43  0.62    1   89   89  180   92    2    3  425  U3JP47     Uncharacterized protein OS=Ficedula albicollis GN=F7 PE=3 SV=1
  299 : W5JXI5_ASTMX        0.43  0.63    2   90   94  182   90    2    2  510  W5JXI5     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  300 : W5MRK0_LEPOC        0.43  0.60    2   86   97  182   88    5    5  476  W5MRK0     Uncharacterized protein OS=Lepisosteus oculatus PE=4 SV=1
  301 : W5MS84_LEPOC        0.43  0.63    1   91   87  179   94    4    4  436  W5MS84     Uncharacterized protein OS=Lepisosteus oculatus PE=4 SV=1
  302 : B3XZY7_LAMJA        0.42  0.71    1   90   93  181   90    1    1  478  B3XZY7     Coagulation factor X-1 (Fragment) OS=Lampetra japonica GN=Factor X-1 PE=2 SV=1
  303 : D2I5N9_AILME        0.42  0.65    1   89   81  172   92    2    3  438  D2I5N9     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_021024 PE=3 SV=1
  304 : F1C799_PERFV        0.42  0.62    2   91   26  115   90    0    0  430  F1C799     Coagulation factor x (Fragment) OS=Perca flavescens GN=F10 PE=2 SV=1
  305 : FA7_MOUSE           0.42  0.62    1   89   90  181   92    2    3  446  P70375     Coagulation factor VII OS=Mus musculus GN=F7 PE=1 SV=1
  306 : G1KY08_ANOCA        0.42  0.60    1   89   89  180   92    2    3  426  G1KY08     Uncharacterized protein OS=Anolis carolinensis GN=F7 PE=3 SV=2
  307 : G1LUS2_AILME        0.42  0.65    1   89  117  208   92    2    3  474  G1LUS2     Uncharacterized protein OS=Ailuropoda melanoleuca GN=F7 PE=3 SV=1
  308 : G3HB48_CRIGR        0.42  0.65  116  325    1  200  210    2   10  202  G3HB48     Coagulation factor IX (Fragment) OS=Cricetulus griseus GN=I79_007664 PE=4 SV=1
  309 : G3WY11_SARHA        0.42  0.63    1   89   89  180   92    2    3  447  G3WY11     Uncharacterized protein OS=Sarcophilus harrisii GN=F7 PE=3 SV=1
  310 : G3WY12_SARHA        0.42  0.63    1   89   89  180   92    2    3  434  G3WY12     Uncharacterized protein OS=Sarcophilus harrisii GN=F7 PE=3 SV=1
  311 : H2T090_TAKRU        0.42  0.60    1   91   95  183   92    3    4  498  H2T090     Uncharacterized protein OS=Takifugu rubripes GN=f9 PE=3 SV=1
  312 : H2T091_TAKRU        0.42  0.63    1   90   90  179   91    2    2  509  H2T091     Uncharacterized protein OS=Takifugu rubripes GN=f9 PE=3 SV=1
  313 : H2T092_TAKRU        0.42  0.63    1   90   95  184   91    2    2  486  H2T092     Uncharacterized protein OS=Takifugu rubripes GN=f9 PE=3 SV=1
  314 : H2T093_TAKRU        0.42  0.63    1   90   95  184   91    2    2  482  H2T093     Uncharacterized protein OS=Takifugu rubripes GN=f9 PE=3 SV=1
  315 : H2T094_TAKRU        0.42  0.63    1   90   88  177   91    2    2  507  H2T094     Uncharacterized protein OS=Takifugu rubripes GN=f9 PE=3 SV=1
  316 : H2T095_TAKRU        0.42  0.63    1   90   95  184   91    2    2  537  H2T095     Uncharacterized protein OS=Takifugu rubripes GN=f9 PE=3 SV=1
  317 : H2T096_TAKRU        0.42  0.63    1   90   95  184   91    2    2  490  H2T096     Uncharacterized protein OS=Takifugu rubripes GN=f9 PE=3 SV=1
  318 : H2T097_TAKRU        0.42  0.63    1   90   89  178   91    2    2  471  H2T097     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f9 PE=3 SV=1
  319 : H2T098_TAKRU        0.42  0.63    1   90   87  176   91    2    2  474  H2T098     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f9 PE=3 SV=1
  320 : L5LI76_MYODS        0.42  0.66    2   87   88  173   86    0    0  404  L5LI76     Vitamin K-dependent protein Z OS=Myotis davidii GN=MDA_GLEAN10006804 PE=3 SV=1
  321 : M3WKC6_FELCA        0.42  0.62    1   89  117  208   92    2    3  474  M3WKC6     Uncharacterized protein OS=Felis catus GN=F7 PE=3 SV=1
  322 : Q542C2_MOUSE        0.42  0.62    1   89   90  181   92    2    3  446  Q542C2     Coagulation factor VII, isoform CRA_b OS=Mus musculus GN=F7 PE=2 SV=1
  323 : Q5FVZ2_XENTR        0.42  0.62    1   89   97  187   92    3    4  456  Q5FVZ2     MGC107972 protein OS=Xenopus tropicalis GN=proc PE=2 SV=1
  324 : Q804W8_TAKRU        0.42  0.63    1   90   95  184   91    2    2  537  Q804W8     Coagulation factor IX OS=Takifugu rubripes GN=F9 PE=2 SV=1
  325 : Q804X1_TAKRU        0.42  0.58    2   88   88  176   91    6    6  442  Q804X1     Coagulation factor VIIb OS=Takifugu rubripes PE=2 SV=1
  326 : S9XFE4_9CETA        0.42  0.57    1   88   56  142   93    6   11  467  S9XFE4     Coagulation factor X OS=Camelus ferus GN=CB1_000287035 PE=4 SV=1
  327 : U3IX11_ANAPL        0.42  0.61   93  324   18  252  236    4    5  260  U3IX11     Uncharacterized protein (Fragment) OS=Anas platyrhynchos GN=PROC PE=3 SV=1
  328 : W5MU78_LEPOC        0.42  0.65    1   89   89  179   92    3    4  442  W5MU78     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=4 SV=1
  329 : W5PD49_SHEEP        0.42  0.59    1   89   87  178   92    3    3  292  W5PD49     Uncharacterized protein OS=Ovis aries GN=F7 PE=4 SV=1
  330 : A8KC28_DANRE        0.41  0.61    1   91   88  180   94    4    4  434  A8KC28     Proc protein OS=Danio rerio GN=proca PE=2 SV=1
  331 : B2GRR3_DANRE        0.41  0.61    1   91   88  180   94    4    4  434  B2GRR3     Proc protein OS=Danio rerio GN=proc PE=2 SV=1
  332 : B8JLG2_DANRE        0.41  0.62    1   91   88  180   94    4    4  427  B8JLG2     Uncharacterized protein OS=Danio rerio GN=LOC798775 PE=3 SV=1
  333 : E1BT71_CHICK        0.41  0.61    1   87   89  175   88    2    2  407  E1BT71     Uncharacterized protein OS=Gallus gallus GN=PROZ PE=3 SV=1
  334 : F1Q4A4_CANFA        0.41  0.62    1   89   89  180   92    2    3  446  F1Q4A4     Uncharacterized protein OS=Canis familiaris GN=F7 PE=3 SV=2
  335 : F1R2A5_DANRE        0.41  0.61    1   91   88  180   94    4    4  434  F1R2A5     Uncharacterized protein OS=Danio rerio GN=proca PE=3 SV=1
  336 : G5AVW2_HETGA        0.41  0.65    1   89   94  185   92    2    3  450  G5AVW2     Coagulation factor VII OS=Heterocephalus glaber GN=GW7_08589 PE=3 SV=1
  337 : H3CM84_TETNG        0.41  0.55    2   91   86  180   96    6    7  282  H3CM84     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=4 SV=1
  338 : K9IK51_DESRO        0.41  0.59    1   89  102  193   92    2    3  459  K9IK51     Putative trypsin-like serine protease OS=Desmodus rotundus PE=2 SV=1
  339 : M3YG51_MUSPF        0.41  0.61    1   89   93  184   92    2    3  450  M3YG51     Uncharacterized protein OS=Mustela putorius furo GN=F7 PE=3 SV=1
  340 : M3ZVS8_XIPMA        0.41  0.59    2   88   88  173   90    6    7  693  M3ZVS8     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=3 SV=1
  341 : Q38J75_CANFA        0.41  0.62    1   89   89  180   92    2    3  446  Q38J75     Coagulation factor VII OS=Canis familiaris PE=2 SV=1
  342 : Q4SUA0_TETNG        0.41  0.55    2   91   92  186   96    6    7  379  Q4SUA0     Chromosome 3 SCAF13974, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00012560001 PE=4 SV=1
  343 : Q6GNA2_XENLA        0.41  0.59    1   89   91  182   92    2    3  432  Q6GNA2     MGC82927 protein OS=Xenopus laevis GN=f7 PE=2 SV=1
  344 : Q7T3B6_DANRE        0.41  0.61    1   91   88  180   94    4    4  434  Q7T3B6     Protein C (Inactivator of coagulation factors Va and VIIIa) OS=Danio rerio GN=proca PE=2 SV=1
  345 : W5MRI7_LEPOC        0.41  0.64    1   91   87  179   94    4    4  435  W5MRI7     Uncharacterized protein OS=Lepisosteus oculatus PE=4 SV=1
  346 : A5PLD4_DANRE        0.40  0.59    1   90   95  184   91    2    2  398  A5PLD4     LOC558106 protein (Fragment) OS=Danio rerio GN=prozb PE=2 SV=1
  347 : A9X173_PAPAN        0.40  0.62    2   91   91  180   90    0    0  400  A9X173     Protein Z, vitamin K-dependent plasma glycoprotein (Predicted) OS=Papio anubis GN=PROZ PE=3 SV=1
  348 : B0YJC6_HUMAN        0.40  0.63    2   91  112  201   90    0    0  421  B0YJC6     Vitamin K-dependent protein Z variant 1 OS=Homo sapiens GN=PROZ PE=2 SV=1
  349 : F1QZU6_DANRE        0.40  0.59    1   90   92  181   91    2    2  395  F1QZU6     Uncharacterized protein OS=Danio rerio GN=si:zfos-1962a1.5 PE=3 SV=2
  350 : F6SAZ0_MACMU        0.40  0.63    2   91   91  180   90    0    0  400  F6SAZ0     Uncharacterized protein OS=Macaca mulatta GN=PROZ PE=3 SV=1
  351 : F6SB17_MACMU        0.40  0.63    2   91  115  204   90    0    0  424  F6SB17     Uncharacterized protein OS=Macaca mulatta GN=PROZ PE=4 SV=1
  352 : F7D6Z7_MONDO        0.40  0.58    1   89   89  180   92    2    3  442  F7D6Z7     Uncharacterized protein OS=Monodelphis domestica GN=F7 PE=3 SV=2
  353 : F8W4J1_DANRE        0.40  0.57   93  327   35  256  235    4   13  256  F8W4J1     Uncharacterized protein OS=Danio rerio GN=si:ch73-103b2.3 PE=3 SV=1
  354 : FA7_RAT             0.40  0.60    1   89   90  181   92    2    3  446  Q8K3U6     Coagulation factor VII OS=Rattus norvegicus GN=F7 PE=2 SV=1
  355 : G1K8D2_ANOCA        0.40  0.64    1   87   89  175   88    2    2  406  G1K8D2     Uncharacterized protein OS=Anolis carolinensis GN=PROZ PE=3 SV=2
  356 : G1QI89_NOMLE        0.40  0.63    2   91  113  202   90    0    0  422  G1QI89     Uncharacterized protein OS=Nomascus leucogenys GN=PROZ PE=3 SV=1
  357 : G3QDS4_GORGO        0.40  0.63    2   91  113  202   90    0    0  422  G3QDS4     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101136586 PE=3 SV=1
  358 : G3SHG4_GORGO        0.40  0.63    2   91   92  181   90    0    0  401  G3SHG4     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101136586 PE=3 SV=1
  359 : G3TZX1_LOXAF        0.40  0.64    1   85   69  153   85    0    0  377  G3TZX1     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=PROZ PE=3 SV=1
  360 : G7PVR8_MACFA        0.40  0.63    2   91  115  204   90    0    0  424  G7PVR8     Vitamin K-dependent protein Z OS=Macaca fascicularis GN=EGM_08639 PE=3 SV=1
  361 : H0V548_CAVPO        0.40  0.62    1   89   89  180   92    2    3  445  H0V548     Uncharacterized protein OS=Cavia porcellus GN=F7 PE=3 SV=1
  362 : H2NKD6_PONAB        0.40  0.63    2   91   91  180   90    0    0  335  H2NKD6     Uncharacterized protein OS=Pongo abelii GN=PROZ PE=3 SV=2
  363 : H2Q7U0_PANTR        0.40  0.63    2   91  113  202   90    0    0  422  H2Q7U0     Uncharacterized protein OS=Pan troglodytes GN=PROZ PE=3 SV=1
  364 : H2S874_TAKRU        0.40  0.55    2   87   87  177   92    6    7  421  H2S874     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  365 : H2S875_TAKRU        0.40  0.55    2   87   69  159   92    6    7  403  H2S875     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  366 : H2S879_TAKRU        0.40  0.55    2   87   88  178   92    6    7  441  H2S879     Uncharacterized protein OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  367 : H2SDJ8_TAKRU        0.40  0.58    2   91   92  182   92    3    3  467  H2SDJ8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=f10 PE=3 SV=1
  368 : H3CM83_TETNG        0.40  0.60    2   88   88  176   91    5    6  442  H3CM83     Uncharacterized protein OS=Tetraodon nigroviridis PE=4 SV=1
  369 : M3ZVT4_XIPMA        0.40  0.57    1   89   91  184   94    3    5  451  M3ZVT4     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
  370 : PROZ_HUMAN  3H5C    0.40  0.63    2   91   91  180   90    0    0  400  P22891     Vitamin K-dependent protein Z OS=Homo sapiens GN=PROZ PE=1 SV=2
  371 : Q4SUA1_TETNG        0.40  0.60    2   88   86  174   91    5    6  453  Q4SUA1     Chromosome 3 SCAF13974, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00012559001 PE=4 SV=1
  372 : Q804X2_TAKRU        0.40  0.57    2   87   88  178   92    6    7  441  Q804X2     Coagulation factor VII OS=Takifugu rubripes PE=2 SV=1
  373 : U3F8T6_MICFL        0.40  0.57    1   89   89  180   92    2    3  425  U3F8T6     Coagulation factor 7 OS=Micrurus fulvius PE=2 SV=1
  374 : U6DW05_NEOVI        0.40  0.65   93  327   23  264  243    3    9  276  U6DW05     Coagulation factor VII (Serum prothrombin conversion accelerator) (Fragment) OS=Neovison vison GN=F5H8B0 PE=2 SV=1
  375 : W5K694_ASTMX        0.40  0.54    1   86   88  175   90    5    6  492  W5K694     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  376 : W5L9S8_ASTMX        0.40  0.62    1   89   88  179   93    4    5  442  W5L9S8     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  377 : W5ULP8_ICTPU        0.40  0.58    1   86   88  175   89    3    4  490  W5ULP8     Coagulation factor X OS=Ictalurus punctatus GN=F10 PE=2 SV=1
  378 : A7RIT8_NEMVE        0.39  0.49    2   68    4   78   75    2    8   88  A7RIT8     Predicted protein OS=Nematostella vectensis GN=v1g83156 PE=4 SV=1
  379 : B2KI37_RHIFE        0.39  0.62    1   89   89  180   92    3    3  249  B2KI37     Coagulation factor VII (Predicted) (Fragment) OS=Rhinolophus ferrumequinum GN=F7 PE=3 SV=1
  380 : C0HAZ4_SALSA        0.39  0.51    1   87   99  186   89    3    3  434  C0HAZ4     Coagulation factor X OS=Salmo salar GN=FA10 PE=2 SV=1
  381 : E7FBA9_DANRE        0.39  0.56   93  327   21  242  235    4   13  242  E7FBA9     Trypsinogen 1b OS=Danio rerio GN=si:ch73-103b2.3 PE=2 SV=1
  382 : F8W3C3_DANRE        0.39  0.55   93  327   29  250  235    4   13  250  F8W3C3     Uncharacterized protein (Fragment) OS=Danio rerio GN=zgc:66382 PE=3 SV=1
  383 : G1KEL3_ANOCA        0.39  0.57    2   91   95  188   95    4    6  430  G1KEL3     Uncharacterized protein OS=Anolis carolinensis GN=PROC PE=3 SV=2
  384 : G1NPS0_MELGA        0.39  0.58    1   87   91  177   89    2    4  409  G1NPS0     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=PROZ PE=3 SV=2
  385 : G3PC46_GASAC        0.39  0.52    1   87   91  178   89    3    3  424  G3PC46     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  386 : G3PC61_GASAC        0.39  0.52    1   87   91  178   89    3    3  417  G3PC61     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  387 : G3VNT5_SARHA        0.39  0.53    2   90  111  201   93    6    6  460  G3VNT5     Uncharacterized protein OS=Sarcophilus harrisii GN=PROC PE=3 SV=1
  388 : H0VMC9_CAVPO        0.39  0.61    6   90  104  189   87    3    3  465  H0VMC9     Uncharacterized protein OS=Cavia porcellus GN=PROC PE=3 SV=1
  389 : H2L6K2_ORYLA        0.39  0.59    2   89   88  180   94    5    7  430  H2L6K2     Uncharacterized protein OS=Oryzias latipes GN=LOC101155013 PE=3 SV=1
  390 : H2UUW9_TAKRU        0.39  0.53    1   88   86  174   90    3    3  422  H2UUW9     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066031 PE=3 SV=1
  391 : H2UUX0_TAKRU        0.39  0.53    1   88   86  174   90    3    3  421  H2UUX0     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066031 PE=3 SV=1
  392 : H3D0U7_TETNG        0.39  0.60   93  325   14  252  240    4    8  256  H3D0U7     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  393 : I3KKE3_ORENI        0.39  0.49    1   87   85  171   88    2    2  420  I3KKE3     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100700322 PE=3 SV=1
  394 : K7G962_PELSI        0.39  0.66    1   86   90  175   87    2    2  410  K7G962     Uncharacterized protein OS=Pelodiscus sinensis GN=PROZ PE=3 SV=1
  395 : PROZ_MOUSE          0.39  0.61    2   91   91  180   90    0    0  399  Q9CQW3     Vitamin K-dependent protein Z OS=Mus musculus GN=Proz PE=1 SV=1
  396 : Q05CL2_MOUSE        0.39  0.61    2   91   21  110   90    0    0  329  Q05CL2     Proz protein OS=Mus musculus GN=Proz PE=2 SV=1
  397 : Q1M2L7_LEPDS        0.39  0.53   93  323   42  257  233    8   19  260  Q1M2L7     Allergen Lep d 3 OS=Lepidoglyphus destructor PE=2 SV=1
  398 : Q1M2M8_GLYDO        0.39  0.53   93  323   42  257  233    8   19  260  Q1M2M8     Gly d 3 OS=Glycyphagus domesticus PE=2 SV=1
  399 : Q7SY86_XENLA        0.39  0.57    1   89   97  187   92    4    4  455  Q7SY86     Proc-prov protein OS=Xenopus laevis GN=proc PE=2 SV=1
  400 : Q8CI01_MOUSE        0.39  0.61    2   91   91  180   90    0    0  241  Q8CI01     Protein Z, vitamin K-dependent plasma glycoprotein, isoform CRA_a OS=Mus musculus GN=Proz PE=2 SV=1
  401 : Q91004_GECGE        0.39  0.61  118  327    4  233  230    6   20  235  Q91004     Thrombin (Fragment) OS=Gecko gecko GN=thrombin PE=2 SV=1
  402 : S4RWF2_PETMA        0.39  0.56    2   86   69  162   94    3    9  266  S4RWF2     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=4 SV=1
  403 : T1J964_STRMM        0.39  0.56   93  323   34  267  241    7   17  269  T1J964     Uncharacterized protein OS=Strigamia maritima PE=3 SV=1
  404 : U3JKN6_FICAL        0.39  0.58    1   87   88  174   90    4    6  425  U3JKN6     Uncharacterized protein (Fragment) OS=Ficedula albicollis GN=PROZ PE=3 SV=1
  405 : A3RKG7_HUMAN        0.38  0.65   93  327   20  261  243    3    9  273  A3RKG7     Coagulation factor VII (Fragment) OS=Homo sapiens PE=2 SV=1
  406 : A7S9K6_NEMVE        0.38  0.53   93  327   27  261  238    3    6  261  A7S9K6     Predicted protein OS=Nematostella vectensis GN=v1g229711 PE=3 SV=1
  407 : B3M1Y7_DROAN        0.38  0.59  118  326   10  218  215    6   12  223  B3M1Y7     GF19924 OS=Drosophila ananassae GN=Dana\GF19924 PE=3 SV=1
  408 : B4NJM4_DROWI        0.38  0.59  118  326   10  218  215    6   12  223  B4NJM4     GK13880 OS=Drosophila willistoni GN=Dwil\GK13880 PE=3 SV=1
  409 : C3YQH0_BRAFL        0.38  0.58  110  324    1  219  224    5   14  227  C3YQH0     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_241809 PE=3 SV=1
  410 : C3ZES1_BRAFL        0.38  0.57  110  320    1  217  222    6   16  223  C3ZES1     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_209883 PE=3 SV=1
  411 : E3NYI2_9NEOP        0.38  0.55   93  323    1  221  234    7   16  224  E3NYI2     Fibrinolytic enzyme (Fragment) OS=Eupolyphaga sinensis PE=2 SV=1
  412 : F1QFP3_DANRE        0.38  0.56    1   89   87  179   94    5    6  433  F1QFP3     Uncharacterized protein OS=Danio rerio GN=f7 PE=3 SV=1
  413 : F4NCD9_PLEAT        0.38  0.58    1   91   92  182   92    2    2  453  F4NCD9     Coagulation factor X OS=Plecoglossus altivelis GN=Fx PE=2 SV=1
  414 : F6QXJ0_ORNAN        0.38  0.58    1   90   21  112   93    4    4  252  F6QXJ0     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PROC PE=3 SV=1
  415 : F6QXK3_ORNAN        0.38  0.58    1   90   10  101   93    4    4  286  F6QXK3     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PROC PE=3 SV=1
  416 : F7AEE9_MONDO        0.38  0.54    2   90  111  201   93    6    6  460  F7AEE9     Uncharacterized protein OS=Monodelphis domestica GN=PROC PE=3 SV=2
  417 : G3UCI6_LOXAF        0.38  0.62    1   85   90  176   87    1    2  409  G3UCI6     Uncharacterized protein OS=Loxodonta africana GN=PROZ PE=3 SV=1
  418 : G3XL84_CYPCA        0.38  0.54   93  327   21  242  235    4   13  242  G3XL84     Trypsin 1 OS=Cyprinus carpio GN=tryp1 PE=2 SV=1
  419 : G9B5E8_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5E8     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  420 : G9B5F3_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5F3     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  421 : G9B5F4_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5F4     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  422 : G9B5F5_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5F5     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  423 : G9B5F6_9NEOP        0.38  0.55   93  323   31  251  237   12   22  254  G9B5F6     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  424 : G9B5F7_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5F7     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  425 : G9B5G0_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5G0     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  426 : G9B5G4_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5G4     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  427 : G9B5G5_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5G5     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  428 : G9B5G8_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5G8     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  429 : G9B5H4_9NEOP        0.38  0.54   93  323   31  251  237   12   22  254  G9B5H4     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  430 : H0ZAX9_TAEGU        0.38  0.54    1   84   74  156   87    5    7  422  H0ZAX9     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=PROC PE=3 SV=1
  431 : H2L6H4_ORYLA        0.38  0.60    1   86   97  185   89    3    3  430  H2L6H4     Uncharacterized protein OS=Oryzias latipes GN=F7 (1 of 2) PE=3 SV=1
  432 : H2S871_TAKRU        0.38  0.58    1   87   88  177   90    3    3  437  H2S871     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  433 : H2S872_TAKRU        0.38  0.58    1   89   97  188   92    3    3  455  H2S872     Uncharacterized protein OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  434 : H2S873_TAKRU        0.38  0.57    1   87   95  186   92    4    5  430  H2S873     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  435 : H2S876_TAKRU        0.38  0.56    2   87   67  153   89    5    5  397  H2S876     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC446072 PE=3 SV=1
  436 : H2UUW2_TAKRU        0.38  0.52    1   88   86  177   93    5    6  437  H2UUW2     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066031 PE=3 SV=1
  437 : H2UUW3_TAKRU        0.38  0.52    1   88   86  177   93    5    6  436  H2UUW3     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066031 PE=3 SV=1
  438 : H2UUW4_TAKRU        0.38  0.52    1   88   86  177   93    5    6  437  H2UUW4     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066031 PE=3 SV=1
  439 : H2UUW6_TAKRU        0.38  0.52    1   88   86  177   93    5    6  435  H2UUW6     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066031 PE=3 SV=1
  440 : H2UUW7_TAKRU        0.38  0.52    1   88   86  177   93    5    6  439  H2UUW7     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066031 PE=3 SV=1
  441 : H2UUW8_TAKRU        0.38  0.52    1   88   86  177   93    5    6  426  H2UUW8     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066031 PE=3 SV=1
  442 : H3CM85_TETNG        0.38  0.60    1   89   97  188   92    3    3  430  H3CM85     Uncharacterized protein OS=Tetraodon nigroviridis GN=F7 (3 of 3) PE=3 SV=1
  443 : I3K350_ORENI        0.38  0.61    1   87   88  176   90    4    4  442  I3K350     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100704100 PE=3 SV=1
  444 : K7GE02_PELSI        0.38  0.55    1   89   89  180   92    2    3  426  K7GE02     Uncharacterized protein OS=Pelodiscus sinensis GN=F7 PE=3 SV=1
  445 : M3XKM2_LATCH        0.38  0.61    1   87   90  176   89    4    4  421  M3XKM2     Uncharacterized protein OS=Latimeria chalumnae PE=3 SV=1
  446 : M3ZVT5_XIPMA        0.38  0.60    2   90   98  189   92    3    3  430  M3ZVT5     Uncharacterized protein OS=Xiphophorus maculatus GN=F7 (2 of 2) PE=3 SV=1
  447 : Q2F9N7_9PRIM        0.38  0.52    1   89   65  156   97    3   13  183  Q2F9N7     Cogulation factor VII (Fragment) OS=Gorilla gorilla GN=F7 PE=4 SV=1
  448 : Q504H3_DANRE        0.38  0.56    1   89   87  179   94    5    6  433  Q504H3     Coagulation factor VII OS=Danio rerio GN=f7 PE=2 SV=1
  449 : Q7SX90_DANRE        0.38  0.55   93  327   21  242  235    4   13  242  Q7SX90     Zgc:66382 OS=Danio rerio GN=zgc:66382 PE=2 SV=1
  450 : Q804X0_TAKRU        0.38  0.58    1   89   97  188   92    3    3  430  Q804X0     Coagulation factor VIIc OS=Takifugu rubripes PE=2 SV=1
  451 : Q8JHD0_DANRE        0.38  0.56    1   89   87  179   94    5    6  433  Q8JHD0     Coagulation factor VII OS=Danio rerio GN=f7 PE=3 SV=1
  452 : Q90YK1_DANRE        0.38  0.57    1   89   87  179   94    5    6  433  Q90YK1     Coagulation factor VII OS=Danio rerio GN=f7 PE=2 SV=1
  453 : T1G593_HELRO        0.38  0.53    2   84   39  121   85    2    4  241  T1G593     Uncharacterized protein (Fragment) OS=Helobdella robusta GN=HELRODRAFT_83699 PE=4 SV=1
  454 : U6DQT0_NEOVI        0.38  0.54    1   85   73  160   93    3   13  160  U6DQT0     Coagulation factor VII (Fragment) OS=Neovison vison GN=FA7 PE=2 SV=1
  455 : B1H1C8_XENTR        0.37  0.64    1   87   77  165   90    4    4  403  B1H1C8     Proz protein OS=Xenopus tropicalis GN=proz PE=2 SV=1
  456 : B1H253_RAT          0.37  0.63    2   91   99  188   90    0    0  410  B1H253     Proz protein (Fragment) OS=Rattus norvegicus GN=Proz PE=2 SV=1
  457 : B3XZY9_LAMJA        0.37  0.57    2   91   90  187   98    4    8  484  B3XZY9     Coagulation factor VII OS=Lampetra japonica GN=Factor VII PE=2 SV=1
  458 : B3Y604_TRIHK        0.37  0.52   93  327   21  242  235    4   13  242  B3Y604     Trypsin OS=Tribolodon hakonensis PE=2 SV=2
  459 : B3Y6D5_SALLE        0.37  0.54   93  326   21  241  234    4   13  242  B3Y6D5     Trypsin OS=Salvelinus leucomaenis PE=2 SV=2
  460 : B5X8D4_SALSA        0.37  0.54   93  326   21  241  234    4   13  242  B5X8D4     Trypsin-1 OS=Salmo salar GN=TRY1 PE=2 SV=1
  461 : C3YIV9_BRAFL        0.37  0.59  106  324    3  226  227    6   11  229  C3YIV9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_86658 PE=3 SV=1
  462 : C3ZLB7_BRAFL        0.37  0.59   93  323   15  245  240    5   18  250  C3ZLB7     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_121932 PE=3 SV=1
  463 : D2D389_CTEID        0.37  0.54   93  327   21  242  235    4   13  242  D2D389     Trypsinogen OS=Ctenopharyngodon idella PE=2 SV=1
  464 : D3ZKM4_RAT          0.37  0.63    2   91   21  110   90    0    0  332  D3ZKM4     Protein Proz OS=Rattus norvegicus GN=Proz PE=3 SV=2
  465 : E0VW11_PEDHC        0.37  0.60   93  326   35  268  241    8   14  274  E0VW11     Tripsin, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM472610 PE=3 SV=1
  466 : F1NGY6_CHICK        0.37  0.58    1   90   88  179   93    4    4  433  F1NGY6     Uncharacterized protein OS=Gallus gallus GN=PROC PE=3 SV=1
  467 : F1R894_DANRE        0.37  0.54   93  327   21  242  235    4   13  242  F1R894     Trypsinogen 1a OS=Danio rerio GN=zgc:66382 PE=2 SV=1
  468 : F4X2V3_ACREC        0.37  0.57   93  326   10  242  243    8   19  249  F4X2V3     Serine proteinase stubble (Fragment) OS=Acromyrmex echinatior GN=G5I_12634 PE=3 SV=1
  469 : F6R7E8_MOUSE        0.37  0.57   93  327   24  247  237    7   15  247  F6R7E8     Protein Gm2663 OS=Mus musculus GN=Gm2663 PE=3 SV=1
  470 : F6WZJ1_XENTR        0.37  0.63    1   87   90  180   92    5    6  418  F6WZJ1     Uncharacterized protein OS=Xenopus tropicalis GN=proz PE=3 SV=1
  471 : F6Z0N2_XENTR        0.37  0.64    1   87   90  178   90    4    4  416  F6Z0N2     Uncharacterized protein OS=Xenopus tropicalis GN=proz PE=3 SV=1
  472 : G1MRY6_MELGA        0.37  0.58    1   90   88  179   93    4    4  433  G1MRY6     Uncharacterized protein OS=Meleagris gallopavo GN=PROC PE=3 SV=1
  473 : G3HUA0_CRIGR        0.37  0.56   93  327    6  230  238    8   16  230  G3HUA0     Trypsin-4 (Fragment) OS=Cricetulus griseus GN=I79_014508 PE=3 SV=1
  474 : G3PT67_GASAC        0.37  0.60    1   91   88  180   95    5    6  435  G3PT67     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  475 : G3V8K8_RAT          0.37  0.63    2   91   95  184   90    0    0  406  G3V8K8     Protein Proz OS=Rattus norvegicus GN=Proz PE=3 SV=2
  476 : G3VBJ1_SARHA        0.37  0.55   93  327   26  249  236    6   13  250  G3VBJ1     Uncharacterized protein OS=Sarcophilus harrisii GN=LOC100916403 PE=3 SV=1
  477 : G3XL85_CYPCA        0.37  0.54   93  327   21  242  235    4   13  242  G3XL85     Trypsin 2 OS=Cyprinus carpio GN=tryp2 PE=2 SV=1
  478 : G9B5E7_9NEOP        0.37  0.54   93  324   31  252  238   12   22  254  G9B5E7     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  479 : G9B5E9_9NEOP        0.37  0.54   93  324   31  252  239   13   24  254  G9B5E9     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  480 : G9B5F1_9NEOP        0.37  0.54   93  324   31  252  238   12   22  254  G9B5F1     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  481 : G9B5F2_9NEOP        0.37  0.54   93  323   31  251  237   12   22  254  G9B5F2     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  482 : G9B5F9_9NEOP        0.37  0.54   93  324   31  252  238   12   22  254  G9B5F9     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  483 : G9B5G1_9NEOP        0.37  0.54   93  325   31  253  239   12   22  254  G9B5G1     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  484 : G9B5G7_9NEOP        0.37  0.54   93  323   31  251  237   12   22  254  G9B5G7     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  485 : G9B5H2_9NEOP        0.37  0.54   93  323   31  251  237   12   22  254  G9B5H2     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  486 : H0ZFP6_TAEGU        0.37  0.59    1   87   90  176   90    4    6  408  H0ZFP6     Uncharacterized protein OS=Taeniopygia guttata GN=PROZ PE=3 SV=1
  487 : H2LPB8_ORYLA        0.37  0.55   93  327   33  258  238    6   15  258  H2LPB8     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101170788 PE=3 SV=1
  488 : H2UMW1_TAKRU        0.37  0.57   93  324   16  236  235    5   17  238  H2UMW1     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071730 PE=3 SV=1
  489 : H2UMW2_TAKRU        0.37  0.57   93  326   22  242  235    5   15  245  H2UMW2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071730 PE=3 SV=1
  490 : H2UMW3_TAKRU        0.37  0.57   93  326   29  249  235    5   15  252  H2UMW3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071730 PE=3 SV=1
  491 : H2YXY2_CIOSA        0.37  0.57    1   85  131  213   87    3    6  334  H2YXY2     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
  492 : H3K3Y6_CTEID        0.37  0.55   93  327   21  242  235    4   13  242  H3K3Y6     Trypsin OS=Ctenopharyngodon idella GN=trp PE=2 SV=1
  493 : I3KKX7_ORENI        0.37  0.59    2   90   95  184   91    3    3  488  I3KKX7     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100694381 PE=3 SV=1
  494 : I5AP59_DROPS        0.37  0.57   93  326   20  251  240    7   14  256  I5AP59     GA11223, isoform B OS=Drosophila pseudoobscura pseudoobscura GN=Dpse\GA11223 PE=3 SV=1
  495 : L5KQU0_PTEAL        0.37  0.56   93  327   25  247  236    5   14  247  L5KQU0     Anionic trypsin OS=Pteropus alecto GN=PAL_GLEAN10019030 PE=3 SV=1
  496 : M3ZEZ3_XIPMA        0.37  0.57    2   90   93  182   91    3    3  485  M3ZEZ3     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
  497 : Q28731_RABIT        0.37  0.60  115  324    1  231  231    6   21  235  Q28731     Thrombin (Fragment) OS=Oryctolagus cuniculus GN=thrombin PE=2 SV=1
  498 : Q5M8E7_XENTR        0.37  0.64    1   87   87  175   90    4    4  413  Q5M8E7     Proz protein (Fragment) OS=Xenopus tropicalis GN=proz PE=2 SV=1
  499 : Q69EZ8_HUMAN1WBG    0.37  0.59   93  325   37  291  255    8   22  295  Q69EZ8     Prothrombin (Fragment) OS=Homo sapiens PE=1 SV=1
  500 : Q7Z0G1_PHLPP        0.37  0.51   93  324   31  255  236    7   15  257  Q7Z0G1     Trypsin 3 OS=Phlebotomus papatasi GN=tryp3 PE=2 SV=1
  501 : Q804X5_CHICK        0.37  0.58    1   90   88  179   93    4    4  433  Q804X5     Anticoagulant protein C OS=Gallus gallus GN=PROC PE=2 SV=1
  502 : Q9CPN7_MOUSE        0.37  0.57   93  327   24  247  237    6   15  247  Q9CPN7     Protein 1810009J06Rik OS=Mus musculus GN=1810009J06Rik PE=2 SV=1
  503 : TRY4_RAT            0.37  0.57   93  327   24  247  237    7   15  247  P12788     Trypsin-4 OS=Rattus norvegicus GN=Try4 PE=2 SV=1
  504 : U3I4W2_ANAPL        0.37  0.59    1   87   89  175   90    4    6  407  U3I4W2     Uncharacterized protein OS=Anas platyrhynchos GN=PROZ PE=3 SV=1
  505 : V5IGW7_IXORI        0.37  0.59  105  327    9  229  227    7   10  230  V5IGW7     Putative serine protease 110 (Fragment) OS=Ixodes ricinus PE=2 SV=1
  506 : V9KMF4_CALMI        0.37  0.55    1   87  125  208   93    4   15  455  V9KMF4     Coagulation factor X OS=Callorhynchus milii PE=2 SV=1
  507 : W5L7A7_ASTMX        0.37  0.54   93  327   21  242  235    4   13  242  W5L7A7     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  508 : W5L7B3_ASTMX        0.37  0.54   93  327   34  255  235    4   13  255  W5L7B3     Uncharacterized protein (Fragment) OS=Astyanax mexicanus PE=4 SV=1
  509 : W5L9U7_ASTMX        0.37  0.56    1   90   92  181   90    0    0  425  W5L9U7     Uncharacterized protein OS=Astyanax mexicanus GN=PROZ (2 of 2) PE=4 SV=1
  510 : W5M4Y0_LEPOC        0.37  0.54    1   91   90  179   92    3    3  424  W5M4Y0     Uncharacterized protein OS=Lepisosteus oculatus PE=4 SV=1
  511 : W5M4Z9_LEPOC        0.37  0.54    1   91   89  178   92    3    3  434  W5M4Z9     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=4 SV=1
  512 : W5MU65_LEPOC        0.37  0.59    1   87   95  184   90    3    3  426  W5MU65     Uncharacterized protein OS=Lepisosteus oculatus GN=F7 (1 of 2) PE=4 SV=1
  513 : A4UCN5_LUTLO        0.36  0.54   93  322   27  249  233    6   13  253  A4UCN5     Trypsin 2 OS=Lutzomyia longipalpis GN=tryp2 PE=2 SV=1
  514 : A7RKX8_NEMVE        0.36  0.50   93  321    2  240  242    7   16  240  A7RKX8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g85345 PE=3 SV=1
  515 : A7RXZ9_NEMVE        0.36  0.60  117  325   10  232  223    5   14  232  A7RXZ9     Predicted protein OS=Nematostella vectensis GN=v1g164017 PE=3 SV=1
  516 : A7UNU1_9ACAR        0.36  0.52   93  323   29  250  236   10   19  253  A7UNU1     Ale o 3 allergen OS=Aleuroglyphus ovatus PE=2 SV=1
  517 : A7VMR7_SOLSE        0.36  0.55   93  327   25  247  236    6   14  247  A7VMR7     Trypsinogen 2 OS=Solea senegalensis GN=Tryp2 PE=2 SV=1
  518 : B0KZK0_ACASI        0.36  0.55   93  322   37  258  234    8   16  263  B0KZK0     Allergen Aca s 3 OS=Acarus siro PE=2 SV=1
  519 : B0WAI9_CULQU        0.36  0.58   93  326   21  252  240    7   14  258  B0WAI9     Coagulation factor XI OS=Culex quinquefasciatus GN=CpipJ_CPIJ004093 PE=3 SV=1
  520 : B3RY72_TRIAD        0.36  0.57   93  327    2  240  247    8   20  240  B3RY72     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_25111 PE=3 SV=1
  521 : B3Y8K5_ONCKE2ZPR    0.36  0.54   93  326    1  221  234    4   13  222  B3Y8K5     Anionic trypsin isoform 2 (Fragment) OS=Oncorhynchus keta PE=1 SV=1
  522 : B3Y8K6_ONCKE2ZPS    0.36  0.54   93  326    1  221  234    4   13  222  B3Y8K6     Anionic trypsin isoform 3 (Fragment) OS=Oncorhynchus keta PE=1 SV=1
  523 : B5X8T3_SALSA        0.36  0.53   93  326   21  241  234    4   13  242  B5X8T3     Trypsin-1 OS=Salmo salar GN=TRY1 PE=2 SV=1
  524 : B5XEC7_SALSA        0.36  0.54   93  326   21  241  234    4   13  242  B5XEC7     Trypsin-1 OS=Salmo salar GN=TRY1 PE=2 SV=1
  525 : B6VRV3_ONCMA        0.36  0.54   93  326   21  241  234    4   13  242  B6VRV3     Trypsin OS=Oncorhynchus masou GN=tryp PE=2 SV=2
  526 : B6VRV4_9TELE        0.36  0.54   93  327    1  222  235    4   13  222  B6VRV4     Trypsin (Fragment) OS=Pygocentrus nattereri GN=tryp PE=2 SV=1
  527 : C3ZPL4_BRAFL        0.36  0.55   93  321   22  238  231    6   16  242  C3ZPL4     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_88359 PE=3 SV=1
  528 : C3ZRZ3_BRAFL        0.36  0.55   93  325   27  252  236    5   13  252  C3ZRZ3     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_272022 PE=4 SV=1
  529 : D2HAJ7_AILME        0.36  0.54   93  321    1  225  235    7   16  233  D2HAJ7     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_007462 PE=3 SV=1
  530 : D6WAH6_TRICA        0.36  0.56   93  327   29  254  237    6   13  254  D6WAH6     Serine protease P24 OS=Tribolium castaneum GN=P24 PE=4 SV=1
  531 : E0VFA7_PEDHC        0.36  0.57   93  316   29  240  230   12   24  255  E0VFA7     Trypsin-delta, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM153430 PE=3 SV=1
  532 : E1CJC3_9TELE        0.36  0.54   93  326   21  241  234    4   13  242  E1CJC3     Trypsin OS=Parahucho perryi GN=tryp1 PE=2 SV=1
  533 : E1CJC4_9TELE        0.36  0.54   93  326   21  241  234    4   13  242  E1CJC4     Trypsin OS=Parahucho perryi GN=tryp2 PE=2 SV=1
  534 : E2AFY8_CAMFO        0.36  0.61   93  326    2  233  240    7   14  238  E2AFY8     Trypsin-1 (Fragment) OS=Camponotus floridanus GN=EAG_11670 PE=3 SV=1
  535 : E9HBL5_DAPPU        0.36  0.58   93  326    2  236  241    7   13  249  E9HBL5     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_60765 PE=3 SV=1
  536 : F1Q5S2_DANRE        0.36  0.50    1   87   94  179   88    3    3  426  F1Q5S2     Uncharacterized protein OS=Danio rerio GN=proza PE=3 SV=1
  537 : F1QZ90_DANRE        0.36  0.49    2   83   87  169   84    2    3  225  F1QZ90     Uncharacterized protein (Fragment) OS=Danio rerio PE=4 SV=1
  538 : F2WR16_EPICO        0.36  0.53   93  325   21  240  233    4   13  242  F2WR16     Trypsinogen 1a OS=Epinephelus coioides PE=2 SV=1
  539 : F4X2V2_ACREC        0.36  0.60   93  326   11  242  240    7   14  248  F4X2V2     Serine proteinase stubble (Fragment) OS=Acromyrmex echinatior GN=G5I_12633 PE=3 SV=1
  540 : F6SB70_MONDO        0.36  0.54   93  327   25  247  236    5   14  247  F6SB70     Uncharacterized protein OS=Monodelphis domestica GN=LOC100010109 PE=3 SV=1
  541 : F6V8R1_XENTR        0.36  0.55   93  327   25  251  237    4   12  251  F6V8R1     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=prss3 PE=3 SV=1
  542 : F7A744_MONDO        0.36  0.53   93  324    4  223  234    7   16  227  F7A744     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=LOC100010991 PE=3 SV=1
  543 : F7BIQ2_MONDO        0.36  0.57   93  327   23  245  236    5   14  246  F7BIQ2     Uncharacterized protein OS=Monodelphis domestica GN=LOC100010951 PE=3 SV=1
  544 : F7H321_CALJA        0.36  0.62    2   91   91  180   90    0    0  400  F7H321     Uncharacterized protein OS=Callithrix jacchus GN=PROZ PE=3 SV=1
  545 : F7HBQ4_MACMU        0.36  0.55   93  327   38  260  236    6   14  261  F7HBQ4     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=3 SV=1
  546 : F7IDM4_CALJA        0.36  0.62    2   91  113  202   90    0    0  422  F7IDM4     Uncharacterized protein OS=Callithrix jacchus GN=PROZ PE=3 SV=1
  547 : G1FE64_9TELE        0.36  0.55   93  324   11  228  232    5   14  231  G1FE64     Trypsinogen I (Fragment) OS=Sardinops caeruleus GN=try1 PE=2 SV=1
  548 : G1K1X9_BOVIN        0.36  0.61    2   87   94  179   87    2    2  439  G1K1X9     Vitamin K-dependent protein Z OS=Bos taurus GN=PROZ PE=3 SV=1
  549 : G3HU99_CRIGR        0.36  0.54   93  327   26  250  241    9   22  250  G3HU99     Trypsin-4 OS=Cricetulus griseus GN=I79_014507 PE=3 SV=1
  550 : G3LUK8_9PERC        0.36  0.54   93  327   25  247  236    5   14  247  G3LUK8     Trypsinogen OS=Channa argus PE=2 SV=1
  551 : G3NM02_GASAC        0.36  0.62    2   87   91  176   87    2    2  245  G3NM02     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
  552 : G3VR43_SARHA        0.36  0.55   93  327   25  247  236    5   14  247  G3VR43     Uncharacterized protein OS=Sarcophilus harrisii GN=LOC100929943 PE=3 SV=1
  553 : G5AV68_HETGA        0.36  0.51    1   86  120  207   90    4    6  668  G5AV68     Vitamin K-dependent protein S (Fragment) OS=Heterocephalus glaber GN=GW7_07640 PE=4 SV=1
  554 : G5C5M8_HETGA        0.36  0.56   93  327   24  245  236    7   15  245  G5C5M8     Cationic trypsin-3 OS=Heterocephalus glaber GN=GW7_03992 PE=3 SV=1
  555 : G9B5H0_9NEOP        0.36  0.53   93  323   31  251  237   12   22  254  G9B5H0     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  556 : G9B5J8_9NEOP        0.36  0.53   93  323   31  251  236   12   20  254  G9B5J8     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  557 : G9JKF2_EPICO        0.36  0.53   93  325   21  240  233    4   13  242  G9JKF2     Trypsinogens 1 OS=Epinephelus coioides PE=2 SV=1
  558 : H0VQH4_CAVPO        0.36  0.60    2   88   90  176   87    0    0  406  H0VQH4     Uncharacterized protein OS=Cavia porcellus GN=PROZ PE=3 SV=1
  559 : H2LQV9_ORYLA        0.36  0.55    1   91   88  180   94    4    4  439  H2LQV9     Uncharacterized protein OS=Oryzias latipes GN=LOC101168986 PE=3 SV=1
  560 : H2LQW1_ORYLA        0.36  0.55    1   91   88  180   94    4    4  437  H2LQW1     Uncharacterized protein OS=Oryzias latipes GN=LOC101168986 PE=3 SV=1
  561 : H2LX99_ORYLA        0.36  0.53    1   88   32  120   90    3    3  362  H2LX99     Uncharacterized protein OS=Oryzias latipes GN=LOC101156578 PE=3 SV=1
  562 : H2MEQ3_ORYLA        0.36  0.55   93  327   30  251  235    5   13  251  H2MEQ3     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101161921 PE=3 SV=1
  563 : H2SA42_TAKRU        0.36  0.59    1   91   85  177   94    4    4  468  H2SA42     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101069699 PE=3 SV=1
  564 : H2UMW4_TAKRU        0.36  0.55   93  326   22  252  245    6   25  253  H2UMW4     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071730 PE=3 SV=1
  565 : H3CCV1_TETNG        0.36  0.56   93  326   16  240  237    5   15  241  H3CCV1     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  566 : H9D159_9TELE        0.36  0.56   93  327    1  222  235    4   13  222  H9D159     Trypsin (Fragment) OS=Colossoma macropomum PE=2 SV=1
  567 : I3NCW3_SPETR        0.36  0.56   93  327   24  246  236    5   14  246  I3NCW3     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
  568 : I4DNU8_PAPXU        0.36  0.55   93  326   23  258  244   11   18  264  I4DNU8     Serine protease OS=Papilio xuthus PE=2 SV=1
  569 : K7J098_NASVI        0.36  0.54   93  325   34  262  241   11   20  263  K7J098     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
  570 : K7J4K9_NASVI        0.36  0.52   93  320   12  228  229    6   13  236  K7J4K9     Uncharacterized protein OS=Nasonia vitripennis PE=4 SV=1
  571 : K7J4L0_NASVI        0.36  0.54   93  320   30  243  229    7   16  252  K7J4L0     Uncharacterized protein OS=Nasonia vitripennis PE=4 SV=1
  572 : M3WFX9_FELCA        0.36  0.56   93  327   34  256  236    5   14  256  M3WFX9     Uncharacterized protein (Fragment) OS=Felis catus GN=LOC101085707 PE=3 SV=1
  573 : M3YAT9_MUSPF        0.36  0.55   93  327   24  246  236    6   14  247  M3YAT9     Uncharacterized protein OS=Mustela putorius furo PE=3 SV=1
  574 : M3ZFC8_XIPMA        0.36  0.49    1   87   86  171   88    3    3  419  M3ZFC8     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
  575 : M4AG26_XIPMA        0.36  0.51    1   90   91  181   95    5    9  476  M4AG26     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
  576 : PROZ_BOVIN          0.36  0.61    2   87   51  136   87    2    2  396  P00744     Vitamin K-dependent protein Z OS=Bos taurus GN=PROZ PE=1 SV=1
  577 : Q0IF79_AEDAE        0.36  0.53   93  320   29  247  235   12   23  256  Q0IF79     AAEL006429-PA OS=Aedes aegypti GN=AAEL006429 PE=3 SV=1
  578 : Q171W0_AEDAE        0.36  0.54   93  323   10  242  240    9   16  251  Q171W0     AAEL007511-PA (Fragment) OS=Aedes aegypti GN=AAEL007511 PE=3 SV=1
  579 : Q171W1_AEDAE        0.36  0.57   93  326   10  241  240    7   14  247  Q171W1     AAEL007514-PA (Fragment) OS=Aedes aegypti GN=AAEL007514 PE=3 SV=1
  580 : Q17BS3_AEDAE        0.36  0.54   93  327   31  266  246   12   21  270  Q17BS3     AAEL004885-PA OS=Aedes aegypti GN=AAEL004885 PE=3 SV=1
  581 : Q4SH18_TETNG        0.36  0.53   93  327   24  246  236    6   14  246  Q4SH18     Chromosome 8 SCAF14587, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00018366001 PE=4 SV=1
  582 : Q4T8C0_TETNG        0.36  0.56   93  326   16  240  237    5   15  240  Q4T8C0     Chromosome 8 SCAF7842, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00005309001 PE=3 SV=1
  583 : Q52V24_ASTLP2F91    0.36  0.56   93  321    1  233  239    5   16  237  Q52V24     Hepatopancreas trypsin (Fragment) OS=Astacus leptodactylus PE=1 SV=1
  584 : Q6W741_9NEOP        0.36  0.57   93  315   29  240  228    9   21  253  Q6W741     Trypsinogen OS=Pediculus humanus GN=TRY1 PE=2 SV=1
  585 : Q7T1R8_9TELE        0.36  0.54   93  327   21  242  235    4   13  242  Q7T1R8     Trypsinogen OS=Pangasianodon hypophthalmus PE=2 SV=1
  586 : Q7TT42_MOUSE        0.36  0.56   93  327   24  246  237    6   16  246  Q7TT42     Trypsinogen 5 OS=Mus musculus GN=trypsinogen PE=3 SV=1
  587 : Q8AV11_ONCKE1MBQ    0.36  0.53   93  326    1  221  234    4   13  222  Q8AV11     Anionic trypsin (Fragment) OS=Oncorhynchus keta PE=1 SV=1
  588 : Q8QGW3_ANGJA        0.36  0.54   93  326   21  243  234    4   11  244  Q8QGW3     Trypsinogen OS=Anguilla japonica GN=try PE=2 SV=1
  589 : Q90244_ACITR        0.36  0.59  118  324    4  230  227    6   20  234  Q90244     Thrombin (Fragment) OS=Acipenser transmontanus GN=thrombin PE=2 SV=1
  590 : Q9XY51_CTEFE        0.36  0.56   93  313   24  241  228    8   17  256  Q9XY51     Trypsin-like serine protease (Fragment) OS=Ctenocephalides felis GN=SP-2 PE=2 SV=1
  591 : Q9XY59_CTEFE        0.36  0.54   93  315    4  228  235    8   22  242  Q9XY59     Trypsin-like serine protease (Fragment) OS=Ctenocephalides felis GN=SP-40 PE=2 SV=1
  592 : Q9XY60_CTEFE        0.36  0.53   93  323   21  240  233    8   15  245  Q9XY60     Trypsin-like serine protease (Fragment) OS=Ctenocephalides felis GN=SP-5 PE=2 SV=1
  593 : R7V6Y6_CAPTE        0.36  0.58   93  327   14  251  243    5   13  260  R7V6Y6     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_119007 PE=3 SV=1
  594 : R7VEX5_CAPTE        0.36  0.55   93  327   12  251  244    6   13  251  R7VEX5     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_127358 PE=3 SV=1
  595 : TRY1_SALSA  2TBS    0.36  0.53   93  326   21  241  234    4   13  242  P35031     Trypsin-1 OS=Salmo salar PE=1 SV=1
  596 : TRY2_SALSA          0.36  0.54   93  326   10  230  234    4   13  231  P35032     Trypsin-2 (Fragment) OS=Salmo salar PE=2 SV=1
  597 : U5EGR6_9DIPT        0.36  0.55   93  322   30  248  231    5   13  252  U5EGR6     Putative trypsin-like serine protease OS=Corethrella appendiculata PE=2 SV=1
  598 : W5K151_ASTMX        0.36  0.55   93  326   24  248  236    4   13  249  W5K151     Uncharacterized protein (Fragment) OS=Astyanax mexicanus PE=4 SV=1
  599 : W5LTT6_ASTMX        0.36  0.56   93  326   25  246  235    5   14  247  W5LTT6     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  600 : W5LTU4_ASTMX        0.36  0.55   93  326   25  246  235    5   14  247  W5LTU4     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  601 : W5PD84_SHEEP        0.36  0.45    1   85   90  155   89    5   27  509  W5PD84     Uncharacterized protein (Fragment) OS=Ovis aries GN=F10 PE=4 SV=1
  602 : A0FGS8_CANFA        0.35  0.53   93  327   20  242  236    5   14  243  A0FGS8     Anionic trypsinogen (Fragment) OS=Canis familiaris PE=3 SV=1
  603 : A1KXH3_DERFA        0.35  0.54   93  322   28  255  240   10   22  259  A1KXH3     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
  604 : A4UWM7_ORYLA        0.35  0.54   93  327   21  242  235    4   13  242  A4UWM7     Trypsinogen OS=Oryzias latipes GN=tryp PE=2 SV=1
  605 : A4ZX98_MYXAS        0.35  0.55   93  327   24  246  236    5   14  246  A4ZX98     Trypsin OS=Myxocyprinus asiaticus PE=2 SV=1
  606 : A7LD78_PAROL        0.35  0.54   93  326   21  240  236    8   18  241  A7LD78     Trypsinogen 2 OS=Paralichthys olivaceus GN=TRP2 PE=2 SV=1
  607 : A7S1T0_NEMVE        0.35  0.51   93  325   18  250  236    3    6  252  A7S1T0     Predicted protein OS=Nematostella vectensis GN=v1g101093 PE=3 SV=1
  608 : A7S9K4_NEMVE        0.35  0.57   93  326    1  234  237    3    6  235  A7S9K4     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g110126 PE=3 SV=1
  609 : A7SWQ5_NEMVE        0.35  0.55   93  325    7  239  237    5    8  239  A7SWQ5     Predicted protein OS=Nematostella vectensis GN=v1g218669 PE=3 SV=1
  610 : A7TVD3_BOMMO        0.35  0.51   93  323   35  257  237   11   20  260  A7TVD3     Cocoonase OS=Bombyx mori PE=2 SV=1
  611 : A7UNT7_DERPT        0.35  0.53   93  322   30  257  240   11   22  261  A7UNT7     Der p 3 allergen OS=Dermatophagoides pteronyssinus PE=2 SV=1
  612 : A7UNZ4_BOMMA        0.35  0.51   93  323   35  257  237   11   20  260  A7UNZ4     Cocoonase OS=Bombyx mandarina PE=2 SV=1
  613 : A9YYL0_DERFA        0.35  0.54   93  322   28  255  240   11   22  259  A9YYL0     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
  614 : B0WDC9_CULQU        0.35  0.54   93  322   40  259  234    9   18  263  B0WDC9     Trypsin 7 OS=Culex quinquefasciatus GN=CpipJ_CPIJ005132 PE=3 SV=1
  615 : B3GEG4_SINCH        0.35  0.53   93  326   21  241  238    6   21  242  B3GEG4     Trypsinogen 2 OS=Siniperca chuatsi GN=TRS-B PE=2 SV=1
  616 : B3RZF9_TRIAD        0.35  0.56   93  325    4  248  248    6   18  253  B3RZF9     Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_26286 PE=4 SV=1
  617 : B7U5S5_DERFA        0.35  0.54   93  322   28  255  240   10   22  259  B7U5S5     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
  618 : B7U5S6_DERFA        0.35  0.54   93  322   28  255  240   10   22  259  B7U5S6     Der f 3 allergen OS=Dermatophagoides farinae PE=2 SV=1
  619 : B9V2X7_EPICO        0.35  0.53   93  326   24  244  240    9   25  245  B9V2X7     Trypsinogen 1a (Fragment) OS=Epinephelus coioides PE=2 SV=1
  620 : C1BLA2_OSMMO        0.35  0.55   93  327   23  245  236    5   14  245  C1BLA2     Trypsin-3 OS=Osmerus mordax GN=TRY3 PE=2 SV=1
  621 : C3XYP7_BRAFL        0.35  0.59  108  326    2  229  229    3   11  231  C3XYP7     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_126297 PE=3 SV=1
  622 : C3YDA9_BRAFL        0.35  0.50   93  326    5  245  245    8   15  250  C3YDA9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_218346 PE=3 SV=1
  623 : C3ZRZ4_BRAFL        0.35  0.55   93  325   21  246  238    7   17  246  C3ZRZ4     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_287422 PE=3 SV=1
  624 : C3ZW47_BRAFL        0.35  0.55   93  322    1  244  244    8   14  255  C3ZW47     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_241477 PE=3 SV=1
  625 : C5IWV5_PIG          0.35  0.55   93  327   24  246  236    5   14  246  C5IWV5     Trypsinogen OS=Sus scrofa PE=2 SV=1
  626 : C7DY49_TAKOB        0.35  0.54   93  327   24  246  236    5   14  246  C7DY49     Trypsinogen 2 OS=Takifugu obscurus PE=2 SV=1
  627 : D0V531_CTEFE        0.35  0.56   93  313   28  245  228    8   17  260  D0V531     Trypsin (Fragment) OS=Ctenocephalides felis PE=2 SV=1
  628 : D1MYR2_ANGJA        0.35  0.54   93  327   21  244  235    4   11  244  D1MYR2     Trypsinogen OS=Anguilla japonica GN=try PE=2 SV=1
  629 : D3K9W1_HELHR        0.35  0.49    1   73    1   72   80    2   15  178  D3K9W1     Distal-less (Fragment) OS=Heloderma horridum GN=DLL PE=4 SV=1
  630 : D3K9W2_HELSU        0.35  0.49    1   73    1   72   80    2   15  178  D3K9W2     Distal-less (Fragment) OS=Heloderma suspectum GN=DLL PE=4 SV=1
  631 : D3K9Y1_ANISC        0.35  0.50    1   73    1   72   80    2   15  190  D3K9Y1     Distal-less (Fragment) OS=Anilius scytale GN=DLL PE=4 SV=1
  632 : D3K9Y2_LIOAL        0.35  0.51    1   73    1   72   80    2   15  190  D3K9Y2     Distal-less (Fragment) OS=Liotyphlops albirostris GN=DLL PE=4 SV=1
  633 : D3K9Y3_BOACO        0.35  0.51    1   73    1   72   80    2   15  190  D3K9Y3     Distal-less (Fragment) OS=Boa constrictor GN=DLL PE=4 SV=1
  634 : D3K9Y6_XENUN        0.35  0.51    1   73    1   72   80    2   15  190  D3K9Y6     Distal-less (Fragment) OS=Xenopeltis unicolor GN=DLL PE=4 SV=1
  635 : D3TJH6_SINCH        0.35  0.53   93  327   25  247  236    6   14  247  D3TJH6     Pancreatic trypsin OS=Siniperca chuatsi PE=2 SV=1
  636 : D3TP63_GLOMM        0.35  0.53   93  323   31  252  237   10   21  256  D3TP63     Midgut trypsin OS=Glossina morsitans morsitans PE=2 SV=1
  637 : D6PVN2_EPICO        0.35  0.54   93  327   23  245  236    5   14  245  D6PVN2     Trypsinogen OS=Epinephelus coioides PE=2 SV=1
  638 : D6QUQ4_ANTPE        0.35  0.52   93  323   34  258  238   12   20  261  D6QUQ4     Cocoonase-like protein OS=Antheraea pernyi PE=2 SV=1
  639 : DERF3_DERFA         0.35  0.54   93  322   28  255  240   11   22  259  P49275     Mite allergen Der f 3 OS=Dermatophagoides farinae GN=DERF3 PE=1 SV=2
  640 : DERP3_DERPT         0.35  0.53   93  322   30  257  240   11   22  261  P39675     Mite allergen Der p 3 OS=Dermatophagoides pteronyssinus GN=DERP3 PE=1 SV=1
  641 : E1ZYQ4_CAMFO        0.35  0.56   93  322   20  243  234    7   14  247  E1ZYQ4     Trypsin-4 OS=Camponotus floridanus GN=EAG_08391 PE=3 SV=1
  642 : E9GTT5_DAPPU        0.35  0.54  105  326    4  238  240   11   23  239  E9GTT5     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_54608 PE=3 SV=1
  643 : EURM3_EURMA         0.35  0.54   93  322   30  257  240   10   22  261  O97370     Mite allergen Eur m 3 OS=Euroglyphus maynei GN=EURM3 PE=1 SV=1
  644 : F1SRS2_PIG          0.35  0.55   93  327   24  246  236    5   14  246  F1SRS2     Uncharacterized protein OS=Sus scrofa GN=LOC100302368 PE=2 SV=1
  645 : F2XFT0_DISMA        0.35  0.53   93  326   20  240  234    5   13  241  F2XFT0     Trypsinogen H1_1c OS=Dissostichus mawsoni PE=4 SV=1
  646 : F2XFT4_DISMA        0.35  0.54   93  326   20  240  234    4   13  241  F2XFT4     Trypsinogen H1_1g OS=Dissostichus mawsoni PE=3 SV=1
  647 : F2XFV5_DISMA        0.35  0.53   93  326   21  241  234    4   13  242  F2XFV5     Trypsinogen H2_1a OS=Dissostichus mawsoni PE=3 SV=1
  648 : F2XFV7_DISMA        0.35  0.54   93  326   20  240  234    5   13  241  F2XFV7     Trypsinogen H2_1d OS=Dissostichus mawsoni PE=3 SV=1
  649 : F2XFW0_DISMA        0.35  0.53   93  326   21  241  234    4   13  242  F2XFW0     Trypsinogen H2_1g OS=Dissostichus mawsoni PE=3 SV=1
  650 : F2XFX3_DISMA        0.35  0.53   93  326   21  241  234    4   13  242  F2XFX3     H2_1b OS=Dissostichus mawsoni PE=3 SV=1
  651 : F4MI41_9DIPT        0.35  0.51   93  320   31  253  236    9   21  259  F4MI41     Putative trypsin 2 OS=Phlebotomus perniciosus PE=2 SV=1
  652 : F6VNT7_HORSE        0.35  0.56   93  324   26  245  233    5   14  246  F6VNT7     Uncharacterized protein (Fragment) OS=Equus caballus GN=LOC100050047 PE=3 SV=1
  653 : F6XB42_ORNAN        0.35  0.54   93  321   23  249  239   10   22  256  F6XB42     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PRSS55 PE=3 SV=1
  654 : F6XSU3_ORNAN        0.35  0.54   93  327   26  250  237    7   14  250  F6XSU3     Uncharacterized protein OS=Ornithorhynchus anatinus PE=3 SV=1
  655 : F6ZEX0_HORSE        0.35  0.53   93  320    2  226  234    8   15  227  F6ZEX0     Uncharacterized protein (Fragment) OS=Equus caballus GN=TMPRSS4 PE=3 SV=1
  656 : F7DST6_HORSE        0.35  0.56   93  327   24  246  236    5   14  246  F7DST6     Uncharacterized protein OS=Equus caballus GN=LOC100049983 PE=3 SV=1
  657 : F7G640_ORNAN        0.35  0.54   93  317   11  223  228    8   18  241  F7G640     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=LOC100088455 PE=3 SV=1
  658 : F7IUA2_ANOGA        0.35  0.58   93  326   22  253  240    7   14  259  F7IUA2     AGAP004570-PA OS=Anopheles gambiae GN=AgaP_AGAP004570 PE=3 SV=1
  659 : G1LIB7_AILME        0.35  0.54   93  327   24  246  236    6   14  247  G1LIB7     Uncharacterized protein OS=Ailuropoda melanoleuca GN=LOC100472031 PE=3 SV=1
  660 : G1MCD2_AILME        0.35  0.53   93  322    1  229  239    9   19  266  G1MCD2     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=3 SV=1
  661 : G1NSS0_MYOLU        0.35  0.55   93  327   24  246  236    6   14  247  G1NSS0     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
  662 : G1SGH0_RABIT        0.35  0.55   93  327   24  246  236    5   14  246  G1SGH0     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100339859 PE=3 SV=1
  663 : G3NG42_GASAC        0.35  0.55   93  327   22  243  235    5   13  243  G3NG42     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  664 : G3NGE3_GASAC        0.35  0.56   93  327   21  242  235    5   13  242  G3NGE3     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  665 : G3NGG0_GASAC        0.35  0.54   93  327   15  240  239    5   17  241  G3NGG0     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
  666 : G3NGH2_GASAC        0.35  0.54   95  326    1  222  233    4   12  235  G3NGH2     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  667 : G3NGH9_GASAC        0.35  0.53   93  326   22  245  239    5   20  247  G3NGH9     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  668 : G3NY71_GASAC        0.35  0.52   93  321   24  244  233    7   16  250  G3NY71     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  669 : G3PC41_GASAC        0.35  0.46    1   87   91  183   96    5   12  441  G3PC41     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  670 : G3PC79_GASAC        0.35  0.46    1   87   91  183   96    5   12  429  G3PC79     Uncharacterized protein OS=Gasterosteus aculeatus PE=3 SV=1
  671 : G3PS27_GASAC        0.35  0.58    2   88   89  177   91    5    6  457  G3PS27     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  672 : G3QZE0_GORGO        0.35  0.56   93  327   24  246  236    6   14  247  G3QZE0     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101145449 PE=3 SV=1
  673 : G3TM62_LOXAF        0.35  0.54   93  327   24  246  236    5   14  246  G3TM62     Uncharacterized protein OS=Loxodonta africana GN=LOC100659862 PE=3 SV=1
  674 : G3V7Q8_RAT          0.35  0.57   93  327   25  247  236    5   14  247  G3V7Q8     Cationic trypsinogen OS=Rattus norvegicus GN=Prss3 PE=4 SV=1
  675 : G5DGE0_9NEOP        0.35  0.54   93  323   31  251  237   12   22  254  G5DGE0     Trypsin-like protein OS=Eupolyphaga sinensis PE=2 SV=1
  676 : G6DSJ5_DANPL        0.35  0.55   93  322   25  247  237   10   21  263  G6DSJ5     Vitellin-degrading protease OS=Danaus plexippus GN=KGM_06501 PE=3 SV=1
  677 : G9B5J0_9NEOP        0.35  0.54   93  323   31  251  237   12   22  254  G9B5J0     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  678 : G9B5J2_9NEOP        0.35  0.54   93  323   31  251  237   12   22  254  G9B5J2     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  679 : G9B5J6_9NEOP        0.35  0.54   93  323   31  251  237   11   22  254  G9B5J6     Serine protease OS=Eupolyphaga sinensis PE=2 SV=1
  680 : G9JKF3_EPICO        0.35  0.53   93  326   23  243  234    4   13  244  G9JKF3     Trypsinogens 2 OS=Epinephelus coioides PE=2 SV=1
  681 : H0X996_OTOGA        0.35  0.56   93  327   24  246  236    5   14  247  H0X996     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
  682 : H0XFT0_OTOGA        0.35  0.55   93  327   24  246  236    5   14  246  H0XFT0     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
  683 : H0Z9C7_TAEGU        0.35  0.55   93  320    7  233  234    8   13  238  H0Z9C7     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
  684 : H0ZSH7_TAEGU        0.35  0.55   93  327   27  249  236    6   14  249  H0ZSH7     Uncharacterized protein OS=Taeniopygia guttata GN=PRSS3 PE=3 SV=1
  685 : H2LQI1_ORYLA        0.35  0.54   93  321    3  230  233    4    9  235  H2LQI1     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101155223 PE=3 SV=1
  686 : H2MEM6_ORYLA        0.35  0.54   93  327   24  245  235    4   13  245  H2MEM6     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101161921 PE=3 SV=1
  687 : H2N2L4_ORYLA        0.35  0.54   93  327   23  245  236    5   14  245  H2N2L4     Uncharacterized protein OS=Oryzias latipes GN=LOC101154931 PE=3 SV=1
  688 : H2R1H9_PANTR        0.35  0.56   93  327   24  246  236    6   14  247  H2R1H9     Uncharacterized protein OS=Pan troglodytes GN=LOC100615987 PE=3 SV=1
  689 : H2RRG2_TAKRU        0.35  0.52   93  326   21  241  238    6   21  242  H2RRG2     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066992 PE=3 SV=1
  690 : H2SA40_TAKRU        0.35  0.57    1   91   88  180   94    4    4  428  H2SA40     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101069699 PE=3 SV=1
  691 : H2TQN2_TAKRU        0.35  0.51    2   85  196  279   88    3    8  405  H2TQN2     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101061411 PE=4 SV=1
  692 : H2UMW5_TAKRU        0.35  0.54   93  326   23  254  246    6   26  255  H2UMW5     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101071730 PE=3 SV=1
  693 : H3AJ49_LATCH        0.35  0.52    1   89   67  152   92    5    9  534  H3AJ49     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
  694 : H3BY76_TETNG        0.35  0.52    1   91   19  110   93    3    3  348  H3BY76     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  695 : H3C2H9_TETNG        0.35  0.57    1   91   75  167   95    5    6  427  H3C2H9     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  696 : H3C399_TETNG        0.35  0.57    1   91   86  178   95    5    6  438  H3C399     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  697 : H3C4D6_TETNG        0.35  0.57    1   91   92  184   94    4    4  444  H3C4D6     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
  698 : H3CAT7_TETNG        0.35  0.57    1   91   87  179   95    5    6  439  H3CAT7     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
  699 : H9KC43_APIME        0.35  0.62   93  325   18  248  239    7   14  255  H9KC43     Uncharacterized protein OS=Apis mellifera GN=LOC100576158 PE=3 SV=1
  700 : I3JZS8_ORENI        0.35  0.51   93  325   22  243  233    3   11  246  I3JZS8     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100699793 PE=3 SV=1
  701 : I3LBF8_PIG          0.35  0.52   93  327    8  243  244    5   17  244  I3LBF8     Uncharacterized protein OS=Sus scrofa GN=LOC100739292 PE=3 SV=1
  702 : I3NFU5_SPETR        0.35  0.53   93  327   25  247  236    5   14  247  I3NFU5     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=4 SV=1
  703 : K4GP01_DIPDO        0.35  0.50    1   73    1   72   80    2   15  181  K4GP01     Distal-less (Fragment) OS=Dipsosaurus dorsalis PE=4 SV=1
  704 : K4GP02_EXIPL        0.35  0.49    2   73    1   71   79    2   15  177  K4GP02     Distal-less (Fragment) OS=Exiliboa placata PE=4 SV=1
  705 : K4GP07_9SAUR        0.35  0.50    1   73    1   72   80    2   15  181  K4GP07     Distal-less (Fragment) OS=Petrosaurus mearnsi PE=4 SV=1
  706 : K4GP34_ALLMI        0.35  0.51    1   73    1   72   80    2   15  173  K4GP34     Distal-less (Fragment) OS=Alligator mississippiensis PE=4 SV=1
  707 : K4GP46_9SAUR        0.35  0.51    1   73    1   72   80    2   15  190  K4GP46     Distal-less (Fragment) OS=Eryx colubrinus PE=4 SV=1
  708 : K4GPG5_ASPME        0.35  0.51    1   73    1   72   80    2   15  190  K4GPG5     Distal-less (Fragment) OS=Aspidites melanocephalus PE=4 SV=1
  709 : K4GPH8_CHISR        0.35  0.50    1   73    1   72   80    2   15  188  K4GPH8     Distal-less (Fragment) OS=Chilabothrus striatus PE=4 SV=1
  710 : K4GRL3_DIPZA        0.35  0.49    1   73    1   72   80    2   15  190  K4GRL3     Distal-less (Fragment) OS=Diplometopon zarudnyi PE=4 SV=1
  711 : K4GRN9_TROHA        0.35  0.51    1   73    1   72   80    2   15  190  K4GRN9     Distal-less (Fragment) OS=Tropidophis haetianus PE=4 SV=1
  712 : K4GU04_AZEFE        0.35  0.51    1   73    1   72   80    2   15  191  K4GU04     Distal-less (Fragment) OS=Azemiops feae PE=4 SV=1
  713 : K4GU07_CASDU        0.35  0.51    1   73    1   72   80    2   15  190  K4GU07     Distal-less (Fragment) OS=Casarea dussumieri PE=4 SV=1
  714 : K4GU25_9SAUR        0.35  0.50    1   73    1   72   80    2   15  178  K4GU25     Distal-less (Fragment) OS=Teratoscincus scincus PE=4 SV=1
  715 : K7F5S8_PELSI        0.35  0.56    1   91   89  182   95    4    5  428  K7F5S8     Uncharacterized protein OS=Pelodiscus sinensis GN=PROC PE=3 SV=1
  716 : K7J094_NASVI        0.35  0.53   93  322   26  251  238   10   20  255  K7J094     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
  717 : K7J095_NASVI        0.35  0.53   93  322   38  263  240   12   24  267  K7J095     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
  718 : K7J097_NASVI        0.35  0.53   93  326   41  270  244   12   24  270  K7J097     Uncharacterized protein OS=Nasonia vitripennis PE=3 SV=1
  719 : L8HQ42_9CETA        0.35  0.54   93  325    1  230  244   10   25  265  L8HQ42     Serine protease 52 (Fragment) OS=Bos mutus GN=M91_04940 PE=3 SV=1
  720 : L9L0Y1_TUPCH        0.35  0.54   93  327   25  247  236    5   14  247  L9L0Y1     Cationic trypsin-3 OS=Tupaia chinensis GN=TREES_T100005090 PE=3 SV=1
  721 : M3XJJ3_LATCH        0.35  0.55    1   90   89  180   93    4    4  430  M3XJJ3     Uncharacterized protein OS=Latimeria chalumnae PE=3 SV=1
  722 : M3YB18_MUSPF        0.35  0.57   93  327   24  246  236    5   14  246  M3YB18     Uncharacterized protein OS=Mustela putorius furo PE=3 SV=1
  723 : M3Z995_NOMLE        0.35  0.54   93  327   21  243  236    6   14  244  M3Z995     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=LOC100592228 PE=3 SV=1
  724 : M4A844_XIPMA        0.35  0.54   93  327   23  245  236    6   14  245  M4A844     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
  725 : O02570_CULQU        0.35  0.53   93  322   40  259  234    9   18  263  O02570     Late trypsin OS=Culex quinquefasciatus PE=2 SV=1
  726 : O42159_PETMA        0.35  0.51   93  327   21  244  235    3   11  244  O42159     Trypsinogen B1 (Precursor) OS=Petromyzon marinus GN=TRYPB1 PE=2 SV=1
  727 : O42160_PETMA        0.35  0.51   93  327   22  245  235    3   11  245  O42160     Trypsinogen b2 (Precursor) OS=Petromyzon marinus GN=TRYPB2 PE=2 SV=1
  728 : Q17039_ANOGA        0.35  0.58   93  326   10  241  240    7   14  247  Q17039     Serine proteinase (Fragment) OS=Anopheles gambiae PE=3 SV=1
  729 : Q27J28_9NEOP        0.35  0.53   93  323    2  222  236   11   20  225  Q27J28     Fibrinolytic enzyme (Fragment) OS=Eupolyphaga sinensis PE=2 SV=1
  730 : Q3SY20_HUMAN        0.35  0.56   93  327   24  246  236    6   14  247  Q3SY20     Protease, serine, 2 (Trypsin 2) OS=Homo sapiens GN=PRSS2 PE=2 SV=1
  731 : Q3V2G3_MOUSE        0.35  0.56   93  327   24  246  236    6   14  246  Q3V2G3     Putative uncharacterized protein OS=Mus musculus GN=Prss3 PE=2 SV=1
  732 : Q4G0C2_MOUSE        0.35  0.56   93  327   23  245  236    6   14  245  Q4G0C2     Prss3 protein (Fragment) OS=Mus musculus GN=Prss3 PE=2 SV=1
  733 : Q5H730_MACMU        0.35  0.56   93  327   24  246  236    6   14  247  Q5H730     Try13 OS=Macaca mulatta GN=try13 PE=3 SV=1
  734 : Q5H731_MACMU        0.35  0.56   93  327   24  246  236    5   14  247  Q5H731     Try12 OS=Macaca mulatta GN=try12 PE=3 SV=1
  735 : Q5H732_MACMU        0.35  0.56   93  327   24  247  236    6   13  248  Q5H732     Try10 OS=Macaca mulatta GN=try10 PE=3 SV=1
  736 : Q5M8T8_XENTR        0.35  0.57   93  327   23  249  240    6   18  249  Q5M8T8     Hypothetical LOC496697 OS=Xenopus tropicalis GN=prss1.2 PE=2 SV=1
  737 : Q5M910_XENTR        0.35  0.55   93  327   23  249  240    6   18  249  Q5M910     Pancreatic trypsin 1 OS=Xenopus tropicalis GN=prss1 PE=2 SV=1
  738 : Q5NV56_HUMAN        0.35  0.56   93  327   24  246  236    6   14  247  Q5NV56     Anionic trypsinogen OS=Homo sapiens GN=TRY8 PE=2 SV=1
  739 : Q66PG8_TAKRU        0.35  0.53   93  326    9  233  236    5   13  235  Q66PG8     Trypsinogen (Fragment) OS=Takifugu rubripes PE=4 SV=1
  740 : Q6DIW2_XENTR        0.35  0.55   93  327   23  249  237    4   12  249  Q6DIW2     MGC89184 protein OS=Xenopus tropicalis GN=prss3 PE=2 SV=1
  741 : Q792Z0_MOUSE        0.35  0.56   93  327   24  246  236    6   14  246  Q792Z0     Protein Prss3 OS=Mus musculus GN=Prss3 PE=4 SV=1
  742 : Q90387_CYNPY        0.35  0.59  116  324    1  230  230    7   21  235  Q90387     Thrombin (Fragment) OS=Cynops pyrrhogaster GN=thrombin PE=2 SV=1
  743 : Q91218_ONCMY        0.35  0.60  116  324    1  230  230    7   21  239  Q91218     Thrombin (Fragment) OS=Oncorhynchus mykiss GN=thrombin PE=2 SV=1
  744 : Q91515_TAKRU        0.35  0.53   93  326   16  236  234    4   13  237  Q91515     Trypsinogen (Fragment) OS=Takifugu rubripes PE=2 SV=1
  745 : Q92099_PARMG        0.35  0.54   93  326   21  241  234    5   13  242  Q92099     Trypsin (Precursor) OS=Paranotothenia magellanica PE=2 SV=1
  746 : Q98TG9_9TELE        0.35  0.53   93  325   20  238  237    7   22  241  Q98TG9     Trypsinogen II OS=Engraulis japonicus GN=aTryII PE=2 SV=1
  747 : Q9CPN9_MOUSE        0.35  0.57   93  327   25  247  236    5   14  247  Q9CPN9     Protein 2210010C04Rik OS=Mus musculus GN=2210010C04Rik PE=2 SV=1
  748 : Q9D7Y7_MOUSE        0.35  0.57   94  327   26  247  235    6   14  247  Q9D7Y7     Putative uncharacterized protein OS=Mus musculus GN=2210010C04Rik PE=2 SV=1
  749 : Q9W7Q5_PAROL        0.35  0.50   93  327   22  246  240    5   20  247  Q9W7Q5     Trypsinogen 3 OS=Paralichthys olivaceus PE=2 SV=2
  750 : Q9W7Q6_PAROL        0.35  0.54   93  326   18  237  234    5   14  238  Q9W7Q6     Trypsinogen 2 (Fragment) OS=Paralichthys olivaceus PE=2 SV=1
  751 : Q9XY55_CTEFE        0.35  0.52   93  315   29  252  236   11   25  265  Q9XY55     Trypsin-like serine protease OS=Ctenocephalides felis GN=SP-28 PE=2 SV=1
  752 : R0JSD5_SETT2        0.35  0.52   93  322   36  261  240   11   24  263  R0JSD5     Uncharacterized protein OS=Setosphaeria turcica (strain 28A) GN=SETTUDRAFT_93425 PE=3 SV=1
  753 : S4RVH9_PETMA        0.35  0.51   93  327   22  245  235    3   11  245  S4RVH9     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=Pma.9336 PE=3 SV=1
  754 : S7MN18_MYOBR        0.35  0.56   93  327   24  246  236    6   14  247  S7MN18     Anionic trypsin OS=Myotis brandtii GN=D623_10026158 PE=3 SV=1
  755 : T1DJQ1_ANOAQ        0.35  0.53  105  326    2  225  231    9   16  231  T1DJQ1     Putative serine protease aedes aegypti serine protease (Fragment) OS=Anopheles aquasalis PE=2 SV=1
  756 : TRY2_CANFA          0.35  0.53   93  327   24  246  236    5   14  247  P06872     Anionic trypsin OS=Canis familiaris PE=2 SV=1
  757 : TRY2_HUMAN          0.35  0.56   93  327   24  246  236    6   14  247  P07478     Trypsin-2 OS=Homo sapiens GN=PRSS2 PE=1 SV=1
  758 : TRY3_RAT            0.35  0.57   93  327   25  247  236    5   14  247  P08426     Cationic trypsin-3 OS=Rattus norvegicus GN=Try3 PE=2 SV=1
  759 : TRYA_RAT            0.35  0.56   93  327   25  246  236    7   15  246  P32821     Trypsin V-A OS=Rattus norvegicus PE=2 SV=1
  760 : TRYB_RAT            0.35  0.57   93  327   25  246  236    7   15  246  P32822     Trypsin V-B OS=Rattus norvegicus PE=2 SV=1
  761 : TRYP_ASTAS          0.35  0.56   93  321    1  233  240    5   18  237  P00765     Trypsin-1 OS=Astacus astacus PE=1 SV=1
  762 : TRYP_PIG    1AN1    0.35  0.55   93  327    9  231  236    5   14  231  P00761     Trypsin OS=Sus scrofa PE=1 SV=1
  763 : V5FZR0_ANOGL        0.35  0.52   93  323   38  259  236   11   19  262  V5FZR0     Trypsin-7 (Fragment) OS=Anoplophora glabripennis GN=TRY7 PE=4 SV=1
  764 : W5L9S3_ASTMX        0.35  0.58    1   86   96  186   92    5    7  432  W5L9S3     Uncharacterized protein OS=Astyanax mexicanus GN=F7 (1 of 3) PE=4 SV=1
  765 : W5Q4Y9_SHEEP        0.35  0.55   93  327   21  243  236    5   14  244  W5Q4Y9     Uncharacterized protein OS=Ovis aries GN=LOC101112559 PE=4 SV=1
  766 : W5Q4Z1_SHEEP        0.35  0.55   93  327   24  246  236    5   14  247  W5Q4Z1     Uncharacterized protein OS=Ovis aries GN=LOC101112559 PE=4 SV=1
  767 : A1A508_HUMAN        0.34  0.55   93  327   24  246  236    6   14  247  A1A508     PRSS3 protein OS=Homo sapiens GN=PRSS3 PE=2 SV=1
  768 : A2TGR7_BOMMO        0.34  0.52  105  323    8  218  222    7   14  221  A2TGR7     Cocoonase (Fragment) OS=Bombyx mori PE=2 SV=1
  769 : A4QP82_DANRE        0.34  0.58    1   86   95  185   92    5    7  431  A4QP82     Zgc:163025 protein OS=Danio rerio GN=zgc:163025 PE=2 SV=1
  770 : A4UCN4_LUTLO        0.34  0.53   93  324   30  253  237    8   18  255  A4UCN4     Trypsin 1 OS=Lutzomyia longipalpis GN=tryp1 PE=2 SV=1
  771 : A5PJB4_BOVIN        0.34  0.54   93  327   24  246  236    5   14  247  A5PJB4     PRSS2 protein OS=Bos taurus GN=PRSS2 PE=2 SV=1
  772 : A7DZ29_DROME        0.34  0.52   93  325   24  243  238   12   23  245  A7DZ29     Serine protease OS=Drosophila melanogaster GN=CG17240 PE=3 SV=1
  773 : A7DZ34_DROSI        0.34  0.49   93  325   24  243  241   13   29  245  A7DZ34     GD22853 OS=Drosophila simulans GN=CG17240 PE=4 SV=1
  774 : A7RX09_NEMVE        0.34  0.46    1   73   43  114   80    2   15  114  A7RX09     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g96278 PE=4 SV=1
  775 : A7S5M4_NEMVE        0.34  0.50   93  327   13  249  246   10   20  249  A7S5M4     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g105460 PE=3 SV=1
  776 : A7T3C0_NEMVE        0.34  0.52   93  327    7  241  238    3    6  241  A7T3C0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g144191 PE=4 SV=1
  777 : A7YWU9_BOVIN        0.34  0.54   93  327   24  246  236    5   14  247  A7YWU9     PRSS2 protein OS=Bos taurus GN=PRSS2 PE=2 SV=1
  778 : A8QL65_LOCMI        0.34  0.51   93  325   10  244  243    7   18  244  A8QL65     Trypsin-like serine protease (Fragment) OS=Locusta migratoria manilensis GN=TSP PE=2 SV=1
  779 : B4KTX0_DROMO        0.34  0.55   93  323   31  251  238   10   24  255  B4KTX0     GI21243 OS=Drosophila mojavensis GN=Dmoj\GI21243 PE=3 SV=1
  780 : B4LJ05_DROVI        0.34  0.50   93  327   31  256  240   10   19  265  B4LJ05     GJ21494 OS=Drosophila virilis GN=Dvir\GJ21494 PE=3 SV=1
  781 : B4LJ08_DROVI        0.34  0.49   93  326   34  267  246    9   24  269  B4LJ08     GJ20851 OS=Drosophila virilis GN=Dvir\GJ20851 PE=4 SV=1
  782 : B6CGL8_SPAAU        0.34  0.52   93  326   21  240  238    7   22  241  B6CGL8     Trypsinogen OS=Sparus aurata PE=2 SV=1
  783 : B6CGL9_DIPSG        0.34  0.52   93  326   21  240  238    6   22  241  B6CGL9     Trypsinogen OS=Diplodus sargus PE=2 SV=1
  784 : B7P8G5_IXOSC        0.34  0.56   93  324   11  250  244    7   16  252  B7P8G5     Serine protease, putative OS=Ixodes scapularis GN=IscW_ISCW002979 PE=3 SV=1
  785 : B7QCW8_IXOSC        0.34  0.50    2   73   55  134   80    2    8  134  B7QCW8     Neurogenic locus notch, putative (Fragment) OS=Ixodes scapularis GN=IscW_ISCW022533 PE=4 SV=1
  786 : C1BKZ0_OSMMO        0.34  0.55   93  326   22  245  235    4   12  246  C1BKZ0     Anionic trypsin-1 OS=Osmerus mordax GN=TRY1 PE=2 SV=1
  787 : C3UV51_GADMO        0.34  0.52   93  326   20  240  240    9   25  241  C3UV51     Trypsinogen I (Fragment) OS=Gadus morhua PE=2 SV=1
  788 : C3YCI0_BRAFL        0.34  0.53   93  326   22  259  243    9   14  261  C3YCI0     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_100914 PE=3 SV=1
  789 : C4TP29_THECH        0.34  0.53   93  326   20  240  240    9   25  241  C4TP29     Trypsin (Precursor) OS=Theragra chalcogramma GN=tryp PE=2 SV=3
  790 : D0G7G2_BORSA        0.34  0.53   93  326   20  240  240    9   25  241  D0G7G2     Trypsin OS=Boreogadus saida GN=tryp PE=2 SV=1
  791 : D0V536_CTEFE        0.34  0.55   93  322   25  240  232    9   18  244  D0V536     Trypsin (Fragment) OS=Ctenocephalides felis PE=2 SV=1
  792 : D2D388_9TELE        0.34  0.54   93  327   25  247  236    6   14  247  D2D388     Trypsinogen OS=Culter alburnus PE=2 SV=1
  793 : D2HP16_AILME        0.34  0.56   93  327   12  234  236    5   14  234  D2HP16     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_013482 PE=3 SV=1
  794 : D2HP34_AILME        0.34  0.53   93  327   15  237  236    5   14  238  D2HP34     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_013507 PE=3 SV=1
  795 : D3K9V3_CHACY        0.34  0.50    1   73    1   72   80    2   15  184  D3K9V3     Distal-less (Fragment) OS=Chamaeleo calyptratus GN=DLL PE=4 SV=1
  796 : D3TJK1_EPICO        0.34  0.52   93  326   21  241  238    6   21  242  D3TJK1     Pancreatic trypsinogen OS=Epinephelus coioides PE=2 SV=1
  797 : D3TS70_GLOMM        0.34  0.52   93  326   33  253  239   11   23  262  D3TS70     Salivary expressed trypsin OS=Glossina morsitans morsitans PE=2 SV=1
  798 : E0VFA8_PEDHC        0.34  0.52   93  315   29  241  231   12   26  255  E0VFA8     Trypsin, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM153440 PE=4 SV=1
  799 : E0VKQ3_PEDHC        0.34  0.55   93  327   26  258  247   11   26  259  E0VKQ3     Trypsin, putative OS=Pediculus humanus subsp. corporis GN=Phum_PHUM268620 PE=3 SV=1
  800 : E5RVK3_BOMMO        0.34  0.52   93  323    2  224  233    6   12  227  E5RVK3     Cocoonase OS=Bombyx mori GN=QH-Coc PE=2 SV=1
  801 : E7F5N1_DANRE        0.34  0.51   93  327   23  249  237    6   12  250  E7F5N1     Uncharacterized protein OS=Danio rerio GN=LOC560023 PE=3 SV=1
  802 : E9H014_DAPPU        0.34  0.50   93  326    1  214  236    8   24  215  E9H014     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_56547 PE=4 SV=1
  803 : F1PCE8_CANFA        0.34  0.54   93  327   24  246  238    7   18  246  F1PCE8     Uncharacterized protein OS=Canis familiaris GN=PRSS1 PE=3 SV=1
  804 : F1PZN9_CANFA        0.34  0.50   93  320    6  232  238   11   21  232  F1PZN9     Uncharacterized protein (Fragment) OS=Canis familiaris PE=3 SV=2
  805 : F1Q3T5_CANFA        0.34  0.57   98  320    2  222  234    8   24  228  F1Q3T5     Uncharacterized protein OS=Canis familiaris GN=LOC482172 PE=3 SV=2
  806 : F1QVC8_DANRE        0.34  0.52    2   91   69  154   91    3    6  556  F1QVC8     Uncharacterized protein (Fragment) OS=Danio rerio PE=3 SV=1
  807 : F1R612_DANRE        0.34  0.58    1   86   95  185   92    5    7  431  F1R612     Uncharacterized protein OS=Danio rerio GN=zgc:163025 PE=4 SV=1
  808 : F2XFT3_DISMA        0.34  0.50   93  326   21  241  238    7   21  242  F2XFT3     Trypsinogen H1_1f OS=Dissostichus mawsoni PE=3 SV=1
  809 : F4WTJ3_ACREC        0.34  0.56   93  322   20  244  237   10   19  248  F4WTJ3     Trypsin-7 OS=Acromyrmex echinatior GN=G5I_09191 PE=3 SV=1
  810 : F6T323_HORSE        0.34  0.56   93  327   31  253  236    6   14  254  F6T323     Uncharacterized protein (Fragment) OS=Equus caballus GN=LOC100055297 PE=3 SV=1
  811 : F6V9M1_XENTR        0.34  0.54   93  327   25  251  237    6   12  251  F6V9M1     Uncharacterized protein OS=Xenopus tropicalis GN=LOC100490788 PE=3 SV=1
  812 : F6VSH7_ORNAN        0.34  0.53   93  327   25  247  236    6   14  247  F6VSH7     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100086459 PE=3 SV=1
  813 : F6X2B2_MACMU        0.34  0.55   93  327   24  246  236    6   14  247  F6X2B2     Uncharacterized protein OS=Macaca mulatta GN=LOC716882 PE=3 SV=1
  814 : F7BIT1_MONDO        0.34  0.56   93  327   24  243  235    5   15  243  F7BIT1     Uncharacterized protein OS=Monodelphis domestica GN=LOC100010619 PE=3 SV=1
  815 : F7D9G1_XENTR        0.34  0.53   93  327   32  254  236    6   14  254  F7D9G1     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=prss1 PE=3 SV=1
  816 : F7EM73_ORNAN        0.34  0.55   93  326   24  245  237    8   18  246  F7EM73     Uncharacterized protein OS=Ornithorhynchus anatinus GN=LOC100088455 PE=3 SV=1
  817 : G1L9Y4_AILME        0.34  0.58   93  320   13  238  235    8   16  240  G1L9Y4     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=LOC100484715 PE=3 SV=1
  818 : G1LI59_AILME        0.34  0.56   93  327   24  246  238    7   18  246  G1LI59     Uncharacterized protein OS=Ailuropoda melanoleuca GN=LOC100471781 PE=3 SV=1
  819 : G1LI64_AILME        0.34  0.56   93  327   23  244  236    5   15  244  G1LI64     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca PE=3 SV=1
  820 : G1PIF1_MYOLU        0.34  0.51   93  325    2  238  247    8   24  273  G1PIF1     Uncharacterized protein (Fragment) OS=Myotis lucifugus GN=TMPRSS2 PE=3 SV=1
  821 : G1PSB0_MYOLU        0.34  0.55   93  327   24  246  236    6   14  246  G1PSB0     Uncharacterized protein (Fragment) OS=Myotis lucifugus PE=4 SV=1
  822 : G1QED3_MYOLU        0.34  0.55   93  327   24  246  236    5   14  246  G1QED3     Uncharacterized protein OS=Myotis lucifugus PE=3 SV=1
  823 : G1QQL8_NOMLE        0.34  0.54   93  327   24  246  236    6   14  247  G1QQL8     Uncharacterized protein OS=Nomascus leucogenys GN=PRSS1 PE=3 SV=1
  824 : G1U3L5_RABIT        0.34  0.56   93  327   27  249  236    6   14  249  G1U3L5     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100339606 PE=3 SV=1
  825 : G1U414_RABIT        0.34  0.55   93  327   27  249  236    5   14  249  G1U414     Uncharacterized protein OS=Oryctolagus cuniculus GN=LOC100339353 PE=3 SV=1
  826 : G3HUC0_CRIGR        0.34  0.54   93  327    2  217  235    7   19  217  G3HUC0     Anionic trypsin-2 (Fragment) OS=Cricetulus griseus GN=I79_014528 PE=3 SV=1
  827 : G3P413_GASAC        0.34  0.52   93  327    4  236  244    9   20  245  G3P413     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  828 : G3STI1_LOXAF        0.34  0.55   93  327   25  247  236    6   14  247  G3STI1     Uncharacterized protein OS=Loxodonta africana GN=LOC100670373 PE=3 SV=1
  829 : H0VF02_CAVPO        0.34  0.53   93  325   10  247  245    7   19  269  H0VF02     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=LOC100722925 PE=3 SV=1
  830 : H0Y212_OTOGA        0.34  0.54   93  327   25  247  236    6   14  247  H0Y212     Uncharacterized protein OS=Otolemur garnettii PE=3 SV=1
  831 : H3B697_LATCH        0.34  0.52   93  327   37  259  235    5   12  259  H3B697     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
  832 : H3DKT9_TETNG        0.34  0.53    1   88   88  176   90    3    3  421  H3DKT9     Uncharacterized protein OS=Tetraodon nigroviridis PE=3 SV=1
  833 : H3DMP9_TETNG        0.34  0.56   93  320   11  229  231    7   15  236  H3DMP9     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=TMPRSS9 (6 of 6) PE=3 SV=1
  834 : H9GDA9_ANOCA        0.34  0.55   93  327   25  247  236    6   14  247  H9GDA9     Uncharacterized protein OS=Anolis carolinensis GN=LOC100565603 PE=3 SV=1
  835 : I1E9D6_AMPQE        0.34  0.53    1   84  261  344   88    3    8  365  I1E9D6     Uncharacterized protein (Fragment) OS=Amphimedon queenslandica PE=4 SV=1
  836 : I3KHT2_ORENI        0.34  0.52   93  327   23  245  236    6   14  245  I3KHT2     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100534516 PE=3 SV=1
  837 : I3MAQ1_SPETR        0.34  0.56   93  327   24  246  236    6   14  246  I3MAQ1     Uncharacterized protein OS=Spermophilus tridecemlineatus PE=3 SV=1
  838 : I7HI61_9PERO        0.34  0.53   93  327   21  243  236    5   14  243  I7HI61     Trypsin OS=Lutjanus fulvus GN=trp PE=2 SV=1
  839 : K4GP09_9SAUR        0.34  0.47    2   73    2   72   79    2   15  178  K4GP09     Distal-less (Fragment) OS=Rhacodactylus auriculatus PE=4 SV=1
  840 : K4GP52_9SAUR        0.34  0.49    1   73    1   72   80    2   15  178  K4GP52     Distal-less (Fragment) OS=Leiosaurus catamarcensis PE=4 SV=1
  841 : K7F5T2_PELSI        0.34  0.53    1   86   89  172   90    5   10  477  K7F5T2     Uncharacterized protein OS=Pelodiscus sinensis GN=PROC PE=3 SV=1
  842 : L9L2C2_TUPCH        0.34  0.54   93  327   25  243  235    5   16  243  L9L2C2     Anionic trypsin OS=Tupaia chinensis GN=TREES_T100005221 PE=3 SV=1
  843 : M3WP64_FELCA        0.34  0.56   93  327   26  248  236    6   14  248  M3WP64     Uncharacterized protein (Fragment) OS=Felis catus GN=LOC101085453 PE=3 SV=1
  844 : M4AF88_XIPMA        0.34  0.55    1   91  101  193   94    3    4  442  M4AF88     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus PE=3 SV=1
  845 : N4WZY0_COCH4        0.34  0.48   93  322   31  258  242   12   26  261  N4WZY0     Uncharacterized protein OS=Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T) GN=COCC4DRAFT_45984 PE=3 SV=1
  846 : O42158_PETMA        0.34  0.51   93  327   24  247  237    6   15  247  O42158     Trypsinogen a2 (Precursor) OS=Petromyzon marinus GN=TRYPA2 PE=2 SV=1
  847 : O42608_PETMA        0.34  0.51   93  327   24  247  237    6   15  247  O42608     Trypsinogen A1 (Precursor) OS=Petromyzon marinus GN=TRYPA3 PE=2 SV=1
  848 : Q05AV3_XENLA        0.34  0.53   93  327   22  244  236    6   14  244  Q05AV3     LOC397853 protein OS=Xenopus laevis GN=LOC397853 PE=2 SV=1
  849 : Q0GYP4_SPAAU        0.34  0.52   93  326   21  240  238    6   22  241  Q0GYP4     Trypsinogen II OS=Sparus aurata GN=TRPII PE=2 SV=1
  850 : Q17LZ9_AEDAE        0.34  0.53   93  323   10  239  238    8   15  247  Q17LZ9     AAEL001178-PA (Fragment) OS=Aedes aegypti GN=AAEL001178 PE=3 SV=1
  851 : Q1AMP9_DISMA        0.34  0.53   93  326   21  241  238    6   21  242  Q1AMP9     Trypsinogen OS=Dissostichus mawsoni GN=AFGP PE=2 SV=1
  852 : Q3B898_XENLA        0.34  0.53   93  327   30  252  236    6   14  252  Q3B898     LOC397853 protein (Fragment) OS=Xenopus laevis GN=LOC397853 PE=2 SV=1
  853 : Q3SY19_HUMAN        0.34  0.57   93  327   24  246  236    6   14  247  Q3SY19     PRSS1 protein OS=Homo sapiens GN=PRSS1 PE=2 SV=1
  854 : Q4QY73_SPAAU        0.34  0.52   93  326   21  240  238    7   22  241  Q4QY73     Trypsinogen-like protein OS=Sparus aurata PE=2 SV=1
  855 : Q4QY79_SPAAU        0.34  0.52   93  326   21  240  238    6   22  241  Q4QY79     Trypsinogen 1-like protein OS=Sparus aurata PE=2 SV=1
  856 : Q4RH74_TETNG        0.34  0.57   93  320   11  233  231    7   11  234  Q4RH74     Chromosome undetermined SCAF15067, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00034480001 PE=3 SV=1
  857 : Q4RJM2_TETNG        0.34  0.53    1   88   85  173   90    3    3  418  Q4RJM2     Chromosome 3 SCAF15037, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00033373001 PE=3 SV=1
  858 : Q4RQD7_TETNG        0.34  0.54   93  320    3  229  235    9   15  230  Q4RQD7     Chromosome 17 SCAF15006, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00030653001 PE=4 SV=1
  859 : Q4TB33_TETNG        0.34  0.57    1   91  398  493   97    5    7  740  Q4TB33     Chromosome undetermined SCAF7209, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00003934001 PE=3 SV=1
  860 : Q4VSI1_PEDHC        0.34  0.54   93  327   26  261  250   11   29  262  Q4VSI1     Try2 (Fragment) OS=Pediculus humanus subsp. corporis GN=try2 PE=3 SV=1
  861 : Q4VSI2_PEDHC        0.34  0.55   93  327   26  258  247   11   26  259  Q4VSI2     Try2 OS=Pediculus humanus subsp. corporis GN=try2 PE=2 SV=1
  862 : Q547S4_BOVIN        0.34  0.54   93  327   24  246  236    5   14  247  Q547S4     Pancreatic anionic trypsinogen OS=Bos taurus GN=TRYP8 PE=3 SV=1
  863 : Q561Z7_DANRE        0.34  0.56   93  327   25  247  236    6   14  247  Q561Z7     Try protein OS=Danio rerio GN=try PE=2 SV=1
  864 : Q5EBE2_XENTR        0.34  0.53   93  327   22  244  236    6   14  244  Q5EBE2     MGC108396 protein OS=Xenopus tropicalis GN=prss1 PE=2 SV=1
  865 : Q5H728_MACMU        0.34  0.55   93  327   24  246  236    6   14  247  Q5H728     Try16 OS=Macaca mulatta GN=try16 PE=3 SV=1
  866 : Q5H729_MACMU        0.34  0.54   93  327   24  246  236    6   14  247  Q5H729     Try14 OS=Macaca mulatta GN=try14 PE=4 SV=1
  867 : Q5H733_MACMU        0.34  0.53   93  327   24  246  236    6   14  247  Q5H733     Try9 OS=Macaca mulatta GN=try9 PE=4 SV=1
  868 : Q5H734_MACMU        0.34  0.52   93  327   24  247  237    6   15  248  Q5H734     Try4 OS=Macaca mulatta GN=try4 PE=3 SV=1
  869 : Q6R670_OREAU        0.34  0.52   93  327   23  245  236    6   14  245  Q6R670     Trypsin OS=Oreochromis aureus PE=2 SV=1
  870 : Q6R671_ORENI        0.34  0.52   93  327   23  245  236    6   14  245  Q6R671     Trypsin OS=Oreochromis niloticus PE=2 SV=1
  871 : Q7SZT1_XENLA        0.34  0.53   93  327   26  248  236    6   14  248  Q7SZT1     LOC397853 protein (Fragment) OS=Xenopus laevis GN=LOC397853 PE=2 SV=1
  872 : Q9VQ97_DROME        0.34  0.51   93  325   24  243  239   13   25  245  Q9VQ97     IP02082p OS=Drosophila melanogaster GN=Ser12 PE=2 SV=1
  873 : Q9W6K0_9PERC        0.34  0.51   93  326   23  247  240    6   21  249  Q9W6K0     Trypsinogen-like serine protease OS=Notothenia coriiceps PE=2 SV=1
  874 : Q9W7Q7_PAROL        0.34  0.53   93  326   21  241  240    9   25  242  Q9W7Q7     Trypsinogen 1 OS=Paralichthys olivaceus PE=2 SV=1
  875 : R0KWP6_ANAPL        0.34  0.52   93  327    9  231  236    5   14  231  R0KWP6     Trypsin I-P1 (Fragment) OS=Anas platyrhynchos GN=Anapl_18720 PE=3 SV=1
  876 : S4RBX8_PETMA        0.34  0.52   93  327   22  246  236    6   12  247  S4RBX8     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
  877 : S4RRW9_PETMA        0.34  0.51   93  327   11  234  235    3   11  234  S4RRW9     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
  878 : S4RWE7_PETMA        0.34  0.51    2   85   69  162   94    4   10  231  S4RWE7     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=4 SV=1
  879 : S4RWE9_PETMA        0.34  0.54    2   91   69  167   99    3    9  274  S4RWE9     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=4 SV=1
  880 : S7PQQ8_MYOBR        0.34  0.54   93  327   24  246  236    5   14  246  S7PQQ8     Cationic trypsin-3 OS=Myotis brandtii GN=D623_10020783 PE=3 SV=1
  881 : T1ID92_RHOPR        0.34  0.53   93  320    1  229  236    8   15  234  T1ID92     Uncharacterized protein (Fragment) OS=Rhodnius prolixus PE=3 SV=1
  882 : T1IX45_STRMM        0.34  0.56   93  312   14  247  238    7   22  249  T1IX45     Uncharacterized protein (Fragment) OS=Strigamia maritima PE=3 SV=1
  883 : TRY1_BOVIN  2D8W    0.34  0.53   93  327   24  246  237    6   16  246  P00760     Cationic trypsin OS=Bos taurus PE=1 SV=3
  884 : TRY1_CHICK          0.34  0.53   93  327   26  248  236    6   14  248  Q90627     Trypsin I-P1 OS=Gallus gallus PE=2 SV=1
  885 : TRY1_HUMAN  1FXY    0.34  0.56   93  327   24  246  236    6   14  247  P07477     Trypsin-1 OS=Homo sapiens GN=PRSS1 PE=1 SV=1
  886 : TRY2_XENLA          0.34  0.53   93  327   22  244  236    6   14  244  P70059     Trypsin OS=Xenopus laevis PE=2 SV=1
  887 : TRY3_SALSA  1A0J    0.34  0.54   93  327   16  238  238    7   18  238  P35033     Trypsin-3 (Fragment) OS=Salmo salar PE=1 SV=1
  888 : TRY6_HUMAN          0.34  0.56   93  327   24  246  236    6   14  247  Q8NHM4     Putative trypsin-6 OS=Homo sapiens GN=PRSS3P2 PE=5 SV=2
  889 : TRYP_PHACE          0.34  0.54   93  322   30  254  238   10   21  258  O97399     Trypsin OS=Phaedon cochleariae PE=2 SV=1
  890 : U3I9W7_ANAPL        0.34  0.52   93  327   26  248  236    5   14  248  U3I9W7     Uncharacterized protein OS=Anas platyrhynchos PE=3 SV=1
  891 : U5EXZ3_9DIPT        0.34  0.59  102  326    2  225  233    9   17  235  U5EXZ3     Putative trypsin-like serine protease (Fragment) OS=Corethrella appendiculata PE=2 SV=1
  892 : W5LBG9_ASTMX        0.34  0.55   93  327   24  246  236    5   14  246  W5LBG9     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  893 : W5Q1Y9_SHEEP        0.34  0.54   93  327   24  246  237    6   16  246  W5Q1Y9     Uncharacterized protein OS=Ovis aries GN=LOC101111795 PE=4 SV=1
  894 : W5Q219_SHEEP        0.34  0.54   93  327   30  252  237    7   16  252  W5Q219     Uncharacterized protein (Fragment) OS=Ovis aries PE=4 SV=1
  895 : W5U9B9_ICTPU        0.34  0.58    1   91   96  191   97    5    7  432  W5U9B9     Coagulation factor VII OS=Ictalurus punctatus GN=F7 PE=2 SV=1
  896 : A2JDL7_CHICK        0.33  0.57   93  326   26  247  235    6   14  248  A2JDL7     Trypsinogen OS=Gallus gallus PE=3 SV=1
  897 : A7DZ33_DROSI        0.33  0.49   93  325   24  243  241   13   29  245  A7DZ33     Serine protease OS=Drosophila simulans GN=CG17240 PE=3 SV=1
  898 : A7DZ38_DROSI        0.33  0.49   93  325   24  243  241   13   29  245  A7DZ38     Serine protease OS=Drosophila simulans GN=CG17240 PE=3 SV=1
  899 : A7RKD3_NEMVE        0.33  0.45    2   86   42  126   93    3   16  277  A7RKD3     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g84597 PE=4 SV=1
  900 : A7RLC0_NEMVE        0.33  0.56   93  326   10  258  253    8   23  259  A7RLC0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g85993 PE=3 SV=1
  901 : A7RYF8_NEMVE        0.33  0.52   93  326    2  236  242    6   15  236  A7RYF8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g97944 PE=3 SV=1
  902 : A7S8Y5_NEMVE        0.33  0.54   93  326    4  238  240    7   11  240  A7S8Y5     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g109239 PE=3 SV=1
  903 : A7SNZ8_NEMVE        0.33  0.45    4   89  317  392   89    5   16  399  A7SNZ8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g125559 PE=4 SV=1
  904 : A7SQE8_NEMVE        0.33  0.53   93  327    2  245  248    7   17  246  A7SQE8     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g127469 PE=4 SV=1
  905 : A7SY01_NEMVE        0.33  0.53    1   68    4   70   75    2   15   83  A7SY01     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g137372 PE=4 SV=1
  906 : B0W771_CULQU        0.33  0.48   93  324   27  251  239   10   21  251  B0W771     Trypsin delta/gamma OS=Culex quinquefasciatus GN=CpipJ_CPIJ002937 PE=3 SV=1
  907 : B0WE92_CULQU        0.33  0.51   93  322   27  248  235    9   18  252  B0WE92     Trypsin 2 OS=Culex quinquefasciatus GN=CpipJ_CPIJ005271 PE=3 SV=1
  908 : B3N9I4_DROER        0.33  0.50   93  325   24  245  238   10   21  247  B3N9I4     GG24539 OS=Drosophila erecta GN=Dere\GG24539 PE=3 SV=1
  909 : B3V3M8_HYPMO        0.33  0.57   93  327   22  243  236    5   15  243  B3V3M8     Myofibril-bound serine proteinase OS=Hypophthalmichthys molitrix GN=MBSP PE=2 SV=1
  910 : B4GGG5_DROPE        0.33  0.49   93  322   28  244  242   12   37  248  B4GGG5     GL17341 OS=Drosophila persimilis GN=Dper\GL17341 PE=3 SV=1
  911 : C0PU26_SALSA        0.33  0.44    1   90   58  143   98    4   20  349  C0PU26     Delta-like protein D (Fragment) OS=Salmo salar GN=DLLD PE=2 SV=1
  912 : C3XS75_BRAFL        0.33  0.51    1   85 1019 1104   91    6   11 1372  C3XS75     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_89963 PE=4 SV=1
  913 : C3Y017_BRAFL        0.33  0.53   93  327    3  240  243    9   13  243  C3Y017     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_209371 PE=3 SV=1
  914 : C3Z4Q6_BRAFL        0.33  0.54   93  327    1  247  252   12   22  247  C3Z4Q6     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_243672 PE=3 SV=1
  915 : C3ZMV5_BRAFL        0.33  0.53   93  326   13  246  241    7   14  247  C3ZMV5     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_59253 PE=3 SV=1
  916 : C3ZVK3_BRAFL        0.33  0.52   93  327    3  245  250    7   22  245  C3ZVK3     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_61430 PE=4 SV=1
  917 : C6L245_PIG          0.33  0.54   93  327   24  246  236    6   14  247  C6L245     Putative trypsinogen OS=Sus scrofa GN=try PE=4 SV=1
  918 : D0V544_CTEFE        0.33  0.49   93  326    2  239  249    8   26  246  D0V544     Chymotrypsin (Fragment) OS=Ctenocephalides felis PE=2 SV=1
  919 : D2HAJ9_AILME        0.33  0.52   93  320    1  228  236    7   16  228  D2HAJ9     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_007464 PE=3 SV=1
  920 : D2HV81_AILME        0.33  0.55   93  320    3  238  241    8   18  239  D2HV81     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_016254 PE=3 SV=1
  921 : D2I2B2_AILME        0.33  0.49    1   88   94  183   92    4    6  649  D2I2B2     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_019515 PE=4 SV=1
  922 : D3Z3S5_MOUSE        0.33  0.55   97  327    1  219  233    7   16  219  D3Z3S5     Uncharacterized protein OS=Mus musculus GN=Gm4744 PE=4 SV=2
  923 : E0DBK1_9TELE        0.33  0.52   93  326    1  221  240    9   25  222  E0DBK1     Trypsin-1 (Fragment) OS=Gadus macrocephalus GN=tryp PE=2 SV=1
  924 : E0DBK2_9TELE        0.33  0.52   93  326    1  221  240    9   25  222  E0DBK2     Trypsin-2 (Fragment) OS=Gadus macrocephalus GN=tryp PE=2 SV=1
  925 : E1C996_CHICK        0.33  0.53   93  327   14  236  236    6   14  236  E1C996     Uncharacterized protein (Fragment) OS=Gallus gallus GN=LOC100857124 PE=1 SV=2
  926 : E5SBE6_TRISP        0.33  0.50   93  320   38  273  260   17   56  296  E5SBE6     Transmembrane serine protease 8 OS=Trichinella spiralis GN=Tsp_01070 PE=3 SV=1
  927 : E6ZFE9_DICLA        0.33  0.53   93  324    5  232  237    5   14  242  E6ZFE9     Trypsin OS=Dicentrarchus labrax GN=DLA_It03240 PE=3 SV=1
  928 : E9GXZ7_DAPPU        0.33  0.56   93  325   11  254  248    7   19  254  E9GXZ7     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_306713 PE=3 SV=1
  929 : F1N9P3_CHICK        0.33  0.53   93  327   26  248  236    6   14  248  F1N9P3     Uncharacterized protein OS=Gallus gallus GN=LOC768817 PE=4 SV=2
  930 : F1PSS8_CANFA        0.33  0.47    1   88  120  209   92    4    6  679  F1PSS8     Uncharacterized protein (Fragment) OS=Canis familiaris GN=PROS1 PE=4 SV=2
  931 : F6TU72_XENTR        0.33  0.52   93  325   26  267  250    8   25  277  F6TU72     Uncharacterized protein OS=Xenopus tropicalis GN=xepsin PE=4 SV=1
  932 : F6W0J7_CALJA        0.33  0.54   93  327   26  248  236    6   14  248  F6W0J7     Uncharacterized protein OS=Callithrix jacchus GN=LOC100396682 PE=3 SV=1
  933 : F6YJN1_XENTR        0.33  0.53   93  327   21  243  236    6   14  243  F6YJN1     Uncharacterized protein OS=Xenopus tropicalis PE=3 SV=1
  934 : F7GV81_CALJA        0.33  0.47    1   88   63  144   94    5   18  423  F7GV81     Uncharacterized protein OS=Callithrix jacchus GN=F9 PE=3 SV=1
  935 : F8U087_EPIBR        0.33  0.54   93  326   22  245  239    6   20  247  F8U087     Trypsinogen 3 (Fragment) OS=Epinephelus bruneus PE=2 SV=1
  936 : F8U088_EPIBR        0.33  0.50   93  327   23  249  244    8   26  250  F8U088     Trypsinogen Y (Fragment) OS=Epinephelus bruneus PE=2 SV=1
  937 : G1L6Q1_AILME        0.33  0.49    1   88  118  207   92    4    6  673  G1L6Q1     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PROS1 PE=4 SV=1
  938 : G1L6Q4_AILME        0.33  0.49    1   88  120  209   92    4    6  675  G1L6Q4     Uncharacterized protein OS=Ailuropoda melanoleuca GN=PROS1 PE=4 SV=1
  939 : G1NN41_MELGA        0.33  0.56   93  326   26  247  235    6   14  248  G1NN41     Uncharacterized protein OS=Meleagris gallopavo GN=LOC100544478 PE=3 SV=2
  940 : G1TNZ4_RABIT        0.33  0.52    1   85  120  206   90    5    8  675  G1TNZ4     Vitamin K-dependent protein S OS=Oryctolagus cuniculus GN=PROS1 PE=4 SV=2
  941 : G3NJS1_GASAC        0.33  0.53   93  327   21  243  236    6   14  243  G3NJS1     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
  942 : G3RVZ7_GORGO        0.33  0.52    1   90   84  180   97    4    7  595  G3RVZ7     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla PE=4 SV=1
  943 : G3VGZ0_SARHA        0.33  0.52   93  327   25  246  236    7   15  247  G3VGZ0     Uncharacterized protein OS=Sarcophilus harrisii GN=LOC100935321 PE=4 SV=1
  944 : G3VGZ1_SARHA        0.33  0.52   93  327   25  246  236    7   15  247  G3VGZ1     Uncharacterized protein OS=Sarcophilus harrisii GN=LOC100935321 PE=4 SV=1
  945 : G5EMQ3_THUOR        0.33  0.53   93  326   21  241  238    7   21  242  G5EMQ3     Trypsinogen 1 OS=Thunnus orientalis PE=2 SV=1
  946 : G5EMQ8_PAGMA        0.33  0.53   93  327   21  241  239    7   22  241  G5EMQ8     Trypsinogen OS=Pagrus major PE=2 SV=1
  947 : G9KIP2_MUSPF        0.33  0.49    1   88  120  209   92    4    6  380  G9KIP2     Protein S (Fragment) OS=Mustela putorius furo PE=2 SV=1
  948 : H0ZSH5_TAEGU        0.33  0.54   93  327    6  228  236    5   14  228  H0ZSH5     Uncharacterized protein (Fragment) OS=Taeniopygia guttata PE=3 SV=1
  949 : H2L6L9_ORYLA        0.33  0.54   93  327    1  236  241    6   11  237  H2L6L9     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=3 SV=1
  950 : H2RVJ0_TAKRU        0.33  0.49    2   91   93  188   98    3   10  436  H2RVJ0     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101064607 PE=3 SV=1
  951 : H2YF27_CIOSA        0.33  0.53   93  323   17  260  250    9   25  264  H2YF27     Uncharacterized protein (Fragment) OS=Ciona savignyi GN=Csa.4525 PE=3 SV=1
  952 : H3BG02_LATCH        0.33  0.48    7   91  112  187   85    3    9  279  H3BG02     Uncharacterized protein OS=Latimeria chalumnae GN=EGFL7 PE=4 SV=2
  953 : H7BYY9_HUMAN        0.33  0.43    1   84   11   93   91    2   15  300  H7BYY9     Sushi, nidogen and EGF-like domain-containing protein 1 (Fragment) OS=Homo sapiens GN=SNED1 PE=4 SV=1
  954 : I3JZT2_ORENI        0.33  0.50   93  326   21  228  238    7   34  229  I3JZT2     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100700058 PE=3 SV=1
  955 : J0M5A0_LOALO        0.33  0.43    1   86  905  987   98   10   27 1142  J0M5A0     GCC2 and GCC3 family protein OS=Loa loa GN=LOAG_17803 PE=4 SV=1
  956 : K7INR7_NASVI        0.33  0.56   93  325   16  259  248    7   19  259  K7INR7     Uncharacterized protein OS=Nasonia vitripennis PE=4 SV=1
  957 : L8HNC2_9CETA        0.33  0.51   93  327   16  253  251    7   29  253  L8HNC2     Cationic trypsin (Fragment) OS=Bos mutus GN=M91_15257 PE=3 SV=1
  958 : M3ZWY8_XIPMA        0.33  0.52   93  327   23  249  242    6   22  250  M3ZWY8     Uncharacterized protein OS=Xiphophorus maculatus PE=4 SV=1
  959 : O16126_BOLVI        0.33  0.50   94  324   19  247  239   11   18  248  O16126     Trypsinogen 1 (Precursor) OS=Boltenia villosa GN=TRYP1 PE=2 SV=1
  960 : O46151_PACLE        0.33  0.53   93  323   32  266  251    9   36  268  O46151     Trypsin (Precursor) OS=Pacifastacus leniusculus PE=3 SV=1
  961 : O76498_DIAAB        0.33  0.49   93  323   23  249  242   12   26  252  O76498     Trypsin (Precursor) OS=Diaprepes abbreviatus PE=2 SV=1
  962 : PROS_RABIT          0.33  0.52    1   85   91  177   90    5    8  646  P98118     Vitamin K-dependent protein S (Fragment) OS=Oryctolagus cuniculus GN=PROS1 PE=2 SV=1
  963 : Q0GC72_CARAU        0.33  0.56   93  327   21  242  236    5   15  242  Q0GC72     Myofibril-bound serine proteinase OS=Carassius auratus PE=2 SV=1
  964 : Q16PS2_AEDAE        0.33  0.50   93  324   33  260  241   12   22  260  Q16PS2     AAEL011549-PA OS=Aedes aegypti GN=AAEL011549 PE=3 SV=1
  965 : Q17035_ANOGA        0.33  0.51   93  326    1  228  245    8   28  237  Q17035     Serine proteinase (Fragment) OS=Anopheles gambiae PE=3 SV=1
  966 : Q5BAR4_EMENI        0.33  0.51   93  322   23  245  237   10   21  249  Q5BAR4     Serine protease similarity, trypsin family (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2366.2 PE=4 SV=1
  967 : Q5G3K5_PYGNE        0.33  0.53   93  325   18  261  251   10   25  262  Q5G3K5     Neurotrypsin (Fragment) OS=Pygathrix nemaeus GN=PRSS12 PE=3 SV=1
  968 : Q5G3K6_TRAFR        0.33  0.53   93  325   18  261  251   10   25  262  Q5G3K6     Neurotrypsin (Fragment) OS=Trachypithecus francoisi GN=PRSS12 PE=3 SV=1
  969 : Q5G3K7_PYGBI        0.33  0.53   93  325   18  261  251   10   25  262  Q5G3K7     Neurotrypsin (Fragment) OS=Pygathrix bieti GN=PRSS12 PE=3 SV=1
  970 : Q5G3K8_HOOHO        0.33  0.53   93  325   18  261  251   10   25  262  Q5G3K8     Neurotrypsin (Fragment) OS=Hoolock hoolock GN=PRSS12 PE=3 SV=1
  971 : Q6GPX7_XENLA        0.33  0.53   93  327   23  248  240    6   19  248  Q6GPX7     MGC82534 protein OS=Xenopus laevis GN=prss1.2 PE=2 SV=1
  972 : Q792Y6_MOUSE        0.33  0.56   93  327   24  246  236    6   14  246  Q792Y6     MCG4990, isoform CRA_e OS=Mus musculus GN=Prss2 PE=2 SV=1
  973 : Q7M754_MOUSE        0.33  0.57   93  327   24  246  236    6   14  246  Q7M754     Try10-like trypsinogen (Precursor) OS=Mus musculus GN=Gm5409 PE=2 SV=1
  974 : Q8I916_BLOTA        0.33  0.51   93  321   36  260  240   12   26  266  Q8I916     Trypsin OS=Blomia tropicalis PE=2 SV=1
  975 : Q98TH0_9TELE        0.33  0.53   93  327   20  240  239    6   22  240  Q98TH0     Trypsinogen OS=Engraulis japonicus PE=2 SV=1
  976 : Q9XYX9_RHYDO        0.33  0.55   93  324   30  248  238   11   25  248  Q9XYX9     Trypsinogen RdoT1 OS=Rhyzopertha dominica PE=2 SV=1
  977 : R4GMN6_HUMAN        0.33  0.50   93  327   40  280  260   15   44  281  R4GMN6     Complement C1r subcomponent (Fragment) OS=Homo sapiens GN=C1R PE=4 SV=1
  978 : R7VQ01_COLLI        0.33  0.52   93  326    4  242  251   11   29  242  R7VQ01     Kallikrein-11 (Fragment) OS=Columba livia GN=A306_10309 PE=3 SV=1
  979 : S4RN25_PETMA        0.33  0.53   93  321    1  231  237   10   14  235  S4RN25     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=3 SV=1
  980 : TRY1_CANFA          0.33  0.53   93  327   24  246  238    7   18  246  P06871     Cationic trypsin OS=Canis familiaris PE=2 SV=1
  981 : TRY2_BOVIN          0.33  0.54   93  327   24  246  236    5   14  247  Q29463     Anionic trypsin OS=Bos taurus PE=2 SV=1
  982 : TRY2_CHICK          0.33  0.53   93  327   26  248  236    6   14  248  Q90628     Trypsin I-P38 OS=Gallus gallus PE=2 SV=1
  983 : TRY2_MOUSE          0.33  0.56   93  327   24  246  236    6   14  246  P07146     Anionic trypsin-2 OS=Mus musculus GN=Prss2 PE=2 SV=1
  984 : TRY3_CHICK          0.33  0.57   93  326   26  247  235    6   14  248  Q90629     Trypsin II-P29 OS=Gallus gallus PE=2 SV=1
  985 : TRYP_SQUAC          0.33  0.56   93  326    8  228  234    4   13  229  P00764     Trypsin OS=Squalus acanthias PE=1 SV=1
  986 : V4ABF0_LOTGI        0.33  0.55    1   84   44  125   89    5   12  240  V4ABF0     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_120770 PE=4 SV=1
  987 : W4XH78_STRPU        0.33  0.49    2   85   52  135   87    4    6  326  W4XH78     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Fbln2L_2 PE=4 SV=1
  988 : W4YHG0_STRPU        0.33  0.43    1   90  118  200   97    4   21 1184  W4YHG0     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Nlr165 PE=4 SV=1
  989 : W5JZA3_ASTMX        0.33  0.51    2   84   30  114   86    3    4  196  W5JZA3     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  990 : W5LCV6_ASTMX        0.33  0.44    1   88  319  402   98    8   24  684  W5LCV6     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
  991 : W5MUX2_LEPOC        0.33  0.48    1   88  112  197   90    5    6  702  W5MUX2     Uncharacterized protein OS=Lepisosteus oculatus PE=4 SV=1
  992 : W5MUX6_LEPOC        0.33  0.48    1   88  112  197   90    5    6  664  W5MUX6     Uncharacterized protein OS=Lepisosteus oculatus PE=4 SV=1
  993 : W5UAJ3_ICTPU        0.33  0.47    1   84  319  398   94    8   24  684  W5UAJ3     Delta-like protein 4 OS=Ictalurus punctatus GN=DLL4 PE=2 SV=1
  994 : A1KXI1_BLOTA        0.32  0.51   93  321   36  260  240   12   26  266  A1KXI1     Blo t 3 allergen OS=Blomia tropicalis PE=2 SV=1
  995 : A7RHH9_NEMVE        0.32  0.47    1   86  805  884   93    4   20 1576  A7RHH9     Predicted protein OS=Nematostella vectensis GN=v1g197208 PE=4 SV=1
  996 : A7RKX5_NEMVE        0.32  0.50   93  325    2  240  243   10   14  240  A7RKX5     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g85362 PE=3 SV=1
  997 : A7RVQ9_NEMVE        0.32  0.45    1   84  154  236   91    2   15  262  A7RVQ9     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g60307 PE=4 SV=1
  998 : A7S431_NEMVE        0.32  0.49    1   85  156  234   92    4   20  423  A7S431     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g103841 PE=4 SV=1
  999 : A7SDB3_NEMVE        0.32  0.53   93  322    4  235  238    7   14  244  A7SDB3     Predicted protein OS=Nematostella vectensis GN=v1g210516 PE=3 SV=1
 1000 : A7SQF0_NEMVE        0.32  0.53   93  327    5  250  249    8   17  251  A7SQF0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g127472 PE=4 SV=1
 1001 : A7SY07_NEMVE        0.32  0.49    1   73   38  109   80    2   15  109  A7SY07     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g46960 PE=4 SV=1
 1002 : A7SYX0_NEMVE        0.32  0.43    2   84    1   84   91    3   15  113  A7SYX0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g138442 PE=4 SV=1
 1003 : A7T118_NEMVE        0.32  0.48    1   84    4   86   91    2   15  116  A7T118     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g141165 PE=4 SV=1
 1004 : A8PZ08_BRUMA        0.32  0.41    1   82 2067 2146   94    9   26 2304  A8PZ08     GCC2 and GCC3 family protein OS=Brugia malayi GN=Bm1_40760 PE=4 SV=1
 1005 : B0V2R4_DANRE        0.32  0.45    1   91  710  794   99    6   22 2424  B0V2R4     Notch homolog 2 (Fragment) OS=Danio rerio GN=notch2 PE=4 SV=1
 1006 : B4JQ66_DROGR        0.32  0.49   93  322   29  250  240   12   28  254  B4JQ66     GH13258 OS=Drosophila grimshawi GN=Dgri\GH13258 PE=3 SV=1
 1007 : B4JVW1_DROGR        0.32  0.53   93  323   12  239  245   12   31  243  B4JVW1     GH22928 OS=Drosophila grimshawi GN=Dgri\GH22928 PE=3 SV=1
 1008 : B4K0E5_DROGR        0.32  0.49   93  323    8  224  238   10   28  234  B4K0E5     GH11999 OS=Drosophila grimshawi GN=Dgri\GH11999 PE=3 SV=1
 1009 : B4KFB8_DROMO        0.32  0.50   93  320   35  254  234    8   20  260  B4KFB8     GI17455 OS=Drosophila mojavensis GN=Dmoj\GI17455 PE=3 SV=1
 1010 : B4MVW4_DROWI        0.32  0.45    1   91  159  243   98    4   20 2119  B4MVW4     GK15151 OS=Drosophila willistoni GN=Dwil\GK15151 PE=4 SV=1
 1011 : B4NW78_DROYA        0.32  0.50   93  325   24  242  240   15   28  244  B4NW78     GE15159 OS=Drosophila yakuba GN=Dyak\GE15159 PE=3 SV=1
 1012 : B4QB84_DROSI        0.32  0.49   93  326   28  260  250   15   33  262  B4QB84     GD25909 OS=Drosophila simulans GN=Dsim\GD25909 PE=4 SV=1
 1013 : C3XPW9_BRAFL        0.32  0.45    1   82 1217 1295   92    6   23 2122  C3XPW9     Uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_118457 PE=4 SV=1
 1014 : C3Y636_BRAFL        0.32  0.46    1   84  227  304   92    6   22  706  C3Y636     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_231904 PE=4 SV=1
 1015 : C3Y637_BRAFL        0.32  0.50    1   87   86  172   92    6   10  338  C3Y637     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_231922 PE=4 SV=1
 1016 : C3YIX6_BRAFL        0.32  0.47    1   85 1432 1510   94    7   24 2251  C3YIX6     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_101341 PE=4 SV=1
 1017 : C3Z6I6_BRAFL        0.32  0.53    1   84    9   92   88    3    8  341  C3Z6I6     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_232309 PE=4 SV=1
 1018 : D2I407_AILME        0.32  0.54   93  321    4  230  241    8   26  230  D2I407     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_020297 PE=3 SV=1
 1019 : D3TKX6_GLOMM        0.32  0.48   93  326   22  248  244   13   27  249  D3TKX6     Trypsin (Fragment) OS=Glossina morsitans morsitans PE=2 SV=1
 1020 : E2BYI8_HARSA        0.32  0.49   93  327   13  264  256   10   25  265  E2BYI8     Transmembrane protease, serine 9 (Fragment) OS=Harpegnathos saltator GN=EAI_08942 PE=4 SV=1
 1021 : E4Y518_OIKDI        0.32  0.43    2   84  969 1046   94    8   27 1473  E4Y518     Whole genome shotgun assembly, allelic scaffold set, scaffold scaffoldA_9 OS=Oikopleura dioica GN=GSOID_T00018656001 PE=4 SV=1
 1022 : E4YLU0_OIKDI        0.32  0.54    1   85   86  170   90    6   10  471  E4YLU0     Whole genome shotgun assembly, allelic scaffold set, scaffold scaffoldA_506 OS=Oikopleura dioica GN=GSOID_T00029458001 PE=4 SV=1
 1023 : E9HMR4_DAPPU        0.32  0.48   93  326   25  253  248   14   33  254  E9HMR4     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_262285 PE=3 SV=1
 1024 : F1R9H8_DANRE        0.32  0.45    1   91  761  845   99    6   22 2475  F1R9H8     Uncharacterized protein OS=Danio rerio GN=notch2 PE=4 SV=1
 1025 : F4MI42_9DIPT        0.32  0.50   93  322    1  223  234    6   15  227  F4MI42     Putative trypsin 3 (Fragment) OS=Phlebotomus perniciosus PE=2 SV=1
 1026 : F6XAG7_CIOIN        0.32  0.51   93  325    9  263  257   10   26  263  F6XAG7     Uncharacterized protein (Fragment) OS=Ciona intestinalis GN=LOC100176526 PE=3 SV=2
 1027 : F6ZSM2_ORNAN        0.32  0.44    2   75   25   97   82    4   17  164  F6ZSM2     Uncharacterized protein OS=Ornithorhynchus anatinus PE=4 SV=2
 1028 : F7AFK1_HORSE        0.32  0.52   93  327    2  228  243   11   24  228  F7AFK1     Uncharacterized protein (Fragment) OS=Equus caballus GN=KLK12 PE=3 SV=1
 1029 : F7C1N9_MACMU        0.32  0.44    2   91   68  151   97    4   20  600  F7C1N9     Uncharacterized protein OS=Macaca mulatta PE=4 SV=1
 1030 : F7E3F0_XENTR        0.32  0.45    1   90  191  280   96    7   12  554  F7E3F0     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=oit3 PE=4 SV=1
 1031 : F7G6J5_MACMU        0.32  0.49    1   91   63  147   97    5   18  423  F7G6J5     Uncharacterized protein OS=Macaca mulatta GN=F9 PE=3 SV=1
 1032 : G1ND81_MELGA        0.32  0.47    1   85  175  264   93    6   11 1452  G1ND81     Uncharacterized protein (Fragment) OS=Meleagris gallopavo PE=4 SV=2
 1033 : G3H4U5_CRIGR        0.32  0.42    1   85  265  344   93    5   21  999  G3H4U5     Sushi, nidogen and EGF-like domain-containing protein 1 OS=Cricetulus griseus GN=I79_005307 PE=4 SV=1
 1034 : G3HXU1_CRIGR        0.32  0.50    1   84   77  160   92    9   16  773  G3HXU1     Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Cricetulus griseus GN=I79_015855 PE=4 SV=1
 1035 : G3NA58_GASAC        0.32  0.54    1   85  250  338   93    8   12 1537  G3NA58     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
 1036 : G3NA60_GASAC        0.32  0.54    1   85  128  216   93    8   12 1158  G3NA60     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
 1037 : G3PBK6_GASAC        0.32  0.52   93  326   24  248  237    7   15  249  G3PBK6     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=3 SV=1
 1038 : G3PRG0_GASAC        0.32  0.49    1   89  113  199   92    7    8  652  G3PRG0     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
 1039 : G3PRG5_GASAC        0.32  0.49    1   89  108  194   92    7    8  644  G3PRG5     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
 1040 : G8HT92_ACRMI        0.32  0.50    2   89   49  138   92    6    6  470  G8HT92     Putative uncharacterized protein OS=Acropora millepora PE=2 SV=1
 1041 : H2L3H1_ORYLA        0.32  0.55   93  325    1  232  241    8   17  232  H2L3H1     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101170186 PE=3 SV=1
 1042 : H2LBK3_ORYLA        0.32  0.46    1   85 1903 1986   90    8   11 2881  H2LBK3     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101171649 PE=4 SV=1
 1043 : H2RVJ3_TAKRU        0.32  0.47    2   80   89  173   87    3   10  438  H2RVJ3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101064607 PE=3 SV=1
 1044 : H2SA43_TAKRU        0.32  0.51    1   91   88  176   94    5    8  459  H2SA43     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101069699 PE=3 SV=1
 1045 : H2SA44_TAKRU        0.32  0.51    1   91   79  167   94    5    8  444  H2SA44     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101069699 PE=3 SV=1
 1046 : H2T4V6_TAKRU        0.32  0.51   93  327   22  247  238    8   15  247  H2T4V6     Uncharacterized protein OS=Takifugu rubripes GN=LOC101064664 PE=3 SV=1
 1047 : H2T4V9_TAKRU        0.32  0.51   93  327   23  248  237    7   13  248  H2T4V9     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101064664 PE=3 SV=1
 1048 : H2U6E7_TAKRU        0.32  0.51    1   84  144  233   92    7   10  398  H2U6E7     Uncharacterized protein OS=Takifugu rubripes GN=LOC101074850 PE=4 SV=1
 1049 : H2Y4D8_CIOSA        0.32  0.47    2   84  471  545   90    4   22 1095  H2Y4D8     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1050 : H3BAK8_LATCH        0.32  0.48    2   76   98  174   79    2    6  174  H3BAK8     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=4 SV=1
 1051 : H3D304_TETNG        0.32  0.55    2   86   23  115   95    6   12  326  H3D304     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=4 SV=1
 1052 : H3D4F4_TETNG        0.32  0.49   93  327   23  248  237    7   13  248  H3D4F4     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
 1053 : I1GIZ1_AMPQE        0.32  0.49    1   85  261  347   94    7   16 3134  I1GIZ1     Uncharacterized protein OS=Amphimedon queenslandica PE=4 SV=1
 1054 : I2NA45_9ACTO        0.32  0.54   93  324   18  235  237   10   24  235  I2NA45     Trypsin-like serine protease OS=Streptomyces tsukubaensis NRRL18488 GN=STSU_03297 PE=3 SV=1
 1055 : I3JE02_ORENI        0.32  0.41    2   84  715  791   91    6   22 1213  I3JE02     Delta-like protein OS=Oreochromis niloticus GN=LOC100710579 PE=3 SV=1
 1056 : I3JE03_ORENI        0.32  0.41    2   84  759  835   91    6   22 1257  I3JE03     Delta-like protein OS=Oreochromis niloticus GN=LOC100710579 PE=3 SV=1
 1057 : I3KA42_ORENI        0.32  0.53    1   85   33  122   93    7   11 1315  I3KA42     Uncharacterized protein OS=Oreochromis niloticus GN=megf6 PE=4 SV=1
 1058 : I3KA43_ORENI        0.32  0.53    1   85  252  341   93    7   11 1513  I3KA43     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=megf6 PE=4 SV=1
 1059 : J9F9R7_WUCBA        0.32  0.43    1   82 1054 1133   94    9   26 1170  J9F9R7     GCC2 and GCC3 family protein (Fragment) OS=Wuchereria bancrofti GN=WUBG_02771 PE=4 SV=1
 1060 : J9QWU2_9CRUS        0.32  0.53   93  320    7  232  233    7   12  237  J9QWU2     Trypsin 610 (Fragment) OS=Daphnia magna PE=2 SV=1
 1061 : K1QMW2_CRAGI        0.32  0.45    1   84  184  267   92    4   16  354  K1QMW2     Neurogenic locus notch-like protein 1 OS=Crassostrea gigas GN=CGI_10020352 PE=4 SV=1
 1062 : K1R9L7_CRAGI        0.32  0.43    2   85  391  468   92    6   22 2528  K1R9L7     Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Crassostrea gigas GN=CGI_10019507 PE=4 SV=1
 1063 : K7ZG86_BDEBC        0.32  0.52   93  323   29  254  240   10   23  256  K7ZG86     Trypsin OS=Bdellovibrio bacteriovorus str. Tiberius GN=Bdt_2544 PE=3 SV=1
 1064 : L5JN69_PTEAL        0.32  0.51   93  327   44  293  263    8   41  294  L5JN69     Mannan-binding lectin serine protease 1 OS=Pteropus alecto GN=PAL_GLEAN10018229 PE=3 SV=1
 1065 : L7N2M3_XENTR        0.32  0.49   93  327    9  234  244   10   27  241  L7N2M3     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=klk1 PE=3 SV=1
 1066 : M3VY57_FELCA        0.32  0.52   93  325    2  249  252    7   23  256  M3VY57     Uncharacterized protein (Fragment) OS=Felis catus GN=OVCH2 PE=3 SV=1
 1067 : M3ZVI8_XIPMA        0.32  0.53   93  327  357  612  271   12   51  617  M3ZVI8     Uncharacterized protein OS=Xiphophorus maculatus PE=3 SV=1
 1068 : N6TLD4_DENPD        0.32  0.41    6   73   34  101   76    3   16  108  N6TLD4     Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae GN=D910_00405 PE=4 SV=1
 1069 : Q16ZU5_AEDAE        0.32  0.44    1   85 1898 1978   95    8   24 3400  Q16ZU5     AAEL008069-PA OS=Aedes aegypti GN=AAEL008069 PE=4 SV=1
 1070 : Q17036_ANOGA        0.32  0.52   93  321   10  240  240   11   20  250  Q17036     Serine proteinase (Fragment) OS=Anopheles gambiae PE=3 SV=1
 1071 : Q170P5_AEDAE        0.32  0.45    1   85   66  144   92    4   20 1780  Q170P5     AAEL007856-PA OS=Aedes aegypti GN=AAEL007856 PE=4 SV=1
 1072 : Q179B1_AEDAE        0.32  0.50   93  324   20  247  238    8   16  247  Q179B1     AAEL005689-PA OS=Aedes aegypti GN=AAEL005689 PE=3 SV=1
 1073 : Q2WBY6_PLADU        0.32  0.46    1   86  893  972   94    6   22 2030  Q2WBY6     Notch protein (Fragment) OS=Platynereis dumerilii GN=notch PE=2 SV=1
 1074 : Q4G030_RAT          0.32  0.49   93  327  121  363  268   17   58  364  Q4G030     C1r protein (Fragment) OS=Rattus norvegicus GN=C1r PE=2 SV=1
 1075 : Q4S8A4_TETNG        0.32  0.55    2   86   49  141   95    6   12  306  Q4S8A4     Chromosome undetermined SCAF14706, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00022441001 PE=4 SV=1
 1076 : Q5M902_XENTR        0.32  0.51   93  327   24  243  236    5   17  243  Q5M902     Trypsin 10 OS=Xenopus tropicalis GN=try10 PE=2 SV=1
 1077 : Q6GYJ5_STRCA        0.32  0.54   93  326    9  230  235    5   14  231  Q6GYJ5     Pancreatic trypsinogen (Fragment) OS=Struthio camelus PE=2 SV=2
 1078 : Q7PPC0_ANOGA        0.32  0.43    1   84 1166 1250   90    6   11 1619  Q7PPC0     AGAP005714-PA OS=Anopheles gambiae GN=AGAP005714 PE=4 SV=4
 1079 : R0JGZ4_ANAPL        0.32  0.52   93  327    5  229  237    6   14  229  R0JGZ4     Kallikrein-6 (Fragment) OS=Anas platyrhynchos GN=Anapl_17536 PE=3 SV=1
 1080 : R7UZW8_CAPTE        0.32  0.44    1   85 1873 1949   91    4   20 3301  R7UZW8     Uncharacterized protein OS=Capitella teleta GN=CAPTEDRAFT_223674 PE=4 SV=1
 1081 : R7VKE8_CAPTE        0.32  0.51   93  325    2  239  240    7    9  239  R7VKE8     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_113671 PE=3 SV=1
 1082 : S4RCJ2_PETMA        0.32  0.51    6   81   91  171   82    5    7  208  S4RCJ2     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=4 SV=1
 1083 : S4RVB8_PETMA        0.32  0.48   93  327   24  263  251    7   27  263  S4RVB8     Uncharacterized protein OS=Petromyzon marinus PE=4 SV=1
 1084 : T1P8A5_MUSDO        0.32  0.53   93  326    5  231  243   10   25  232  T1P8A5     Trypsin OS=Musca domestica PE=2 SV=1
 1085 : U3I9C5_ANAPL        0.32  0.49    7   91  115  194   85    4    5  271  U3I9C5     Uncharacterized protein OS=Anas platyrhynchos GN=EGFL7 PE=4 SV=1
 1086 : U5EUD2_9DIPT        0.32  0.43    2   83  489  564   91    8   24  809  U5EUD2     Delta-like protein OS=Corethrella appendiculata PE=2 SV=1
 1087 : V3ZYI7_LOTGI        0.32  0.50   93  324    2  233  241   11   18  234  V3ZYI7     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_143960 PE=4 SV=1
 1088 : V4AW62_LOTGI        0.32  0.45    1   84  111  189   92    5   21  829  V4AW62     Uncharacterized protein OS=Lottia gigantea GN=LOTGIDRAFT_139219 PE=4 SV=1
 1089 : V4BQ35_LOTGI        0.32  0.50   93  326    2  238  243    9   15  238  V4BQ35     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_122275 PE=4 SV=1
 1090 : V4CH98_LOTGI        0.32  0.44    2   85  401  481   94   10   23  739  V4CH98     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_200309 PE=4 SV=1
 1091 : V8P4X1_OPHHA        0.32  0.48    1   86  305  386   96    8   24  681  V8P4X1     Delta-like protein (Fragment) OS=Ophiophagus hannah GN=DLL4 PE=3 SV=1
 1092 : W4WAW0_ATTCE        0.32  0.48   93  325  287  549  269   12   42  549  W4WAW0     Uncharacterized protein OS=Atta cephalotes PE=4 SV=1
 1093 : W4XV34_STRPU        0.32  0.41    2   88  619  699   95    6   22  859  W4XV34     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-EfgiaL PE=4 SV=1
 1094 : W4YWJ5_STRPU        0.32  0.43    1   82  245  320   90    6   22  535  W4YWJ5     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Egfib_9 PE=4 SV=1
 1095 : W4YYP3_STRPU        0.32  0.55    1   861115011237   91    5    811309  W4YYP3     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-MucD PE=4 SV=1
 1096 : W4Z2X5_STRPU        0.32  0.46    1   88  469  550   95    4   20 1267  W4Z2X5     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Clect/Egf_13 PE=4 SV=1
 1097 : W5JHR2_ANODA        0.32  0.42    2   85  195  273   93    7   23  468  W5JHR2     Uncharacterized protein OS=Anopheles darlingi GN=AND_005874 PE=4 SV=1
 1098 : W5P4X8_SHEEP        0.32  0.47    1   85  332  408   94    7   26  615  W5P4X8     Uncharacterized protein (Fragment) OS=Ovis aries GN=DLL1 PE=4 SV=1
 1099 : A7RKD0_NEMVE        0.31  0.46    2   84    1   82   90    2   15  113  A7RKD0     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g62405 PE=4 SV=1
 1100 : A7S0V1_NEMVE        0.31  0.46    1   86   35  119   93    2   15  228  A7S0V1     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g100228 PE=4 SV=1
 1101 : A7S6D2_NEMVE        0.31  0.45    1   84   42  124   91    2   15  169  A7S6D2     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g106413 PE=4 SV=1
 1102 : A7S9G1_NEMVE        0.31  0.54   93  325    1  242  247    8   19  245  A7S9G1     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g109826 PE=4 SV=1
 1103 : A7SP50_NEMVE        0.31  0.44    1   86   75  161   88    2    3  186  A7SP50     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g125705 PE=4 SV=1
 1104 : A7SR73_NEMVE        0.31  0.42    2   84   88  168   95    8   26  480  A7SR73     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g173414 PE=4 SV=1
 1105 : A7SR74_NEMVE        0.31  0.44    1   73   39  113   80    2   12  118  A7SR74     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g128484 PE=4 SV=1
 1106 : A7STC0_NEMVE        0.31  0.44    1   84  165  247   90    7   13  386  A7STC0     Predicted protein OS=Nematostella vectensis GN=v1g130899 PE=4 SV=1
 1107 : A7T191_NEMVE        0.31  0.41    2   68    1   66   75    4   17   71  A7T191     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g44265 PE=4 SV=1
 1108 : A8P933_BRUMA        0.31  0.52   93  325    4  235  247   12   29  245  A8P933     Trypsin family protein (Fragment) OS=Brugia malayi GN=Bm1_19535 PE=3 SV=1
 1109 : A9VBM5_MONBE        0.31  0.44    1   88 1238 1319   96    6   22 4310  A9VBM5     Predicted protein OS=Monosiga brevicollis GN=29619 PE=4 SV=1
 1110 : B3N9I5_DROER        0.31  0.48   93  325   24  225  238   14   41  227  B3N9I5     GG24538 OS=Drosophila erecta GN=Dere\GG24538 PE=3 SV=1
 1111 : B3RPA9_TRIAD        0.31  0.43    1   84    5   86   95    7   24  547  B3RPA9     Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_21402 PE=4 SV=1
 1112 : B3RY71_TRIAD        0.31  0.54   93  327    2  238  249   10   26  238  B3RY71     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_25686 PE=3 SV=1
 1113 : B4K3A4_DROGR        0.31  0.44    1   85  520  600   95    8   24  768  B4K3A4     GH12702 (Fragment) OS=Drosophila grimshawi GN=Dgri\GH12702 PE=4 SV=1
 1114 : B4KK09_DROMO        0.31  0.46    1   91   47  131   98    4   20 1976  B4KK09     GI14162 OS=Drosophila mojavensis GN=Dmoj\GI14162 PE=4 SV=1
 1115 : B7S8U3_GLYIN        0.31  0.47   93  324   13  230  236   11   22  232  B7S8U3     Chymotrypsin-like protein OS=Glyptapanteles indiensis GN=GIP_L3_0210 PE=3 SV=1
 1116 : C3XPW7_BRAFL        0.31  0.45    1   88 1397 1473   96    6   27 1796  C3XPW7     Uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_67440 PE=4 SV=1
 1117 : C3Y021_BRAFL        0.31  0.48   93  327   24  216  238    9   48  216  C3Y021     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_57891 PE=3 SV=1
 1118 : C3Y565_BRAFL        0.31  0.41    1   84   14   96   91    2   15  105  C3Y565     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_235995 PE=4 SV=1
 1119 : C3Y635_BRAFL        0.31  0.49    1   67   33  107   75    2    8  109  C3Y635     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_160505 PE=4 SV=1
 1120 : C3YCB8_BRAFL        0.31  0.50    1   85  973 1057   90    5   10 2705  C3YCB8     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_88051 PE=4 SV=1
 1121 : C3YG96_BRAFL        0.31  0.49    1   82 1259 1337   91    5   21 1715  C3YG96     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_92840 PE=4 SV=1
 1122 : C3YMV5_BRAFL        0.31  0.43    7   86  235  325   94    7   17  528  C3YMV5     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_117022 PE=4 SV=1
 1123 : C3Z3I6_BRAFL        0.31  0.45    1   86  118  197   95    7   24  496  C3Z3I6     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_215890 PE=4 SV=1
 1124 : C3Z4M5_BRAFL        0.31  0.46   93  320    1  183  232    3   53  183  C3Z4M5     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_243675 PE=3 SV=1
 1125 : C3Z8C5_BRAFL        0.31  0.51    1   86  171  253   89    5    9  319  C3Z8C5     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_233007 PE=4 SV=1
 1126 : C3ZHH7_BRAFL        0.31  0.54    1   91  578  669   96    8    9  960  C3ZHH7     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_79554 PE=4 SV=1
 1127 : C3ZKF7_BRAFL        0.31  0.41    2   84  120  196   91    7   22  389  C3ZKF7     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_69402 PE=4 SV=1
 1128 : C3ZTC7_BRAFL        0.31  0.45    1   86 1986 2063   94    6   24 4468  C3ZTC7     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_68801 PE=4 SV=1
 1129 : C3ZXG9_BRAFL        0.31  0.43    2   85  804  888   91    6   13 2532  C3ZXG9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_105734 PE=4 SV=1
 1130 : D3TKN2_GLOMM        0.31  0.49   93  320   10  229  235   10   22  236  D3TKN2     Trypsin-like serine protease (Fragment) OS=Glossina morsitans morsitans PE=2 SV=1
 1131 : D3TR36_GLOMM        0.31  0.50   93  320   28  248  237   11   25  255  D3TR36     Midgut trypsin OS=Glossina morsitans morsitans PE=2 SV=1
 1132 : D3TR38_GLOMM        0.31  0.50   93  320   28  247  236   11   24  254  D3TR38     Midgut trypsin OS=Glossina morsitans morsitans PE=2 SV=1
 1133 : D6W8V9_TRICA        0.31  0.41    1   85 2114 2194   95    8   24 3631  D6W8V9     Putative uncharacterized protein SP1070 OS=Tribolium castaneum GN=SP1070 PE=4 SV=1
 1134 : E0VSI2_PEDHC        0.31  0.44    2   86  619  697   94    8   24 1214  E0VSI2     Delta-like protein OS=Pediculus humanus subsp. corporis GN=Phum_PHUM419360 PE=3 SV=1
 1135 : E1ZYB5_CAMFO        0.31  0.44    1   82  258  334   90    5   21  755  E1ZYB5     Delta-like protein OS=Camponotus floridanus GN=EAG_06456 PE=3 SV=1
 1136 : E4XD92_OIKDI        0.31  0.41    2   84 1020 1097   94    8   27 1632  E4XD92     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_24 OS=Oikopleura dioica GN=GSOID_T00008131001 PE=4 SV=1
 1137 : E4XGM3_OIKDI        0.31  0.57    1   84  397  484   90    3    8 1431  E4XGM3     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_34 OS=Oikopleura dioica GN=GSOID_T00010636001 PE=4 SV=1
 1138 : E4XRP5_OIKDI        0.31  0.54    1   85   77  161   90    6   10  462  E4XRP5     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_107 OS=Oikopleura dioica GN=GSOID_T00001833001 PE=4 SV=1
 1139 : E4YEU7_OIKDI        0.31  0.57    1   84  397  484   90    3    8 1443  E4YEU7     Whole genome shotgun assembly, allelic scaffold set, scaffold scaffoldA_195 OS=Oikopleura dioica GN=GSOID_T00022012001 PE=4 SV=1
 1140 : E4YMX0_OIKDI        0.31  0.45    5   85 3251 3336   91   10   15 3336  E4YMX0     Whole genome shotgun assembly, allelic scaffold set, scaffold scaffoldA_574 (Fragment) OS=Oikopleura dioica GN=GSOID_T00029869001 PE=4 SV=1
 1141 : E4YQY7_OIKDI        0.31  0.51    1   86  399  490   95    7   12 1035  E4YQY7     Whole genome shotgun assembly, allelic scaffold set, scaffold scaffoldA_807 OS=Oikopleura dioica GN=GSOID_T00031373001 PE=4 SV=1
 1142 : E4YY80_OIKDI        0.31  0.51    1   86  882  973   95    7   12 1548  E4YY80     Whole genome shotgun assembly, allelic scaffold set, scaffold scaffoldA_1642 (Fragment) OS=Oikopleura dioica GN=GSOID_T00022416001 PE=4 SV=1
 1143 : E5S025_TRISP        0.31  0.47   93  326   39  298  267   13   40  309  E5S025     Peptidase, S1A subfamily OS=Trichinella spiralis GN=Tsp_08945 PE=3 SV=1
 1144 : E5SGD5_TRISP        0.31  0.49    1   87  262  351   93    5    9 1081  E5SGD5     Putative GCC2 and GCC3 protein OS=Trichinella spiralis GN=Tsp_06534 PE=4 SV=1
 1145 : E7FFP9_DANRE        0.31  0.46    1   84  114  198   90    6   11 1513  E7FFP9     Uncharacterized protein OS=Danio rerio GN=megf6a PE=4 SV=1
 1146 : E9CH58_CAPO3        0.31  0.50    1   85  317  404   90    5    7 1544  E9CH58     Egfl6-prov protein OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_07512 PE=4 SV=1
 1147 : E9HAG8_DAPPU        0.31  0.49   93  327    6  242  247   11   22  243  E9HAG8     Putative uncharacterized protein (Fragment) OS=Daphnia pulex GN=DAPPUDRAFT_60449 PE=4 SV=1
 1148 : E9HEP9_DAPPU        0.31  0.48    1   85  189  267   94    7   24  606  E9HEP9     Putative uncharacterized protein OS=Daphnia pulex GN=DAPPUDRAFT_129960 PE=4 SV=1
 1149 : E9QHA9_DANRE        0.31  0.46    1   84   57  141   90    6   11 1446  E9QHA9     Uncharacterized protein OS=Danio rerio GN=megf6a PE=4 SV=1
 1150 : F1NE59_CHICK        0.31  0.48    1   84 1235 1312   91    4   20 3687  F1NE59     Uncharacterized protein OS=Gallus gallus GN=SVEP1 PE=4 SV=2
 1151 : F1QUS5_DANRE        0.31  0.43    1   84   55  149   97    9   15  727  F1QUS5     Uncharacterized protein OS=Danio rerio GN=eltd1 PE=4 SV=1
 1152 : F4W815_ACREC        0.31  0.49   93  327    7  258  256   10   25  259  F4W815     Serine proteinase stubble OS=Acromyrmex echinatior GN=G5I_01592 PE=4 SV=1
 1153 : F6R222_CIOIN        0.31  0.45    1   85 1705 1790   91    9   11 2156  F6R222     Uncharacterized protein (Fragment) OS=Ciona intestinalis PE=4 SV=2
 1154 : F6V6A8_MONDO        0.31  0.50   93  324   10  251  252   10   30  251  F6V6A8     Uncharacterized protein (Fragment) OS=Monodelphis domestica GN=LOC100022135 PE=3 SV=1
 1155 : F7B4M7_MONDO        0.31  0.42    1   86  756  835   95    8   24 2485  F7B4M7     Uncharacterized protein OS=Monodelphis domestica GN=NOTCH1 PE=4 SV=1
 1156 : F7BHV7_MACMU        0.31  0.45   93  326  313  564  267   15   48  564  F7BHV7     Uncharacterized protein OS=Macaca mulatta GN=PLAT PE=3 SV=1
 1157 : F7C6H1_ORNAN        0.31  0.49   93  326   20  262  261   16   45  264  F7C6H1     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=C1RL PE=4 SV=1
 1158 : F7ETM0_CALJA        0.31  0.43    7   90  111  186   84    3    8  272  F7ETM0     Uncharacterized protein OS=Callithrix jacchus GN=EGFL7 PE=4 SV=1
 1159 : F7EWU8_ORNAN        0.31  0.45    1   85  267  353   96    9   20  548  F7EWU8     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=FBLN1 PE=4 SV=1
 1160 : F7FYT6_CALJA        0.31  0.43    7   90   70  145   84    3    8  244  F7FYT6     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=EGFL7 PE=4 SV=1
 1161 : F7H974_MACMU        0.31  0.44    1   83 2155 2234   91    5   19 2436  F7H974     Uncharacterized protein OS=Macaca mulatta GN=FAT4 PE=4 SV=1
 1162 : F7HHF4_MACMU        0.31  0.44    1   90  269  349   95    6   19 1228  F7HHF4     Uncharacterized protein OS=Macaca mulatta GN=MEGF6 PE=4 SV=1
 1163 : F7HN53_MACMU        0.31  0.44    1   83 2162 2241   91    5   19 3220  F7HN53     Uncharacterized protein OS=Macaca mulatta GN=FAT4 PE=4 SV=1
 1164 : G1KQA3_ANOCA        0.31  0.36    2   86 4048 4127   94    7   23 4612  G1KQA3     Uncharacterized protein OS=Anolis carolinensis GN=FAT3 PE=4 SV=2
 1165 : G1L6Q0_AILME        0.31  0.43    6   90  118  199   87    5    7  295  G1L6Q0     Uncharacterized protein OS=Ailuropoda melanoleuca GN=EGFL8 PE=4 SV=1
 1166 : G1RQS0_NOMLE        0.31  0.45   93  326  311  562  267   15   48  562  G1RQS0     Uncharacterized protein OS=Nomascus leucogenys GN=PLAT PE=3 SV=1
 1167 : G3PDA8_GASAC        0.31  0.48    1   84    3   86   88    4    8  348  G3PDA8     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
 1168 : G3PRG3_GASAC        0.31  0.49    1   89  114  203   93    6    7  664  G3PRG3     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
 1169 : G3PX14_GASAC        0.31  0.46    1   85 2583 2666   90    8   11 3563  G3PX14     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus GN=FBN1 PE=4 SV=1
 1170 : G3UCP4_LOXAF        0.31  0.40    7   90  120  195   85    4   10  283  G3UCP4     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=EGFL7 PE=4 SV=1
 1171 : G3VR37_SARHA        0.31  0.42    1   86  756  835   95    8   24 2672  G3VR37     Uncharacterized protein OS=Sarcophilus harrisii GN=NOTCH1 PE=4 SV=1
 1172 : G3VR38_SARHA        0.31  0.42    1   86  757  836   95    8   24 2538  G3VR38     Uncharacterized protein OS=Sarcophilus harrisii GN=NOTCH1 PE=4 SV=1
 1173 : G5C7R7_HETGA        0.31  0.44    1   90  447  531   99    7   23  786  G5C7R7     Delta-like protein OS=Heterocephalus glaber GN=GW7_11304 PE=3 SV=1
 1174 : G7MZ73_MACMU        0.31  0.45   93  326  311  562  267   15   48  562  G7MZ73     Tissue-type plasminogen activator OS=Macaca mulatta GN=PLAT PE=2 SV=1
 1175 : G7NQR3_MACMU        0.31  0.52   93  327   13  256  254    9   29  257  G7NQR3     Tryptase alpha-1 (Fragment) OS=Macaca mulatta GN=EGK_12329 PE=3 SV=1
 1176 : G7PBR4_MACFA        0.31  0.45   93  326  311  562  267   15   48  562  G7PBR4     Tissue-type plasminogen activator OS=Macaca fascicularis GN=EGM_17275 PE=3 SV=1
 1177 : H0W6S3_CAVPO        0.31  0.52   93  326   14  257  258   11   38  267  H0W6S3     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=PRSS27 PE=3 SV=1
 1178 : H0Z6C6_TAEGU        0.31  0.43    2   84  212  298   91    7   12 2267  H0Z6C6     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=STAB1 PE=4 SV=1
 1179 : H0Z7A8_TAEGU        0.31  0.48    2   86  214  297   93    4   17  339  H0Z7A8     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=SNED1 PE=4 SV=1
 1180 : H2L430_ORYLA        0.31  0.47    1   86  302  382   95    6   23  627  H2L430     Delta-like protein (Fragment) OS=Oryzias latipes GN=LOC101170775 PE=3 SV=1
 1181 : H2LHK3_ORYLA        0.31  0.54    1   85  128  217   93    7   11 1140  H2LHK3     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101160063 PE=4 SV=1
 1182 : H2LHK6_ORYLA        0.31  0.54    1   85  170  259   93    7   11 1431  H2LHK6     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101160063 PE=4 SV=1
 1183 : H2LXA2_ORYLA        0.31  0.50    1   91   83  175   94    4    4  467  H2LXA2     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101156578 PE=3 SV=1
 1184 : H2MPY8_ORYLA        0.31  0.47    1   84    3   86   88    4    8  381  H2MPY8     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
 1185 : H2MZH4_ORYLA        0.31  0.48    1   85 1977 2059   90    7   12 2412  H2MZH4     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=4 SV=1
 1186 : H2P7A3_PONAB        0.31  0.45    1   86   79  151   88    5   17  427  H2P7A3     Uncharacterized protein OS=Pongo abelii GN=PROC PE=3 SV=2
 1187 : H2S135_TAKRU        0.31  0.44    2   86    1   88   96    6   19  587  H2S135     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101077826 PE=4 SV=1
 1188 : H2TVQ8_TAKRU        0.31  0.49   93  324   17  256  250   12   28  258  H2TVQ8     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101064621 PE=4 SV=1
 1189 : H2UQM7_TAKRU        0.31  0.51    1   85  250  339   93    7   11 1537  H2UQM7     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
 1190 : H2UQM8_TAKRU        0.31  0.51    1   85  244  333   93    7   11 1463  H2UQM8     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
 1191 : H2UQM9_TAKRU        0.31  0.51    1   85  219  308   93    7   11  560  H2UQM9     Uncharacterized protein (Fragment) OS=Takifugu rubripes PE=4 SV=1
 1192 : H2USM7_TAKRU        0.31  0.48    2   85  313  399   91    6   11  997  H2USM7     Uncharacterized protein OS=Takifugu rubripes PE=4 SV=1
 1193 : H2Y4D9_CIOSA        0.31  0.44    2   84  388  465   93    6   25  682  H2Y4D9     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1194 : H2YMQ9_CIOSA        0.31  0.44    2   84  261  335   91    6   24  402  H2YMQ9     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1195 : H3AI72_LATCH        0.31  0.49   93  320   25  275  257   11   35  278  H3AI72     Uncharacterized protein (Fragment) OS=Latimeria chalumnae PE=3 SV=1
 1196 : H3CDA3_TETNG        0.31  0.42    2   84  927 1006   93    7   23 1499  H3CDA3     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
 1197 : H3DGG6_TETNG        0.31  0.42    2   84  925 1004   93    7   23 1504  H3DGG6     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=3 SV=1
 1198 : H3E7C2_PRIPA        0.31  0.49    1   84   95  179   89    4    9  300  H3E7C2     Uncharacterized protein OS=Pristionchus pacificus GN=WBGene00095161 PE=4 SV=1
 1199 : H7C557_HUMAN        0.31  0.43    1   90  382  462   95    6   19 1323  H7C557     Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens GN=MEGF6 PE=4 SV=2
 1200 : H9FVV9_MACMU        0.31  0.45   93  326  311  562  267   15   48  562  H9FVV9     Tissue-type plasminogen activator isoform 1 preproprotein OS=Macaca mulatta GN=PLAT PE=2 SV=1
 1201 : I1EAH1_AMPQE        0.31  0.53    1   84  167  249   89    5   11  407  I1EAH1     Uncharacterized protein (Fragment) OS=Amphimedon queenslandica GN=LOC100636478 PE=4 SV=1
 1202 : I3IUH1_ORENI        0.31  0.40    2   85  933 1013   94    7   23 1557  I3IUH1     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100705354 PE=3 SV=1
 1203 : I3JR09_ORENI        0.31  0.52    1   88   68  156   90    3    3  378  I3JR09     Uncharacterized protein (Fragment) OS=Oreochromis niloticus GN=PROZ (1 of 2) PE=4 SV=1
 1204 : I3NG97_SPETR        0.31  0.47    1   90  355  435   95    6   19 1319  I3NG97     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus PE=4 SV=1
 1205 : K0K9Q0_SACES        0.31  0.50   93  326   24  247  243   10   28  249  K0K9Q0     Trypsin-like protein OS=Saccharothrix espanaensis (strain ATCC 51144 / DSM 44229 / JCM 9112 / NBRC 15066 / NRRL 15764) GN=BN6_70320 PE=3 SV=1
 1206 : L5KXF6_PTEAL        0.31  0.54   93  325  370  640  272   12   40  644  L5KXF6     Prothrombin OS=Pteropus alecto GN=PAL_GLEAN10018124 PE=3 SV=1
 1207 : L9KIW1_TUPCH        0.31  0.43    1   83 1538 1617   91    5   19 2618  L9KIW1     Protocadherin Fat 4 OS=Tupaia chinensis GN=TREES_T100015073 PE=4 SV=1
 1208 : LYAM3_MOUSE 4GXB    0.31  0.43    2   84  163  244   91    6   17  768  Q01102     P-selectin OS=Mus musculus GN=Selp PE=1 SV=1
 1209 : M3X1G7_FELCA        0.31  0.53    1   84  288  379   93    6   10 1542  M3X1G7     Uncharacterized protein OS=Felis catus GN=MEGF6 PE=4 SV=1
 1210 : M3ZJA3_XIPMA        0.31  0.45    2   87  255  340   91    6   10  997  M3ZJA3     Uncharacterized protein OS=Xiphophorus maculatus PE=4 SV=1
 1211 : O16004_LYTVA        0.31  0.47    1   86  630  709   94    6   22 2531  O16004     Notch homolog OS=Lytechinus variegatus PE=2 SV=1
 1212 : Q0IFC0_AEDAE        0.31  0.56   93  324    8  250  247    7   19  251  Q0IFC0     AAEL005906-PA OS=Aedes aegypti GN=AAEL005906 PE=4 SV=1
 1213 : Q5RGG6_DANRE        0.31  0.42    1   87  282  364   96    6   22  645  Q5RGG6     Delta-like protein (Fragment) OS=Danio rerio GN=dll4 PE=3 SV=1
 1214 : Q5SPB5_DANRE        0.31  0.42    1   87  320  402   96    6   22  683  Q5SPB5     Delta-like protein OS=Danio rerio GN=dll4 PE=3 SV=2
 1215 : Q7KPY6_LUCCU        0.31  0.44    2   86  125  210   94    4   17  227  Q7KPY6     Notch homolog (Fragment) OS=Lucilia cuprina GN=Scl PE=4 SV=1
 1216 : Q7SY09_DANRE        0.31  0.43    1   84   55  149   97    9   15  726  Q7SY09     Zgc:63629 OS=Danio rerio GN=eltd1 PE=2 SV=1
 1217 : Q8T5W7_CAERE        0.31  0.42    1   74    5   82   85    4   18  129  Q8T5W7     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
 1218 : Q8T5W8_CAERE        0.31  0.43    1   73    4   80   84    4   18  128  Q8T5W8     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
 1219 : Q8T5W9_CAERE        0.31  0.42    1   73    3   79   84    4   18  127  Q8T5W9     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
 1220 : Q8T5X1_CAERE        0.31  0.42    1   73    4   80   84    4   18  128  Q8T5X1     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
 1221 : Q8T5X2_CAERE        0.31  0.44    1   73    3   79   84    4   18  127  Q8T5X2     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
 1222 : Q8T5X4_CAERE        0.31  0.41    1   74    5   82   85    4   18  129  Q8T5X4     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
 1223 : Q9GNU3_PARLI        0.31  0.40    1   86 2098 2177   94    6   22 2656  Q9GNU3     Fibrosurfin (Precursor) OS=Paracentrotus lividus GN=surfin2656 PE=2 SV=1
 1224 : R0L536_ANAPL        0.31  0.49   93  324    6  228  240   10   25  228  R0L536     Kallikrein-11 (Fragment) OS=Anas platyrhynchos GN=Anapl_17535 PE=3 SV=1
 1225 : R0LEM5_ANAPL        0.31  0.49   93  326  134  383  266   14   48  395  R0LEM5     Urokinase-type plasminogen activator (Fragment) OS=Anas platyrhynchos GN=Anapl_00140 PE=3 SV=1
 1226 : R4GCU2_ANOCA        0.31  0.47    7   91  112  193   86    4    5  223  R4GCU2     Uncharacterized protein OS=Anolis carolinensis GN=EGFL7 PE=4 SV=1
 1227 : S4R9X3_PETMA        0.31  0.44    1   86   14   98   93    2   15  208  S4R9X3     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=SNED1 PE=4 SV=1
 1228 : S4R9X6_PETMA        0.31  0.44    1   86    2   86   93    2   15  236  S4R9X6     Uncharacterized protein (Fragment) OS=Petromyzon marinus GN=SNED1 PE=4 SV=1
 1229 : S4RVC1_PETMA        0.31  0.45   93  327   22  236  239    8   28  236  S4RVC1     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=4 SV=1
 1230 : S7N681_MYOBR        0.31  0.47    1   86  320  399   90    5   14 1190  S7N681     Pro-epidermal growth factor OS=Myotis brandtii GN=D623_10030582 PE=4 SV=1
 1231 : T1G3K4_HELRO        0.31  0.43    2   75    3   74   81    2   16   81  T1G3K4     Uncharacterized protein (Fragment) OS=Helobdella robusta GN=HELRODRAFT_79117 PE=4 SV=1
 1232 : T1IF48_RHOPR        0.31  0.43    1   85   56  136   95    8   24 1541  T1IF48     Uncharacterized protein (Fragment) OS=Rhodnius prolixus PE=4 SV=1
 1233 : TRYP_SARBU          0.31  0.50   93  326   27  253  243   11   25  254  P51588     Trypsin OS=Sarcophaga bullata PE=1 SV=1
 1234 : U3IQP2_ANAPL        0.31  0.49   93  326  173  422  266   14   48  434  U3IQP2     Uncharacterized protein OS=Anas platyrhynchos GN=PLAU PE=3 SV=1
 1235 : U3IYJ9_ANAPL        0.31  0.47    1   85  170  259   93    7   11 1422  U3IYJ9     Uncharacterized protein (Fragment) OS=Anas platyrhynchos PE=4 SV=1
 1236 : U3K2S4_FICAL        0.31  0.44    2   84  239  325   91    7   12 2610  U3K2S4     Uncharacterized protein OS=Ficedula albicollis GN=STAB1 PE=4 SV=1
 1237 : U4TY67_DENPD        0.31  0.44    2   86  323  402   94    7   23 2100  U4TY67     Uncharacterized protein OS=Dendroctonus ponderosae GN=D910_02361 PE=3 SV=1
 1238 : U5Y6P8_PERVI        0.31  0.43    2   84  167  249   93    4   20  322  U5Y6P8     PVFP-2 (Fragment) OS=Perna viridis PE=2 SV=1
 1239 : V3YVI1_LOTGI        0.31  0.51   93  324   16  245  242    6   22  245  V3YVI1     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_84942 PE=4 SV=1
 1240 : V4AGQ6_LOTGI        0.31  0.43    1   85 1172 1250   93    6   22 3777  V4AGQ6     Uncharacterized protein OS=Lottia gigantea GN=LOTGIDRAFT_233055 PE=4 SV=1
 1241 : V4AMS9_LOTGI        0.31  0.49   93  326    2  233  245    9   24  233  V4AMS9     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_66705 PE=4 SV=1
 1242 : V4B093_LOTGI        0.31  0.53    1   91  436  515   95    4   19 1639  V4B093     Uncharacterized protein OS=Lottia gigantea GN=LOTGIDRAFT_231078 PE=4 SV=1
 1243 : V4BQ38_LOTGI        0.31  0.47   93  325    1  232  245    9   25  232  V4BQ38     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_122334 PE=4 SV=1
 1244 : W2SQQ2_NECAM        0.31  0.52   93  325    6  237  243    9   21  241  W2SQQ2     Trypsin OS=Necator americanus GN=NECAME_04722 PE=4 SV=1
 1245 : W4XAL5_STRPU        0.31  0.49    1   86  274  352   93    5   21  488  W4XAL5     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Egfib_3 PE=4 SV=1
 1246 : W4XDC5_STRPU        0.31  0.42    1   85  984 1059   93    6   25 1063  W4XDC5     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Fbn1 PE=4 SV=1
 1247 : W4XNI8_STRPU        0.31  0.44    1   84  576  656   95    7   25  812  W4XNI8     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Notch2-8 PE=4 SV=1
 1248 : W4Y1Q7_STRPU        0.31  0.46    1   86  204  283   93    4   20 2027  W4Y1Q7     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Prss7_1 PE=4 SV=1
 1249 : W4YGW9_STRPU        0.31  0.46    1   86  405  484   94    6   22 2556  W4YGW9     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Notchh1_10 PE=4 SV=1
 1250 : W4YSC6_STRPU        0.31  0.42    1   85  203  280   93    7   23 1157  W4YSC6     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Notch2_4 PE=4 SV=1
 1251 : W4YUY3_STRPU        0.31  0.40    2   83 1562 1647   95    9   22 1962  W4YUY3     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Hyalin2 PE=4 SV=1
 1252 : W4ZAI0_STRPU        0.31  0.40    2   85  505  586   96    9   26  625  W4ZAI0     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Egfib_2 PE=4 SV=1
 1253 : W5JB01_ANODA        0.31  0.40    1   85 2061 2141   95    8   24 3565  W5JB01     Notch OS=Anopheles darlingi GN=AND_006698 PE=4 SV=1
 1254 : W5LKR7_ASTMX        0.31  0.44    1   84   71  150   93    6   22 1385  W5LKR7     Uncharacterized protein (Fragment) OS=Astyanax mexicanus PE=4 SV=1
 1255 : W5MTM5_LEPOC        0.31  0.52    1   86  314  404   94    6   11 1604  W5MTM5     Uncharacterized protein OS=Lepisosteus oculatus PE=4 SV=1
 1256 : W5MTN8_LEPOC        0.31  0.52    1   86  312  402   94    6   11 1612  W5MTN8     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=4 SV=1
 1257 : A2A442_MOUSE        0.30  0.46    1   84   77  166   94    8   14  992  A2A442     Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus GN=Scube1 PE=2 SV=1
 1258 : A7E306_BOVIN        0.30  0.48    4   85  776  862   90    8   11 1305  A7E306     NID2 protein OS=Bos taurus GN=NID2 PE=2 SV=1
 1259 : A7S2E6_NEMVE        0.30  0.50    1   75   35  108   82    2   15  114  A7S2E6     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g101796 PE=4 SV=1
 1260 : A7SQ46_NEMVE        0.30  0.41    1   82  343  421   92    6   23  807  A7SQ46     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g127166 PE=4 SV=1
 1261 : A7SSR9_NEMVE        0.30  0.50   93  327    2  248  251   10   20  260  A7SSR9     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g130234 PE=4 SV=1
 1262 : A7SSY8_NEMVE        0.30  0.51    1   86  112  200   90    3    5  491  A7SSY8     Predicted protein OS=Nematostella vectensis GN=v1g216996 PE=4 SV=1
 1263 : A7T6R5_NEMVE        0.30  0.47    1   86   85  169   93    2   15  240  A7T6R5     Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g148151 PE=4 SV=1
 1264 : A8Q038_BRUMA        0.30  0.42    5   82  839  914   90    9   26 1255  A8Q038     EGF-like domain containing protein OS=Brugia malayi GN=Bm1_39150 PE=3 SV=1
 1265 : B0W514_CULQU        0.30  0.47    1   85   95  173   92    4   20 1705  B0W514     Crumbs OS=Culex quinquefasciatus GN=CpipJ_CPIJ001497 PE=4 SV=1
 1266 : B1AHL2_HUMAN        0.30  0.45    1   85  440  524   96    9   22  721  B1AHL2     Fibulin-1 OS=Homo sapiens GN=FBLN1 PE=2 SV=1
 1267 : B1AHL4_HUMAN        0.30  0.45    1   85  402  486   96    9   22  601  B1AHL4     Fibulin-1 OS=Homo sapiens GN=FBLN1 PE=2 SV=1
 1268 : B3N9K1_DROER        0.30  0.44    1   91  173  257   99    6   22 2163  B3N9K1     GG24848 OS=Drosophila erecta GN=Dere\GG24848 PE=4 SV=1
 1269 : B3NFA8_DROER        0.30  0.47    1   85  815  899   90    6   10 1533  B3NFA8     GG14439 OS=Drosophila erecta GN=Dere\GG14439 PE=4 SV=1
 1270 : B3RX46_TRIAD        0.30  0.49    5   84    1   78   86    2   14  214  B3RX46     Putative uncharacterized protein (Fragment) OS=Trichoplax adhaerens GN=TRIADDRAFT_25024 PE=4 SV=1
 1271 : B3RZV5_TRIAD        0.30  0.36    6   84  185  265   89    5   18  316  B3RZV5     Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_57591 PE=4 SV=1
 1272 : B4DUV1_HUMAN        0.30  0.45    1   85  360  444   96    9   22  641  B4DUV1     cDNA FLJ53207, highly similar to Homo sapiens fibulin 1 (FBLN1), transcript variant C, mRNA OS=Homo sapiens PE=2 SV=1
 1273 : B4HV95_DROSE        0.30  0.47    1   85  794  878   90    6   10 1632  B4HV95     GM14855 OS=Drosophila sechellia GN=Dsec\GM14855 PE=4 SV=1
 1274 : B4KD59_DROMO        0.30  0.41    2   82  491  565   90    8   24  861  B4KD59     Delta-like protein OS=Drosophila mojavensis GN=Dmoj\GI24477 PE=3 SV=1
 1275 : B4NIU4_DROWI        0.30  0.41    2   82  501  575   90    8   24  863  B4NIU4     Delta-like protein OS=Drosophila willistoni GN=Dwil\GK13480 PE=3 SV=1
 1276 : B4NWN2_DROYA        0.30  0.44    1   91  159  243   99    6   22 2157  B4NWN2     GE18127 OS=Drosophila yakuba GN=Dyak\GE18127 PE=4 SV=1
 1277 : B4PC96_DROYA        0.30  0.48    1   85  791  875   90    6   10 1624  B4PC96     GE21630 OS=Drosophila yakuba GN=Dyak\GE21630 PE=4 SV=1
 1278 : B4QKV7_DROSI        0.30  0.47    1   85  794  878   90    6   10 1605  B4QKV7     GD14025 OS=Drosophila simulans GN=Dsim\GD14025 PE=4 SV=1
 1279 : B4Y0U8_AMPQE        0.30  0.44    1   84  518  596   93    7   23 1665  B4Y0U8     Notch OS=Amphimedon queenslandica PE=2 SV=1
 1280 : B5A5B0_MOUSE        0.30  0.50   93  327   29  269  256   10   36  270  B5A5B0     Tryptase alpha/beta 1 OS=Mus musculus GN=Tpsab1 PE=4 SV=1
 1281 : B7Q438_IXOSC        0.30  0.40    1   85 1219 1297   94    7   24 1597  B7Q438     Neurogenic locus notch, putative OS=Ixodes scapularis GN=IscW_ISCW011066 PE=4 SV=1
 1282 : C3Y015_BRAFL        0.30  0.47   93  322   14  246  247    6   31  246  C3Y015     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_209214 PE=4 SV=1
 1283 : C3Y516_BRAFL        0.30  0.49   93  326   11  211  242   10   49  226  C3Y516     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_60416 PE=3 SV=1
 1284 : C3Y8R7_BRAFL        0.30  0.49   93  327   23  261  258   13   42  261  C3Y8R7     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_200682 PE=3 SV=1
 1285 : C3YLW1_BRAFL        0.30  0.48    1   86   90  175   94    3   16  220  C3YLW1     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_227194 PE=4 SV=1
 1286 : C3YMD2_BRAFL        0.30  0.49    2   88    1   94   94    1    7  151  C3YMD2     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_178382 PE=4 SV=1
 1287 : C3YTK2_BRAFL        0.30  0.42    1   85  715  799   90    6   10 2236  C3YTK2     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_66626 PE=4 SV=1
 1288 : C3Z3P4_BRAFL        0.30  0.40    1   86  135  214   94    6   22  328  C3Z3P4     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_211833 PE=4 SV=1
 1289 : C3ZC95_BRAFL        0.30  0.55    1   83   77  161   87    2    6  195  C3ZC95     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_214814 PE=4 SV=1
 1290 : C3ZC96_BRAFL        0.30  0.43    1   86   43  128   90    3    8  201  C3ZC96     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_214736 PE=4 SV=1
 1291 : C3ZJN5_BRAFL        0.30  0.48    1   85   81  167   89    2    6  206  C3ZJN5     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_140040 PE=4 SV=1
 1292 : C3ZK82_BRAFL        0.30  0.45    2   88  313  402   99    8   21  422  C3ZK82     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_69479 PE=4 SV=1
 1293 : C3ZMI6_BRAFL        0.30  0.41    2   86    1   84   92    2   15  194  C3ZMI6     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_233362 PE=4 SV=1
 1294 : C3ZQT1_BRAFL        0.30  0.46    1   86   46  130   93    2   15  297  C3ZQT1     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_144886 PE=4 SV=1
 1295 : C3ZW46_BRAFL        0.30  0.44    6   84    1   78   87    4   17  106  C3ZW46     Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_270316 PE=4 SV=1
 1296 : D2HF76_AILME        0.30  0.44    1   86  945 1029   96    8   21 1225  D2HF76     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_009506 PE=4 SV=1
 1297 : D2I365_AILME        0.30  0.43    6   90  118  199   87    5    7  292  D2I365     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_019925 PE=4 SV=1
 1298 : E0CZJ3_DANRE        0.30  0.44    2   85  224  309   90    5   10 2553  E0CZJ3     FEEL-1 OS=Danio rerio GN=FEEL-1 PE=2 SV=1
 1299 : E1BEB4_BOVIN        0.30  0.45    1   86  880  964   96    8   21 1160  E1BEB4     Uncharacterized protein OS=Bos taurus GN=FBLN2 PE=4 SV=2
 1300 : E1ZM81_CHLVA        0.30  0.47   93  321    1  229  240    8   22  229  E1ZM81     Putative uncharacterized protein (Fragment) OS=Chlorella variabilis GN=CHLNCDRAFT_11918 PE=3 SV=1
 1301 : E2RBU8_CANFA        0.30  0.43    2   86 1044 1122   94    8   24 1353  E2RBU8     Uncharacterized protein (Fragment) OS=Canis familiaris GN=NCAN PE=4 SV=2
 1302 : E4XQK3_OIKDI        0.30  0.54    1   90  714  804   96    6   11 1058  E4XQK3     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_92 OS=Oikopleura dioica GN=GSOID_T00017956001 PE=4 SV=1
 1303 : E5RZ89_TRISP        0.30  0.40    1   87  274  351   96    8   27  562  E5RZ89     Putative ShTK domain protein OS=Trichinella spiralis GN=Tsp_07482 PE=4 SV=1
 1304 : E9BWA3_CAPO3        0.30  0.51    1   84  337  424   90    5    8 1826  E9BWA3     Tyrosine-protein kinase SRK3 OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_00604 PE=4 SV=2
 1305 : E9BWU0_CAPO3        0.30  0.50    1   85  319  406   90    4    7 1563  E9BWU0     Uncharacterized protein OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_00007 PE=4 SV=2
 1306 : E9CEJ9_CAPO3        0.30  0.51    1   84  333  420   90    5    8 1824  E9CEJ9     Tyrosine-protein kinase transforming protein SEA OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_06234 PE=4 SV=2
 1307 : E9CFS4_CAPO3        0.30  0.51    1   84  307  394   90    5    8 1727  E9CFS4     Tyrosine-protein kinase transforming protein SEA OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_06964 PE=4 SV=2
 1308 : EGFL7_HUMAN         0.30  0.40    7   90  111  186   84    3    8  273  Q9UHF1     Epidermal growth factor-like protein 7 OS=Homo sapiens GN=EGFL7 PE=1 SV=3
 1309 : EGF_CANFA           0.30  0.49    1   86  326  405   90    5   14 1216  Q9BEA0     Pro-epidermal growth factor OS=Canis familiaris GN=EGF PE=2 SV=1
 1310 : EYS_DROME           0.30  0.44    1   91  185  269   99    6   22 2176  A0A1F4     Protein eyes shut OS=Drosophila melanogaster GN=eys PE=1 SV=1
 1311 : F1LS74_RAT          0.30  0.41    2   86  928 1010   97    8   26 1530  F1LS74     Slit homolog 1 protein OS=Rattus norvegicus GN=Slit1 PE=3 SV=2
 1312 : F1LWU8_RAT          0.30  0.47    1   85    4   88   89    3    8  384  F1LWU8     Protein Egfem1 (Fragment) OS=Rattus norvegicus GN=Egfem1 PE=4 SV=2
 1313 : F1M450_RAT          0.30  0.41    2   86  928 1010   97    8   26 1472  F1M450     Slit homolog 1 protein OS=Rattus norvegicus GN=Slit1 PE=4 SV=2
 1314 : F1M987_RAT          0.30  0.46    1   84   77  166   94    8   14 1018  F1M987     Protein Scube1 OS=Rattus norvegicus GN=Scube1 PE=4 SV=1
 1315 : F1MF97_BOVIN        0.30  0.48    4   85  774  860   90    8   11 1303  F1MF97     Uncharacterized protein OS=Bos taurus GN=NID2 PE=4 SV=2
 1316 : F1MJF1_BOVIN        0.30  0.47    1   84   49  138   94    9   14  960  F1MJF1     Uncharacterized protein (Fragment) OS=Bos taurus GN=SCUBE1 PE=4 SV=2
 1317 : F1NB27_CHICK        0.30  0.48    6   86   99  184   87    5    7  396  F1NB27     Uncharacterized protein OS=Gallus gallus GN=DLK2 PE=4 SV=2
 1318 : F1NDL4_CHICK        0.30  0.50    4   85  599  685   90    8   11 1215  F1NDL4     Uncharacterized protein OS=Gallus gallus GN=NID2 PE=4 SV=2
 1319 : F1PQD9_CANFA        0.30  0.46    1   84   49  138   94    8   14  988  F1PQD9     Uncharacterized protein (Fragment) OS=Canis familiaris GN=SCUBE1 PE=4 SV=1
 1320 : F1PRU3_CANFA        0.30  0.45    1   86  937 1021   96    8   21 1217  F1PRU3     Uncharacterized protein OS=Canis familiaris GN=FBLN2 PE=4 SV=2
 1321 : F1PWS8_CANFA        0.30  0.49    1   86  326  405   90    5   14 1216  F1PWS8     Pro-epidermal growth factor OS=Canis familiaris GN=EGF PE=4 SV=2
 1322 : F1QCA1_DANRE        0.30  0.52    2   84   98  181   87    6    7  378  F1QCA1     Neurogenic locus notch homolog protein 1 (Fragment) OS=Danio rerio GN=notch1a PE=4 SV=1
 1323 : F1QZF2_DANRE        0.30  0.40    1   88  827  908   96    6   22 2468  F1QZF2     Uncharacterized protein OS=Danio rerio GN=notch3 PE=4 SV=1
 1324 : F1R731_DANRE        0.30  0.41    1   85  574  661   92    7   11  940  F1R731     Uncharacterized protein (Fragment) OS=Danio rerio PE=4 SV=1
 1325 : F1R9V2_DANRE        0.30  0.43    2   86    5   83   93    6   22  309  F1R9V2     Uncharacterized protein (Fragment) OS=Danio rerio GN=ncanb PE=4 SV=1
 1326 : F1RPW3_PIG          0.30  0.43    2   84  163  244   92    7   19  646  F1RPW3     Uncharacterized protein OS=Sus scrofa GN=SELP PE=4 SV=2
 1327 : F1SPG5_PIG          0.30  0.46    1   86  942 1026   96    8   21 1222  F1SPG5     Uncharacterized protein OS=Sus scrofa GN=LOC100738595 PE=4 SV=2
 1328 : F4WM36_ACREC        0.30  0.40    1   82  287  363   90    5   21  753  F4WM36     Delta-like protein OS=Acromyrmex echinatior GN=G5I_06869 PE=3 SV=1
 1329 : F6SPW4_CIOIN        0.30  0.42    2   84   55  130   92    7   25  474  F6SPW4     Uncharacterized protein OS=Ciona intestinalis GN=LOC100179046 PE=4 SV=2
 1330 : F6XA19_XENTR        0.30  0.42    1   85  900  978   93    6   22 2428  F6XA19     Uncharacterized protein (Fragment) OS=Xenopus tropicalis GN=notch3 PE=4 SV=1
 1331 : F6Y5I8_HORSE        0.30  0.42    1   84  895  976   93    8   20 1174  F6Y5I8     Uncharacterized protein OS=Equus caballus GN=FBLN2 PE=4 SV=1
 1332 : F6YCN2_HORSE        0.30  0.42    1   84  892  973   93    8   20 1171  F6YCN2     Uncharacterized protein (Fragment) OS=Equus caballus GN=FBLN2 PE=4 SV=1
 1333 : F7EDD2_MONDO        0.30  0.51    4   85  803  889   90    8   11 1419  F7EDD2     Uncharacterized protein OS=Monodelphis domestica GN=NID2 PE=4 SV=1
 1334 : F7EWZ8_CALJA        0.30  0.49   93  327    2  244  256   11   34  245  F7EWZ8     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=TPSD1 PE=3 SV=1
 1335 : F7EX33_ORNAN        0.30  0.43    1   84   94  179   96    8   22  639  F7EX33     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=PROS1 PE=4 SV=2
 1336 : F7HI44_MACMU        0.30  0.44    1   84   72  160   93    9   13  992  F7HI44     Uncharacterized protein OS=Macaca mulatta GN=SCUBE3 PE=4 SV=1
 1337 : F7HPC2_CALJA        0.30  0.46    1   84   77  166   94    8   14  972  F7HPC2     Uncharacterized protein OS=Callithrix jacchus GN=SCUBE1 PE=4 SV=1
 1338 : F8W7M9_HUMAN        0.30  0.45    1   85  402  486   96    9   22  703  F8W7M9     Fibulin-1 OS=Homo sapiens GN=FBLN1 PE=2 SV=1
 1339 : FBLN1_CHLAE         0.30  0.45    1   85  317  401   96    9   22  598  Q8MJJ9     Fibulin-1 (Fragment) OS=Chlorocebus aethiops GN=FBLN1 PE=1 SV=1
 1340 : FBLN1_HUMAN         0.30  0.45    1   85  402  486   96    9   22  703  P23142     Fibulin-1 OS=Homo sapiens GN=FBLN1 PE=1 SV=4
 1341 : G0N5V8_CAEBE        0.30  0.53    1   89  253  339   93    3   10  464  G0N5V8     Putative uncharacterized protein OS=Caenorhabditis brenneri GN=CAEBREN_09437 PE=4 SV=1
 1342 : G1KWK0_ANOCA        0.30  0.45    2   88  289  374   94    9   15  583  G1KWK0     Uncharacterized protein (Fragment) OS=Anolis carolinensis GN=CD93 PE=4 SV=1
 1343 : G1KWT6_ANOCA        0.30  0.46    2   86  627  704   93    6   23 1416  G1KWT6     Uncharacterized protein OS=Anolis carolinensis GN=SNED1 PE=4 SV=2
 1344 : G1LSJ8_AILME        0.30  0.44    1   86  948 1032   96    8   21 1228  G1LSJ8     Uncharacterized protein OS=Ailuropoda melanoleuca GN=FBLN2 PE=4 SV=1
 1345 : G1LZ82_AILME        0.30  0.43    2   86 1051 1129   94    8   24 1360  G1LZ82     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=NCAN PE=4 SV=1
 1346 : G1NM73_MELGA        0.30  0.40    1   84  714  791   92    6   22  893  G1NM73     Uncharacterized protein (Fragment) OS=Meleagris gallopavo PE=4 SV=2
 1347 : G1RT74_NOMLE        0.30  0.45    1   85  380  464   96    9   22  681  G1RT74     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=FBLN1 PE=4 SV=1
 1348 : G1S227_NOMLE        0.30  0.46    1   84   61  150   94    8   14  972  G1S227     Uncharacterized protein (Fragment) OS=Nomascus leucogenys GN=SCUBE1 PE=4 SV=1
 1349 : G1SK79_RABIT        0.30  0.51    4   86  677  764   90    6    9 1271  G1SK79     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus GN=NID2 PE=4 SV=1
 1350 : G1TRA2_RABIT        0.30  0.52   93  320    9  240  238    7   16  240  G1TRA2     Uncharacterized protein (Fragment) OS=Oryctolagus cuniculus PE=3 SV=1
 1351 : G3QH75_GORGO        0.30  0.45    1   85  428  512   96    9   22  709  G3QH75     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101139950 PE=4 SV=1
 1352 : G3RKX9_GORGO        0.30  0.40    7   90  111  186   84    3    8  273  G3RKX9     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101152192 PE=4 SV=1
 1353 : G3SBA2_GORGO        0.30  0.45    1   85  378  462   96    9   22  679  G3SBA2     Uncharacterized protein (Fragment) OS=Gorilla gorilla gorilla GN=101139950 PE=4 SV=1
 1354 : G3TEZ8_LOXAF        0.30  0.44    2   86  951 1028   94    8   25 1244  G3TEZ8     Uncharacterized protein OS=Loxodonta africana GN=NCAN PE=4 SV=1
 1355 : G5ATC4_HETGA        0.30  0.50   93  325  339  631  299   12   72  652  G5ATC4     Prothrombin OS=Heterocephalus glaber GN=GW7_01180 PE=3 SV=1
 1356 : G5C3R2_HETGA        0.30  0.41    1   86  314  393   94    6   22 1533  G5C3R2     Sushi, nidogen and EGF-like domain-containing protein 1 OS=Heterocephalus glaber GN=GW7_11065 PE=4 SV=1
 1357 : G5CBI8_HETGA        0.30  0.45    1   91  464  558   99    7   12 1806  G5CBI8     Multiple epidermal growth factor-like domains 6 OS=Heterocephalus glaber GN=GW7_14668 PE=4 SV=1
 1358 : G7Y648_CLOSI        0.30  0.43    1   88  148  229   96    6   22 2233  G7Y648     Uncharacterized protein OS=Clonorchis sinensis GN=CLF_101604 PE=4 SV=1
 1359 : H0V730_CAVPO        0.30  0.45    1   86  378  462   96    8   21  658  H0V730     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=FBLN2 PE=4 SV=1
 1360 : H0V7E2_CAVPO        0.30  0.44    1   86  314  393   93    4   20 1404  H0V7E2     Uncharacterized protein OS=Cavia porcellus GN=SNED1 PE=4 SV=1
 1361 : H0V8W2_CAVPO        0.30  0.47    2   85  162  247   93    6   16  767  H0V8W2     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=SELP PE=4 SV=1
 1362 : H0W2I1_CAVPO        0.30  0.44    1   90  329  413  100    7   25  607  H0W2I1     Delta-like protein (Fragment) OS=Cavia porcellus GN=DLL1 PE=3 SV=1
 1363 : H0WCT8_CAVPO        0.30  0.47    1   84   77  166   94    8   14 1018  H0WCT8     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=SCUBE1 PE=4 SV=1
 1364 : H0WJD9_OTOGA        0.30  0.46    1   84   77  166   94    8   14 1019  H0WJD9     Uncharacterized protein OS=Otolemur garnettii GN=SCUBE1 PE=4 SV=1
 1365 : H0XE93_OTOGA        0.30  0.41    1   85  756  834   94    8   24 2550  H0XE93     Uncharacterized protein OS=Otolemur garnettii GN=NOTCH1 PE=4 SV=1
 1366 : H0Z239_TAEGU        0.30  0.50   93  320    6  231  241    9   28  237  H0Z239     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=TMPRSS11B-1 PE=3 SV=1
 1367 : H0Z6Z3_TAEGU        0.30  0.41    1   85  510  588   94    8   24 2274  H0Z6Z3     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=NOTCH1 PE=4 SV=1
 1368 : H2L2W9_ORYLA        0.30  0.40    2   85  917  997   94    7   23 1539  H2L2W9     Uncharacterized protein (Fragment) OS=Oryzias latipes PE=3 SV=1
 1369 : H2MUB9_ORYLA        0.30  0.41    2   84  752  828   92    8   24 1251  H2MUB9     Delta-like protein OS=Oryzias latipes GN=JAG2 (2 of 2) PE=3 SV=1
 1370 : H2P4R8_PONAB        0.30  0.45    1   85  374  458   96    9   22  675  H2P4R8     Uncharacterized protein OS=Pongo abelii GN=FBLN1 PE=4 SV=2
 1371 : H2QLW1_PANTR        0.30  0.45    1   85  136  220   96    9   22  437  H2QLW1     Uncharacterized protein (Fragment) OS=Pan troglodytes GN=FBLN1 PE=4 SV=1
 1372 : H2QY66_PANTR        0.30  0.42    7   90  111  186   84    3    8  273  H2QY66     EGF-like-domain, multiple 7 OS=Pan troglodytes GN=EGFL7 PE=2 SV=1
 1373 : H2S2H4_TAKRU        0.30  0.49   93  320   41  308  272   11   48  327  H2S2H4     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=MASP1 PE=4 SV=1
 1374 : H2STQ1_TAKRU        0.30  0.42    2   84  940 1019   93    7   23 1554  H2STQ1     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101061888 PE=3 SV=1
 1375 : H2STQ2_TAKRU        0.30  0.42    2   84  923 1002   93    7   23 1537  H2STQ2     Uncharacterized protein OS=Takifugu rubripes GN=LOC101061888 PE=3 SV=1
 1376 : H2UA78_TAKRU        0.30  0.50   93  320    2  208  238   11   41  209  H2UA78     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101073906 PE=3 SV=1
 1377 : H2UUX1_TAKRU        0.30  0.42    1   84   86  166   89    7   13  439  H2UUX1     Uncharacterized protein OS=Takifugu rubripes GN=LOC101066031 PE=3 SV=1
 1378 : H2V008_TAKRU        0.30  0.39    1   86  870  949   94    6   22 2513  H2V008     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101067059 PE=4 SV=1
 1379 : H2V009_TAKRU        0.30  0.39    1   86  875  954   94    6   22 2518  H2V009     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101067059 PE=4 SV=1
 1380 : H2V010_TAKRU        0.30  0.39    1   86  826  905   94    6   22 2441  H2V010     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101067059 PE=4 SV=1
 1381 : H2V011_TAKRU        0.30  0.39    1   86  825  904   94    6   22 2458  H2V011     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101067059 PE=4 SV=1
 1382 : H2V2C3_TAKRU        0.30  0.47    7   85  337  414   90    5   23  709  H2V2C3     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101062331 PE=4 SV=1
 1383 : H2XY98_CIOIN        0.30  0.55   93  322    2  233  237    8   12  238  H2XY98     Uncharacterized protein (Fragment) OS=Ciona intestinalis PE=3 SV=1
 1384 : H2YAX9_CIOSA        0.30  0.47    1   82 3093 3180   90    5   10 4433  H2YAX9     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1385 : H2YAY0_CIOSA        0.30  0.47    1   82 3108 3195   90    5   10 4413  H2YAY0     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1386 : H2YAY1_CIOSA        0.30  0.47    1   82 2862 2949   90    5   10 4131  H2YAY1     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1387 : H2YAY2_CIOSA        0.30  0.47    1   82  634  721   90    5   10 1870  H2YAY2     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1388 : H2YAY3_CIOSA        0.30  0.47    1   82 2846 2933   90    5   10 4098  H2YAY3     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1389 : H2YAY4_CIOSA        0.30  0.47    1   82 2843 2930   90    5   10 3713  H2YAY4     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1390 : H2YAY5_CIOSA        0.30  0.47    1   82 3102 3189   90    5   10 4027  H2YAY5     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1391 : H2YAY6_CIOSA        0.30  0.47    1   82  335  422   90    5   10  721  H2YAY6     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1392 : H2YHL6_CIOSA        0.30  0.49    1   86   81  160   94    6   22  683  H2YHL6     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1393 : H2YHL7_CIOSA        0.30  0.49    1   86  528  607   94    6   22 1153  H2YHL7     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1394 : H2YN95_CIOSA        0.30  0.41    1   85  476  554   93    6   22  623  H2YN95     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1395 : H2ZF31_CIOSA        0.30  0.40    2   86   37  120   94    6   19  390  H2ZF31     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1396 : H2ZQZ6_CIOSA        0.30  0.39    2   84    8   93   94    5   19  107  H2ZQZ6     Uncharacterized protein (Fragment) OS=Ciona savignyi PE=4 SV=1
 1397 : H3A230_LATCH        0.30  0.47    1   84   10   87   92    6   22 1577  H3A230     Uncharacterized protein (Fragment) OS=Latimeria chalumnae GN=NOTCH3 PE=4 SV=1
 1398 : H3C2H5_TETNG        0.30  0.42    2   86  363  446   93    7   17  699  H3C2H5     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=FBLN1 (1 of 2) PE=4 SV=1
 1399 : H3C3M8_TETNG        0.30  0.47    1   85 1867 1950   90    8   11 2841  H3C3M8     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=FBN1 PE=4 SV=1
 1400 : H3C692_TETNG        0.30  0.47    1   85 1924 2007   90    8   11 2898  H3C692     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=FBN1 PE=4 SV=1
 1401 : H3CMU4_TETNG        0.30  0.42    2   86  347  430   93    7   17  683  H3CMU4     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=FBLN1 (1 of 2) PE=4 SV=1
 1402 : H3CVW9_TETNG        0.30  0.47    1   85 1912 1995   90    8   11 2886  H3CVW9     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis GN=FBN1 PE=4 SV=1
 1403 : H3DBE7_TETNG        0.30  0.52    1   85  129  218   93    7   11 1141  H3DBE7     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=4 SV=1
 1404 : H3DDS1_TETNG        0.30  0.40    1   86  872  951   94    6   22 2456  H3DDS1     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=4 SV=1
 1405 : H9F4V4_MACMU        0.30  0.45    1   85  376  460   96    9   22  677  H9F4V4     Fibulin-1 isoform D (Fragment) OS=Macaca mulatta GN=FBLN1 PE=2 SV=1
 1406 : H9F513_MACMU        0.30  0.45    1   85  376  460   96    9   22  657  H9F513     Fibulin-1 isoform C (Fragment) OS=Macaca mulatta GN=FBLN1 PE=2 SV=1
 1407 : I1ETI6_AMPQE        0.30  0.51    1   85  853  936   90    7   11 1184  I1ETI6     Uncharacterized protein (Fragment) OS=Amphimedon queenslandica PE=4 SV=1
 1408 : I1FF52_AMPQE        0.30  0.51    1   91  284  373   99    4   17  444  I1FF52     Uncharacterized protein (Fragment) OS=Amphimedon queenslandica GN=LOC100633983 PE=4 SV=1
 1409 : I1FI03_AMPQE        0.30  0.46    1   84 2569 2653   90    6   11 3395  I1FI03     Uncharacterized protein OS=Amphimedon queenslandica PE=4 SV=1
 1410 : I1G4C5_AMPQE        0.30  0.45    1   84  520  598   93    7   23 1667  I1G4C5     Uncharacterized protein OS=Amphimedon queenslandica GN=notch PE=4 SV=1
 1411 : I3JY76_ORENI        0.30  0.45   93  326    7  270  269   11   40  541  I3JY76     Uncharacterized protein OS=Oreochromis niloticus PE=3 SV=1
 1412 : I3LHD7_PIG          0.30  0.55    2   84  145  227   86    4    6  310  I3LHD7     Uncharacterized protein OS=Sus scrofa PE=4 SV=1
 1413 : I3LW87_SPETR        0.30  0.44    1   84    4   92   93    9   13  924  I3LW87     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=SCUBE3 PE=4 SV=1
 1414 : I3M6Z8_SPETR        0.30  0.41    1   85  750  828   94    8   24 2543  I3M6Z8     Uncharacterized protein (Fragment) OS=Spermophilus tridecemlineatus GN=NOTCH1 PE=4 SV=1
 1415 : I3MCD6_SPETR        0.30  0.36    2   86 4025 4104   94    7   23 4557  I3MCD6     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=FAT3 PE=4 SV=1
 1416 : J0XGP7_LOALO        0.30  0.51    1   84  297  383   90    6    9 1659  J0XGP7     Uncharacterized protein OS=Loa loa GN=LOAG_18073 PE=4 SV=1
 1417 : J9EP76_WUCBA        0.30  0.35    2   85  263  341   94    7   25  378  J9EP76     Uncharacterized protein (Fragment) OS=Wuchereria bancrofti GN=WUBG_12016 PE=4 SV=1
 1418 : J9F3W4_WUCBA        0.30  0.42    5   82  570  645   90    9   26  986  J9F3W4     Uncharacterized protein (Fragment) OS=Wuchereria bancrofti GN=WUBG_04927 PE=3 SV=1
 1419 : J9JPN0_ACYPI        0.30  0.45    1   84  389  472   96    8   24 2181  J9JPN0     Uncharacterized protein OS=Acyrthosiphon pisum PE=4 SV=1
 1420 : J9JSB8_ACYPI        0.30  0.40    1   84 2044 2123   94    8   24 3555  J9JSB8     Uncharacterized protein OS=Acyrthosiphon pisum GN=LOC100162025 PE=4 SV=1
 1421 : J9NZ75_CANFA        0.30  0.49    1   86  326  405   90    5   14 1211  J9NZ75     Pro-epidermal growth factor OS=Canis familiaris GN=EGF PE=4 SV=1
 1422 : J9P2K0_CANFA        0.30  0.45    1   86  948 1032   96    8   21 1228  J9P2K0     Uncharacterized protein OS=Canis familiaris GN=FBLN2 PE=4 SV=1
 1423 : K1PPU8_CRAGI        0.30  0.45    1   85  840  918   92    4   20 2536  K1PPU8     Neurogenic locus Notch protein OS=Crassostrea gigas GN=CGI_10013186 PE=4 SV=1
 1424 : K1Q6Z5_CRAGI        0.30  0.51    6   85 1293 1379   94    8   21 1518  K1Q6Z5     Stabilin-2 OS=Crassostrea gigas GN=CGI_10012712 PE=4 SV=1
 1425 : K1QDR8_CRAGI        0.30  0.40    1   85  488  566   92    4   20 1591  K1QDR8     Fibropellin-1 OS=Crassostrea gigas GN=CGI_10013454 PE=4 SV=1
 1426 : K1QFQ8_CRAGI        0.30  0.43    1   86  282  362   94    6   21  524  K1QFQ8     Fibropellin-1 OS=Crassostrea gigas GN=CGI_10024098 PE=4 SV=1
 1427 : K7BA97_PANTR        0.30  0.45    1   85  402  486   96    9   22  703  K7BA97     Fibulin 1 OS=Pan troglodytes GN=FBLN1 PE=2 SV=1
 1428 : K7CJA0_PANTR        0.30  0.45    1   85  402  486   96    9   22  703  K7CJA0     Fibulin 1 OS=Pan troglodytes GN=FBLN1 PE=2 SV=1
 1429 : K7CK50_PANTR        0.30  0.45    1   85  402  486   96    9   22  683  K7CK50     Fibulin 1 OS=Pan troglodytes GN=FBLN1 PE=2 SV=1
 1430 : K7DP07_PANTR        0.30  0.45    1   85  402  486   96    9   22  683  K7DP07     Fibulin 1 OS=Pan troglodytes GN=FBLN1 PE=2 SV=1
 1431 : K7J250_NASVI        0.30  0.41    2   86  609  688   94    7   23 1100  K7J250     Delta-like protein OS=Nasonia vitripennis PE=3 SV=1
 1432 : L5K6M6_PTEAL        0.30  0.44    2   82  280  363   90    8   15  991  L5K6M6     Pro-epidermal growth factor OS=Pteropus alecto GN=PAL_GLEAN10022612 PE=4 SV=1
 1433 : M0R580_RAT          0.30  0.41    2   86  904  986   97    8   26 1506  M0R580     Slit homolog 1 protein OS=Rattus norvegicus GN=Slit1 PE=3 SV=1
 1434 : M3W7U0_FELCA        0.30  0.44    1   86  925 1009   96    8   21 1205  M3W7U0     Uncharacterized protein OS=Felis catus GN=FBLN2 PE=4 SV=1
 1435 : M3WDA4_FELCA        0.30  0.39    1   86  258  337   94    6   22 1363  M3WDA4     Uncharacterized protein OS=Felis catus GN=SNED1 PE=4 SV=1
 1436 : M3X532_FELCA        0.30  0.42    2   85    5   84   92    5   20  314  M3X532     Uncharacterized protein (Fragment) OS=Felis catus PE=4 SV=1
 1437 : M3YVG3_MUSPF        0.30  0.43    2   86 1032 1110   94    8   24 1341  M3YVG3     Uncharacterized protein OS=Mustela putorius furo GN=NCAN PE=4 SV=1
 1438 : M3ZM84_XIPMA        0.30  0.43    1   86  872  951   94    6   22 2491  M3ZM84     Uncharacterized protein OS=Xiphophorus maculatus PE=4 SV=1
 1439 : M4AQ40_XIPMA        0.30  0.44    1   85   45  128   90    8   11 1016  M4AQ40     Uncharacterized protein (Fragment) OS=Xiphophorus maculatus GN=FBN1 PE=4 SV=1
 1440 : M4AS77_XIPMA        0.30  0.53    1   85  320  409   93    7   11 1601  M4AS77     Uncharacterized protein OS=Xiphophorus maculatus PE=4 SV=1
 1441 : M7AID0_CHEMY        0.30  0.45    2   86 1266 1344   94    8   24 1559  M7AID0     Neurocan core protein OS=Chelonia mydas GN=UY3_18741 PE=4 SV=1
 1442 : M7BCJ1_CHEMY        0.30  0.49    1   85  137  226   93    7   11 1087  M7BCJ1     Multiple epidermal growth factor-like domains protein 6 OS=Chelonia mydas GN=UY3_16939 PE=4 SV=1
 1443 : M9PBU9_DROME        0.30  0.44    1   91  174  258   99    6   22 2165  M9PBU9     Eyes shut, isoform D OS=Drosophila melanogaster GN=eys PE=4 SV=1
 1444 : M9VTX9_HUMAN        0.30  0.42    7   90  111  186   84    3    8  273  M9VTX9     Epidermal growth factor like-7 OS=Homo sapiens GN=EGFL7 PE=2 SV=1
 1445 : Q0IHL2_XENTR        0.30  0.44    7   89  113  186   84    5   11  279  Q0IHL2     EGF-like-domain, multiple 7 OS=Xenopus tropicalis GN=egfl7 PE=2 SV=1
 1446 : Q29097_PIG          0.30  0.43    2   84  163  244   92    7   19  646  Q29097     P-selectin (Precursor) OS=Sus scrofa PE=2 SV=1
 1447 : Q4RU01_TETNG        0.30  0.40    1   86  810  889   94    6   22 2341  Q4RU01     Chromosome 12 SCAF14996, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00029014001 PE=4 SV=1
 1448 : Q4RX38_TETNG        0.30  0.52    1   85  128  217   93    7   11 1408  Q4RX38     Chromosome 11 SCAF14979, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00027579001 PE=4 SV=1
 1449 : Q4SHN1_TETNG        0.30  0.44    1   91 2018 2110   97    7   10 2884  Q4SHN1     Chromosome 5 SCAF14581, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00018079001 PE=4 SV=1
 1450 : Q4SXD4_TETNG        0.30  0.48    1   75   29  100   82    2   17  102  Q4SXD4     Chromosome undetermined SCAF12469, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00010910001 PE=4 SV=1
 1451 : Q4T7S0_TETNG        0.30  0.44    2   85  935 1021   94    8   17 1229  Q4T7S0     Chromosome undetermined SCAF8017, whole genome shotgun sequence. (Fragment) OS=Tetraodon nigroviridis GN=GSTENG00005588001 PE=4 SV=1
 1452 : Q68EF9_MOUSE        0.30  0.48    1   84  120  205   90    7   10  907  Q68EF9     Scube1 protein OS=Mus musculus GN=Scube1 PE=2 SV=1
 1453 : Q800E4_DANRE        0.30  0.40    1   88  827  908   96    6   22 2468  Q800E4     Notch3 OS=Danio rerio GN=notch3 PE=2 SV=1
 1454 : Q8I499_CUPSA        0.30  0.47    2   86   46  124   93    5   22  420  Q8I499     Notch protein (Fragment) OS=Cupiennius salei GN=notch PE=2 SV=1
 1455 : Q8NBH6_HUMAN        0.30  0.45    1   85  337  421   96    9   22  638  Q8NBH6     cDNA PSEC0266 fis, clone NT2RP3003649, highly similar to Homo sapiens fibulin-1D mRNA OS=Homo sapiens PE=2 SV=1
 1456 : Q8T5W5_CAERE        0.30  0.42    2   73    1   76   83    4   18  124  Q8T5W5     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
 1457 : Q8T5X0_CAERE        0.30  0.41    2   73    1   76   83    4   18  124  Q8T5X0     Glp-1 (Fragment) OS=Caenorhabditis remanei PE=4 SV=1
 1458 : Q921N4_MOUSE        0.30  0.50   93  327   29  272  258   10   37  273  Q921N4     Tryptase alpha/beta 1 OS=Mus musculus GN=Tpsab1 PE=2 SV=1
 1459 : Q9CV76_MOUSE        0.30  0.51   93  327    9  234  243   11   25  234  Q9CV76     MCG144712 (Fragment) OS=Mus musculus GN=Klk12 PE=2 SV=1
 1460 : R0JB03_ANAPL        0.30  0.52    7   90  116  204   92    7   11  450  R0JB03     Vitamin K-dependent protein C (Fragment) OS=Anas platyrhynchos GN=Anapl_07298 PE=3 SV=1
 1461 : R7TTU1_CAPTE        0.30  0.44    2   86   24  112   94    5   14  240  R7TTU1     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_114977 PE=4 SV=1
 1462 : R7UQ68_CAPTE        0.30  0.44    1   85    9   93   90    5   10  305  R7UQ68     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_96424 PE=4 SV=1
 1463 : R7UTL0_CAPTE        0.30  0.40    2   86  166  246   94    6   22  558  R7UTL0     Uncharacterized protein OS=Capitella teleta GN=CAPTEDRAFT_190179 PE=4 SV=1
 1464 : R7UTL3_CAPTE        0.30  0.43    2   84    1   84   92    4   17  221  R7UTL3     Uncharacterized protein (Fragment) OS=Capitella teleta GN=CAPTEDRAFT_98122 PE=4 SV=1
 1465 : R7VJM6_CAPTE        0.30  0.41    1   86  301  379   94    6   23 1085  R7VJM6     Uncharacterized protein OS=Capitella teleta GN=CAPTEDRAFT_220964 PE=4 SV=1
 1466 : S4T9U3_PARLI        0.30  0.46    1   85  740  818   93    6   22 2528  S4T9U3     Notch OS=Paracentrotus lividus PE=2 SV=1
 1467 : S7MJC7_MYOBR        0.30  0.47    1   84  149  238   94    8   14 1035  S7MJC7     Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Myotis brandtii GN=D623_10014576 PE=4 SV=1
 1468 : S9WEV3_9CETA        0.30  0.46    1   84  100  189   94    9   14  385  S9WEV3     Uncharacterized protein (Fragment) OS=Camelus ferus GN=CB1_001862001 PE=4 SV=1
 1469 : S9XF75_9CETA        0.30  0.46    1   84  100  189   94    8   14 1028  S9XF75     Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Camelus ferus GN=CB1_000319017 PE=4 SV=1
 1470 : S9YGX0_9CETA        0.30  0.45    1   86  287  371   93    3   15 1354  S9YGX0     Sushi, nidogen and EGF-like domains 1 OS=Camelus ferus GN=CB1_000575001 PE=4 SV=1
 1471 : SCUB1_MOUSE         0.30  0.46    1   84   77  166   94    8   14 1018  Q6NZL8     Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus GN=Scube1 PE=2 SV=2
 1472 : SLIT1_RAT           0.30  0.41    2   86  929 1011   97    8   26 1531  O88279     Slit homolog 1 protein OS=Rattus norvegicus GN=Slit1 PE=1 SV=1
 1473 : T1EM96_HELRO        0.30  0.53   93  325   10  264  260   10   32  266  T1EM96     Uncharacterized protein OS=Helobdella robusta GN=HELRODRAFT_157319 PE=4 SV=1
 1474 : T1FSH0_HELRO        0.30  0.42    1   86  424  504   96    8   25 1247  T1FSH0     Delta-like protein OS=Helobdella robusta GN=HELRODRAFT_190982 PE=3 SV=1
 1475 : T1L3V0_TETUR        0.30  0.42    1   84  256  333   92    6   22  554  T1L3V0     Uncharacterized protein OS=Tetranychus urticae PE=4 SV=1
 1476 : TRYT_MERUN          0.30  0.48   93  327   26  269  263   12   47  270  P50342     Mast cell tryptase OS=Meriones unguiculatus PE=2 SV=1
 1477 : U3BL19_CALJA        0.30  0.45    1   85  402  486   96    9   22  683  U3BL19     Fibulin-1 isoform C OS=Callithrix jacchus GN=FBLN1 PE=2 SV=1
 1478 : U3CNK3_CALJA        0.30  0.45    1   85  402  486   96    9   22  703  U3CNK3     Fibulin-1 isoform D OS=Callithrix jacchus GN=FBLN1 PE=2 SV=1
 1479 : U3IAJ8_ANAPL        0.30  0.41    1   85  759  837   94    8   24 2475  U3IAJ8     Uncharacterized protein (Fragment) OS=Anas platyrhynchos GN=NOTCH1 PE=4 SV=1
 1480 : U3IB42_ANAPL        0.30  0.48    1   85  164  249   90    4    9 1559  U3IB42     Uncharacterized protein (Fragment) OS=Anas platyrhynchos GN=MEGF6 PE=4 SV=1
 1481 : U3JG63_FICAL        0.30  0.41    1   85  416  494   94    8   24 2128  U3JG63     Uncharacterized protein OS=Ficedula albicollis GN=NOTCH1 PE=4 SV=1
 1482 : U6D202_NEOVI        0.30  0.43    2   86  715  793   94    8   24  884  U6D202     CSPG3 variant protein (Fragment) OS=Neovison vison GN=Q4LE67 PE=2 SV=1
 1483 : U6D3D1_NEOVI        0.30  0.37    2   86  234  313   94    7   23  559  U6D3D1     FAT tumor suppressor homolog 3 (Drosophila) (Fragment) OS=Neovison vison GN=E9PQ73 PE=2 SV=1
 1484 : U6D8X4_NEOVI        0.30  0.42    2   86  297  375   93    6   22  375  U6D8X4     Delta-like protein (Fragment) OS=Neovison vison GN=DLL1 PE=2 SV=1
 1485 : V4AJ71_LOTGI        0.30  0.48    2   86  757  835   93    6   22 1147  V4AJ71     Delta-like protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_71205 PE=3 SV=1
 1486 : V4BAP6_LOTGI        0.30  0.51   93  324    3  223  243    9   33  223  V4BAP6     Uncharacterized protein (Fragment) OS=Lottia gigantea GN=LOTGIDRAFT_56436 PE=4 SV=1
 1487 : V9P4G1_9BILA        0.30  0.40    2   85  376  453   92    6   22  787  V9P4G1     Delta-like protein OS=Euperipatoides rowelli PE=2 SV=1
 1488 : W4WZU3_ATTCE        0.30  0.41    1   82  132  208   90    5   21  599  W4WZU3     Uncharacterized protein OS=Atta cephalotes PE=4 SV=1
 1489 : W4XFE8_STRPU        0.30  0.43    1   84 1927 2004   93    8   24 2165  W4XFE8     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Fn3/Egf_11 PE=4 SV=1
 1490 : W4XNB6_STRPU        0.30  0.46    2   88  920 1004   96    5   20 2713  W4XNB6     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Egf/LamGap1 PE=4 SV=1
 1491 : W4XRX1_STRPU        0.30  0.41    1   89   33  119   94    5   12 1451  W4XRX1     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-LrpL_1 PE=4 SV=1
 1492 : W4XTY3_STRPU        0.30  0.39    2   84  251  332   87    6    9  367  W4XTY3     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Hypp_1686 PE=4 SV=1
 1493 : W4Y493_STRPU        0.30  0.41    1   88  232  313   96    6   22  461  W4Y493     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Egfib_4 PE=4 SV=1
 1494 : W4YA88_STRPU        0.30  0.46    1   86  251  330   94    6   22  720  W4YA88     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Egfib PE=4 SV=1
 1495 : W4YVK2_STRPU        0.30  0.43    1   86 1362 1441   94    6   22 1602  W4YVK2     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Notch1-17 PE=4 SV=1
 1496 : W4Z176_STRPU        0.30  0.46    2   88  937 1021   96    5   20 1825  W4Z176     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Notch1-18 PE=4 SV=1
 1497 : W4Z1Y8_STRPU        0.30  0.41    1   89   73  159   94    5   12 1495  W4Z1Y8     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-LrpL_5 PE=4 SV=1
 1498 : W4ZE00_STRPU        0.30  0.42    1   84  191  268   92    6   22  664  W4ZE00     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-NotchL_14 PE=4 SV=1
 1499 : W4ZFY6_STRPU        0.30  0.42    1   84  407  484   92    6   22  838  W4ZFY6     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-FibropellinL3 PE=4 SV=1
 1500 : W5MPB2_LEPOC        0.30  0.44    1   84 1900 1986   97    8   23 2880  W5MPB2     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=4 SV=1
 1501 : W5MVW5_LEPOC        0.30  0.41    1   86  873  952   94    6   22 2415  W5MVW5     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=4 SV=1
 1502 : W5NTY2_SHEEP        0.30  0.44    1   86  294  378   96    8   21  576  W5NTY2     Uncharacterized protein (Fragment) OS=Ovis aries GN=FBLN2 PE=4 SV=1
 1503 : W8AGD9_CERCA        0.30  0.49    2   85  762  842   90    9   15 1866  W8AGD9     Fibrillin-2 OS=Ceratitis capitata GN=FBN2 PE=2 SV=1
 1504 : W8AS46_CERCA        0.30  0.49    2   85  762  842   90    9   15 1597  W8AS46     Fibrillin-2 OS=Ceratitis capitata GN=FBN2 PE=2 SV=1
 1505 : W8BC32_CERCA        0.30  0.49    2   85  762  842   90    9   15 1612  W8BC32     Fibrillin-2 OS=Ceratitis capitata GN=FBN2 PE=2 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1   49 L Q              0   0  101  671   35     QQQ QQQQ Q QQ Q Q Q Q   QQ  Q                    QQQ   Q QQQQQQ QQQ
     2   50 L a    >   +     0   0   22  858    0     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
     3   51 L E  T 3  S+     0   0  187  858   80     EEE EEEE E EE E E E E   EE  E                    EEE   E EDEEDE EEE
     4   52 L T  T 3  S-     0   0  105  864   61     TTT TTTT T TT T T T T   TS  S                    GSS   S SSSSSS SSS
     5   53 L S    <   +     0   0   89  868   72     SSS SSSS S SS S S S S   SS  D                    SSS   N NNSSNS SSS
     6   54 L P        +     0   0   10  878   31     PPP PPPP P PP P P P P   PP  P                    PPP   P PPPPPP PPP
     7   55 L b        -     0   0   18  893   21     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
     8   56 L Q  S    S+     0   0   92  892   83     QQQ QQQQ Q QQ Q Q Q Q   QQ  Q                    QQQ   Q LQQQLQ QQQ
     9   57 L N  S    S-     0   0   63  893   51     NNN NNNN N NN N N N N   NN  N                    NNN   N NNNNNN NNN
    10   58 L Q  S    S-     0   0  152  893   57     QQQ QQQE Q EE E E E E   EQ  Q                    QQQ   Q QQEQEE QQQ
    11   59 L G        -     0   0   16  893   40     GGG GGGG G GG G G G G   GG  G                    GGG   G GGGGGG GGG
    12   60 L K  E     -S   23   0G 117  852   79     KKK KKKK K KK K K K K   KK  K                    VKK   K RKQQKQ AAA
    13   61 L a  E     -S   22   0G  45  882   10     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
    14   62 L K  E     -S   21   0G 155  890   81     KKK KKKK K RR R R R R   RR  K                    KKK   Q KKRKKR RRR
    15   63 L X  E     +S   20   0G 120  768   39     DDD DDDD D DD D D D D   DD  D                    DDD   D DDDDDD DDD
    16   64 L G        -     0   0   44  862   73     GGG GGGG G GG G G G G   GG  G                    GGG   G GGGGGG GGG
    17   65 L L  S    S-     0   0  152  871   64     LLL LLLL L LL L L L L   LL  L                    LLL   L LLLLLL III
    18   66 L G  S    S+     0   0   67  883   63     GGG GGGG G GG G G G G   GG  G                    GGG   G GGGLGG GGG
    19   67 L E        -     0   0  119  837   61     EEE EEEE E EE E E E E   EQ  Q                    QEE   E EEEEEE GGG
    20   68 L Y  E     -S   15   0G  37  883   11     YYY YYYY Y YY Y Y Y Y   YY  Y                    YYY   Y YYYYYY YYY
    21   69 L T  E     -S   14   0G  71  886   82     TTT TTTT T TT T T T T   TT  T                    TNN   T TSTSTT TTT
    22   70 L b  E     -S   13   0G  20  889    0     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
    23   71 L T  E     -S   12   0G  85  890   86     TTT TTTT T TT T T T T   TT  T                    TTT   T TSTITT TTT
    24   72 L c        -     0   0   44  890    0     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
    25   73 L L    >   -     0   0   62  890   88     LLL LLLL L LL L L L L   LL  L                    LAA   L QLLLLL SSS
    26   74 L E  T 3  S+     0   0  177  890   75     EEE EEEE E EE E E E E   EE  E                    EEE   E EDEEEE EEE
    27   75 L G  T 3  S+     0   0   29  893   20     GGG GGGG G GG G G G G   GG  G                    GGG   G GGGGGG GGG
    28   76 L F  E <   +T   36   0H  40  893    9     FFF FFFF F FF F F F F   FF  F                    FFF   F YFYYFY FFF
    29   77 L E  E     +T   35   0H  74  893   73     EEE EEEE E EE E E E E   EE  E                    EEE   E EEEEEE EEE
    30   78 L G  S >  S-     0   0   32  889    5     GGG GGGG G GG G G G G   GG  G                    GGG   G GGGGGG GGG
    31   79 L K  T 3  S+     0   0  156  891   73     KKK KKKK K KK K K K K   KK  K                    KKK   K RKKKKK KKK
    32   80 L N  T 3  S-     0   0   33  892   62     NNN NNNN N NN N N N N   NN  N                    NNN   N NNNNNN NNN
    33   81 L c  S <  S+     0   0    1  892    3     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
    34   82 L E        +     0   0   87  891   44     EEE EEEE E EE E E E E   EE  E                    EEE   E EEEEEE EEE
    35   83 L L  E    S-T   29   0H  96  889   88     LLL LLLL L LL L L L L   LL  L                    LLL   L LLLLLL LLL
    36   84 L F  E     -T   28   0H 139  889   83     FFF FFFF F FF F F F F   FF  F                    LLL   T PFSSSS FFF
    37   85 L T        -     0   0   44  677   75     TTT TTTT T TT T T T T   TT  T                    TTT   I MATTMT VVV
    38   86 L R        +     0   0   57  408   92     RRR RRRR R RR R R R R   RR  R                    RRR   R RRRRRR RRR
    39   87 L K        +     0   0   96  535   81     KKK KKKK K KK K K K K   KK  K                    KKK   E KKKKQK KKK
    40   88 L L        -     0   0   91  608   90     LLL LLLL L LL L L L L   LL  L                    LLL   L FLLLLL LLL
    41   89 L d  S  > S+     0   0   15  617   29     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
    42   90 L S  T  4 S+     0   0   98  624   84     SSS SSSS S SS S S S S   SS  S                    SSS   S SSSSSS RRR
    43   91 L L  T >4 S-     0   0  120  627   87     LLL LLLL L LL L L L L   LL  L                    LLL   L LLVVLV LLL
    44   92 L D  G >4 S-     0   0  107  638   73     DDD DDDD D DD D D D D   DD  D                    DDD   D DDDDDD DDD
    45   93 L N  G >< S-     0   0    8  700   56     NNN NNNN N NN N N N N   NN  N                    NNN   N NNNNNN NNN
    46   94 L G  G <  S-     0   0    0  882   52     GGG GGGG G GG G G G G   GG  G                    GGG   G GGGGGG GGG
    47   95 L D  G <  S+     0   0   44  887   62     DDD DDDD D DD E E E E   ED  D                    DDD   D DDDDDD DDD
    48   96 L e    <   -     0   0    0  892    0     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
    49   97 L D  S    S-     0   0   59  892   74     DDD DDDD D DD D D D D   DD  D                    DDD   D DDEDDE DDD
    50   98 L Q  S    S+     0   0    2  892   63     QQQ QQQQ Q QQ Q Q Q Q   QQ  Q                    QQQ   Q QQQQQQ QQQ
    51   99 L F  E     -U   62   0I   4  892   80     FFF FFFF F FF F F F F   FF  F                    FFF   F FFFFFF FFF
    52  100 L d  E     +U   61   0I  10  893    1     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
    53  101 L H  E     -U   60   0I  68  893   87     HHH HHHH H HH H H H H   HH  H                    RRR   N RQRRSR RRR
    54  102 L E  E     -U   59   0I  92  893   68     EEE EEEE E EE E E E E   EE  E                    EEE   E EEEEEE EEE
    55  103 L E  S    S-     0   0  100  893   82     EEE EEEE E EE E E E E   EE  E                    EEE   E EMEEEE EEE
    56  104 L Q  S    S-     0   0  175  693   73     QQQ QQQQ Q QQ Q Q Q Q   QQ  Q                    QQQ   R QQQQRQ QQQ
    57  105 L N  S    S+     0   0  154  838   66     NNN NNNN N NN N N N N   NN  N                    NSS   N NNSSNS NNN
    58  106 L S  S    S-     0   0   58  853   65     SSS SSSS S SS S S S S   SS  S                    ESS   S SSSSSS SSS
    59  107 L V  E     -U   54   0I   7  890   79     VVV VVVV V VV V V V V   VV  V                    VVV   V VVVVVV VVV
    60  108 L V  E     -U   53   0I  45  891   88     VVV VVVV V VV V V V V   VV  V                    VVV   V VVVVVV VVV
    61  109 L e  E     +U   52   0I   5  893    1     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
    62  110 L S  E     -U   51   0I  24  893   75     SSS SSSS S SS S S S S   SS  S                    SSS   S SSSSSS SSS
    63  111 L f        -     0   0   23  893    0     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
    64  112 L A    >   -     0   0    8  893   75     AAA AAAA A AA A A A A   AA  A                    AAA   A AAAAAA AAA
    65  113 L R  T 3  S+     0   0  149  893   80     RRR RRRR R RR R R R R   RS  S                    SSS   A SSSSSS SSS
    66  114 L G  T 3  S+     0   0   24  893    8     GGG GGGG G GG G G G G   GG  G                    GGG   G GGGGGG GGG
    67  115 L Y  E <   -V   78   0J  20  893   11     YYY YYYY Y YY Y Y Y Y   YY  Y                    YYY   Y YYYYYY YYY
    68  116 L T  E     -V   77   0J  72  891   85     TTT TTTT T TT T T T T   TI  V                    TII   T ITVIIV FFF
    69  117 L L  E     -V   76   0J  67  888   64     LLL LLLL L LL L L L L   LL  L                    LLL   L LLLLLL LLL
    70  118 L A    >   -     0   0   23  889   78     AAA AAAA A AA A A A A   AA  A                    GGG   G DGGGGG GGG
    71  119 L D  T 3  S+     0   0  175  889   77     DDD DDDD D DD D D D D   DD  D                    DDD   D DDDDDD NNN
    72  120 L N  T 3  S-     0   0   92  694   44     NNN NNNN N NN N N N N   ND  D                    NNN   N NDNNNN DDD
    73  121 L G  S <  S+     0   0   16  713   66     GGG GGGG S GG G G G G   GG  G                    GGG   G GGGGGG GGG
    74  122 L K  S    S+     0   0   71  687   76     KKK KKKK K KK K K K K   KK  K                    KKK   K KKKKKK KKK
    75  123 L A        -     0   0   22  685   66     AAA AAAA A AA A A A A   AA  A                    SSS   S SSSSSS SSS
    76  124 L f  E     -V   69   0J  12  847    9     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
    77  125 L I  E     -V   68   0J  78  846   80     III IIII I II I I I I   II  I                    III   I IIIIII III
    78  126 L P  E     -V   67   0J  62  850   71     PPP PPPP P PP P P P P   PP  P                    SSS   S SSSSSS SSS
    79  127 L T  S    S+     0   0  103  652   80     TTT TTTT T TT T T T T   TT  T                    TTT   T TTTTTT TTT
    80  128 L G  S    S-     0   0   32  788   69     GGG GGGG G GG G G G G   GG  G                    DEE   E EDEEEE AAA
    81  129 L P  S    S+     0   0  116  601   75     PPP PPPP P PP P P P P   PP  P                    LPP   P PLPPPP PPP
    82  130 L Y  S    S+     0   0   59  794   86     YYY YYYY Y YY Y Y Y Y   YY  Y                    FFF   F YFFFFF FFF
    83  131 L P    >   -     0   0   17  799   62     PPP PPPP P PP P P P P   PP  P                    PPP   P PPPPPP PPP
    84  132 L g  T 3  S+     0   0   16  800    5     CCC CCCC C CC C C C C   CC  C                    CCC   C CCCCCC CCC
    85  133 L G  T 3  S+     0   0    0  712   37     GGG GGGG G GG G G G G   GG  G                    GGG   G GGGGGG GGG
    86  134 L K    <   -     0   0   69  588   68     KKK KKKK K KK K K K K   KK  K                    KKK   K KKKKKK KKK
    87  135 L Q        -     0   0   37  477   65     QQQ QQQQ Q QQ Q Q Q Q   QL  L                    LRR   L LLTTHT III
    88  136 L T        +     0   0    4  428   78     TTT TTTT T TT T T T T   TT  T                    TTT   T TTTTTT TTT
    89  137 L L        +     0   0  105  372   61     LLL LLLL L LL L L L L   LL  L                    LLL   M LLMVQM TTT
    90  138 L E              0   0  104  274   69     EEE EEEE E EE E E E E   EE  E                    GGG   G AGGGGG GGG
    91  139 L R              0   0  231  199   47     RRR RRRR R RR R R R R   RR  R                    RRR   R RRRRRR RRR
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2  III   I    I I  I I I I III  II IIIIIIIIIIIIIIIIIIII   III I          
    94   17 C V  B     -A  271   0A   7  590    9  VVV   V    V V  V V V V VVV  VV VVVVVVVVVVVVVVVVVVVV   VVV V          
    95   18 C G  S    S+     0   0   25  591    6  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G          
    96   19 C G  S    S-     0   0   26  592    0  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
    97   20 C Q  E     -B  237   0B  98  593   95  QQQ   Q    R R  R R R R RRR  RR RRRRRRRQKQQRRQQRRQRQ   RRR Q      K   
    98   21 C E  E     -B  236   0B  80  594   67  EEE   E    E E  E E E E EEE  ED DEEEEEDDEEDDDDNDDDDD   DDD D      K   
    99   22 C h        -     0   0    8  594   58  CCC   C    C C  C C C C CCC  CC CCCCCCCCCCCCCCCCCCCC   CCC C      V   
   100   23 C K    >   -     0   0  123  593   78  KKK   K    K K  E E E E EEE  KK KKKKKKKRQKRERRPAAKRK   RKA K      V   
   101   24 C D  T 3  S+     0   0   60  594   85  DDD   D    D D  N N N N NNN  DD EDDDDDEDERDEEDDEEDED   EDE E      S   
   102   25 C G  T 3  S+     0   0    0  595   74  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   103   26 C E  S <  S+     0   0   36  595   66  EEE   E    E E  E E E E EEE  EE EEEEEEEEEEEEEEEEEEEE   EEE E      S   
   104   27 C h    >   +     0   0    4  595   92  CCC   C    C C  C C C C CCC  CC CCCCCCCCCCCCCCCCCCCC   CCC C      V   
   105   28 C P  T 3   +     0   0    0  599    9  PPP   P    P P  P P P P PPP  PP PPPPPPPPPPPPPPPPPPPP   PPP P      A   
   106   29 C W  T 3  S+     0   0    5  600   26  WWW   W    W W  W W W W WWW  WW WWWWWWWWWWWWWWWWWWWW   WWW W      W   
   107   30 C Q  E <   -J  122   0C   7  601   26  QQQ   Q    Q Q  Q Q Q Q QQQ  QQ QQQQQQQQQQQQQQQQQQQQ   QQQ Q      W   
   108   31 C A  E     -JK 121 146C   1  593   49  AAA   A    A A  A A A A AAA  AA AAAAAAAAAAAAAAAAAAAA   AAP A      A   
   109   32 C L  E     -JK 120 145C   3  598   68  LLL   L    L L  L L L L LLL  LL LLLLLLLLLLLLLLLLLLLL   LHA L      L   
   110   33 C L  E     -JK 119 144C   0  601    9  LLL   L    L L  L L L L LLL  LL LLLLLLLLLLLLLLLLLLLL   LLL L      L   
   111   34 C I  E     -JK 117 143C   0  601   81  III   I    I I  I I I I III  II VIIIIVVIIFVIIVIVVVVV   VIV V      I   
   112   35 C N  E >   - K   0 142C  30  601   88  NNN   N    N N  N N N N NNN  NN NNNNNNNNNsNDNNNNNNNN   NKN N      K   
   113   36 C E  T 3  S+     0   0   63  117   78  EEE   E    E E  E E E E EEE  EE EEEEEEEEEeEEEEEEEEEE   EEE E      E   
   114   37 C E  T 3  S-     0   0  136  242   77  EEE   E    E E  E E E E EEE  EE EDDDDDEEEEEEEEEEEEEE   ENE D      N   
   115   38 C N  S <  S+     0   0   84  565   53  NNN   N    N N  N N N N NNN  NN NNNNNNNNNTNNNNNNNNNN   NNN N      N   
   116   39 C E        -     0   0  100  589   94  EEE   E    E E  E E E E EEE  EE EEEEEEEEEDEEEEEEEEEE   EEE K      E   
   117   40 C G  E     +J  111   0C  14  600   57  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   118   41 C F  E     +     0   0C  28  611   33  FFF   F    F F  F F F F FFF  FF FFFFFFFFFFFFFFFFFFFF   FFF F      F   
   119   42 C i  E     -J  110   0C   0  612    1  CCC   C    C C  C C C C CCC  CC CCCCCCCCCCCCCCCCCCCC   CCC C      C   
   120   43 C G  E     -J  109   0C   1  612    1  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   121   44 C G  E     -J  108   0C   0  612    9  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   122   45 C T  E     -JL 107 130C   0  612   45  TTT   T    T T  T T T T TTT  TT TTTTTTTTTTTTTTTTTTTT   TTT T      T   
   123   46 C I  E     + L   0 129C   0  612   23  III   I    I I  I I I I III  II IIIIIIIIIIIIIIIIIIII   TII I      I   
   124   47 C L        -     0   0    6  612   27  LLL   L    L L  L L L L LLL  LL LLLLLLLLLLLLLLLLLLLL   LLL L      L   
   125   48 C S  S    S-     0   0   22  612   56  SSS   S    S S  S S S S SSS  SS SNNNNNNSNNSSNSSNNSSS   SNS N      N   
   126   49 C E  S    S+     0   0   99  612   63  EEE   E    E E  E E E E EEE  EE EEEEEEEEEEEPEEEEEEEE   EEE E      E   
   127   50 C F  S    S+     0   0   42  612   83  FFF   F    F F  F F F F FFF  FF FFFFFFYYYFYFFYYFFFFF   FFF H      F   
   128   51 C Y  E     - M   0 185C   7  612   34  YYY   Y    Y Y  Y Y Y Y YYY  YH HYYYYYYYYYHHYHHYYHHH   HYY Y      Y   
   129   52 C I  E     -LM 123 184C   0  612   14  III   I    I I  I I I I III  VV VIIIIIIIIIVVVVVVVIVI   VIV I      I   
   130   53 C L  E     +LM 122 183C   0  612   27  LLL   L    L L  L L L L LLL  LL LLLLLLLLLLLLLLLLLLLL   LLL L      L   
   131   54 C T  E     - M   0 182C   0  612   43  TTT   T    T T  T T T T TTT  TT TTTTTTTTTTTTTTTTTTTT   TTT T      T   
   132   55 C A    >>  -     0   0    0  613    2  AAA   A    A A  A A A A AAA  AA AAAAAAAAAAAAAAAAAAAA   AAA A      A   
   133   56 C A  G >4 S+     0   0    0  613    9  AAA   A    A A  A A A A AAA  AA AAAAAAAAAAAAAAAAAAAA   AAA A      A   
   134   57 C H  G >4 S+     0   0    7  613    0  HHH   H    H H  H H H H HHH  HH HHHHHHHHHHHHHHHHHHHH   HHH H      H   
   135   58 C i  G X4 S+     0   0    0  613    1  CCC   C    C C  C C C C CCC  CC CCCCCCCCCCCCCCCCCCCC   CCC C      C   
   136   59 C L  G << S+     0   0   31  613   66  LLL   L    L L  L L L L LLL  LL LLLLLLLLLLLLLLLLLVLV   LLL L      L   
   137   60 C Y  G <  S+     0   0  109  613   87  YYY   Y    Y Y  Y Y Y Y YYY  HH HHHHHHHQHHHHHHHHHQHQ   HNH H      D   
   138   61 C Q  S <  S+     0   0   95  613   78  QQQ   Q    Q Q  Q Q Q Q QQQ  QQ QQQQQQQQQQQQQQQQQQQQ   QQQ E      Q   
   139   61AC A        -     0   0   16  373   75  AAA   A    A A  A A A A AAA  AA AAAAAAAATAAAAAAAAAAA   AEA A      A   
   140   62 C K  S    S-     0   0  172  387   77  KKK   K    K K  K K K K KKK  KK KRRRRRKKRKKKKKKKKKKK   KKK K      K   
   141   63 C R  S    S-     0   0  162  602   78  RRR   R    R R  R R R R RRR  RR RRRRRRRKRRRRRRRRRKKK   RRR R      L   
   142   64 C F  E     -K  112   0C  36  609   54  FFF   F    F F  F F F F FFF  FF FFFFFFFFFFFFFFFFFFFF   FFF F      F   
   143   65 C K  E     -K  111   0C  67  609   79  KKK   K    K K  K K K K KKK  KK TKKKKKKTKKKKKKKTTTKT   KKT T      K   
   144   66 C V  E     -KN 110 161C   0  609   16  VVV   V    V V  V V V V VVV  VV VVVVVVVVVVVVVVVVVVVV   VVV V      V   
   145   67 C R  E     -KN 109 160C  40  609   55  RRR   R    R R  R R R R RRR  RR RRRRRRRRRRRRRRRRRRRR   RRR R      R   
   146   68 C V  E     +KN 108 159C   1  610   43  VVV   V    V V  V V V V VVV  VV VVVVVVVVVVVVVVVVVVVV   VVV V      V   
   147   69 C G  S    S+     0   0    9  610   15  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   148   70 C D        +     0   0   11  611   58  DDD   D    D D  D D D D DDD  DD DDDDDDDEDDDDEDEDDEDE   DDD E      D   
   149   71 C R  S    S+     0   0   24  611   73  RRR   R    R R  R R R R RRR  RR RRRRRRRRRLRRRRRRRRRR   HRR R      R   
   150   72 C N  B >   -P  234   0D  18  611   65  NNN   N    N N  D D D D DDD  DN NNNNNNNDNNDNNDDNNDND   NNN N      N   
   151   73 C T  T 3  S+     0   0   56  611   80  TTT   T    T T  M M M M MMM  TT TTTTTTTTTTTTTTTTTMLM   LTT L      K   
   152   74 C E  T 3  S-     0   0  119  611   84  EEE   E    E E  E E E E EEE  EE EEEEEEEDEEEEEEGEEDED   EEG E      E   
   153   75 C Q  S <  S-     0   0  130  610   85  QQQ   Q    Q Q  Q Q Q Q QQQ  KK KKKKKKKKEQHKKHSQQKKK   KKQ K      K   
   154   76 C E        +     0   0  165  610   85  EEE   E    E E  E E E E EEE  EE EEEEEEEEEEEEEEEEEEEE   EEE E      E   
   155   77 C E        -     0   0   93  469   27  EEE   E    E E  E E E E EEE  EE EEEEEEEEEDEEEEEEEEEE   EDD E      D   
   156   78 C G  S    S+     0   0   46  578   34  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   157   79 C G  S    S+     0   0   47  585   75  GGG   G    G G  G G G G GGG  GG NNNNNNNNNGNNNNDNNNDN   DNN N      N   
   158   80 C E        -     0   0   37  472   30  EEE   E    E E  E E E E EEE  EE EEEEEEEEEEEEEEEEEEEE   EEE E      E   
   159   81 C A  E     -N  146   0C  27  487   57  AAA   A    A A  A A A A AAA  TT MMMMMMMVMMEMMEVMMVAV   AMM M      T   
   160   82 C V  E     -N  145   0C  71  590   83  VVV   V    V V  V V V V VVV  VV VVVVVVAAAVTAATAAAAAA   AVV M      V   
   161   83 C H  E     -N  144   0C  14  599   76  HHH   H    H H  H H H H HHH  HH HHHHHHHHHHHHHHHHHHHH   HHH H      H   
   162   84 C E        -     0   0   90  602   78  EEE   E    E E  E E E E DEE  EE EEEEEEEEEEEEEEEEEEEE   EEE E      E   
   163   85 C V  E     -O  186   0C  27  607   64  VVV   V    V V  V V V V VVV  VV VVVVVVVVVVVVVVVVVVVV   VVV V      V   
   164   86 C E  E    S+     0   0C  70  608   73  EEE   E    E E  E E E E EEE  EE EDDDDDEEEDEEEEDEEEEE   EEE E      E   
   165   87 C V  E     -O  185   0C  13  609   72  VVV   V    V V  V V V V VVV  VV VVVVVVIMMMVVMVVMMLVL   VVM T      V   
   166   88 C V  E     -O  184   0C  72  610   46  VVV   V    V V  I I I I III  II VVVVVVIIIIVVIVITTATA   TIS V      I   
   167   89 C I  E     +O  183   0C  27  610   43  III   I    I I  I I I I III  II VIIIIILIIIVVIVIVVVVV   VIV I      I   
   168   90 C K  E     -O  182   0C  68  610   82  KKK   K    K K  K K K K KKK  KK KKKKKKKKKKKKKKKKKRKR   KKK K      K   
   169   91 C H    >   -     0   0   19  611   13  HHH   H    H H  H H H H HHH  HH HHHHHHHHHHHHHHHHHHHH   HHH H      H   
   170   92 C N  T 3  S+     0   0  156  611   61  NNN   N    N N  N N N N NNN  NN NNNNNNNNNNNNNNNSSNSN   SNG S      K   
   171   93 C R  T 3  S+     0   0  150  608   73  RRR   R    R R  R R R R RRR  RR RKKKKKKKKKRKKRKRRRRR   RKR K      E   
   172   94 C F    <   -     0   0   24  611    5  FFF   F    F F  F F F F FFF  FF FFFFFFFFFFFFFFFFFFFF   FFF F      F   
   173   95 C T     >  -     0   0   56  611   68  TTT   T    T T  T T T T TTT  SS VQQQQQVVIQVVVVVVVVVV   VDV N      D   
   174   96 C K  T  4 S+     0   0  145  561   78  KKK   K    K K  K K K K KKK  II KRRRRRRRRRKRKKRKKRRR   RNK T      N   
   175   97 C E  T  4 S+     0   0  174  569   91  EEE   E    E E  E E E E EEE  EE EDDDDDEEEDEEEEEEEEEE   EKE H      K   
   176   98 C T  T  4 S-     0   0   44  598   57  TTT   T    T T  T T T T TTT  TT TTTTTTTTTTTTTTTTTTTT   TTT T      T   
   177   99 C Y    ><  +     0   0   60  604   65  YYY   Y    Y Y  Y Y Y Y YYY  YY YYYYYYYYYYYYYYYYYYYY   YFY Y      F   
   178  100 C D  T 3   +     0   0   25  609   37  DDD   D    D D  D D D D DDD  DD DDDDDDDDDDDDDDDDDDDD   DND D      N   
   179  101 C F  T 3  S+     0   0   21  595   66  FFF   F    F F  F F F F FFF  FF YYYYYYFFFFFFFFFFFFFF   FCF C      C   
   180  102 C D    <   +     0   0    1  609    0  DDD   D    D D  D D D D DDD  DD DDDDDDDDDDDDDDDDDDDD   DDD D      D   
   181  103 C I        +     0   0    0  611   13  III   I    I I  I I I I III  II IIIIIIIIIIIIIIIIIIII   III I      I   
   182  104 C A  E     -MO 131 168C   0  611   60  AAA   A    A A  A A A A AAA  TT AAAAAAAAAAAAAAAAAAAA   AAA A      G   
   183  105 C V  E     -MO 130 167C   0  612   16  VVV   V    V V  V V V V VVV  VV VVVVVVVVVMVVVVVVVVVV   VVV V      L   
   184  106 C L  E     -MO 129 166C   0  613   30  LLL   L    L L  L L L L LLL  LL LLLLLLIIVLLLLLILLVLV   LLL L      L   
   185  107 C R  E     -MO 128 165C  40  613   43  RRR   R    R R  R R R R RRR  RR RRRRRRKKKRRRKRRRRKKK   KKR R      K   
   186  108 C L  E     - O   0 163C   0  613   16  LLL   L    L L  L L L L LLL  LL LLLLLLLLLLLLLLLLLLLL   LLL L      L   
   187  109 C K  S    S+     0   0  101  613   69  KKK   K    K K  K K K K KKK  KK KKKKKKKKKKKKKKRKKKKK   KKK K      K   
   188  110 C T  S    S-     0   0   82  614   74  TTT   T    T T  S S S S SSS  TT TTTTTTTTTTTTMTTTTTTT   TTT T      T   
   189  111 C P        -     0   0   48  614   39  PPP   P    P P  P P P P PPP  PP PPPPPPPPPPPPPPPPPPPP   PPP P      P   
   190  112 C I        -     0   0    4  562   63  III   I    I I  I I I I III  II IIIIIIIIIIIIIIIIIIII   III I      I   
   191  113 C T        -     0   0   95  566   73  TTT   T    T T  T T T T TTT  TT TTTTTTTTTTTTTTTRRTTT   TKQ T      K   
   192  114 C F        +     0   0   56  612   34  FFF   F    F F  F F F F FFF  FF FFFFFFFFFFFFFFFFFFFF   FFF F      F   
   193  115 C R  B >   -Q  196   0E  52  613   63  RRR   R    R R  R R R R RRR  RR RRRRRRRRRRRRRRRRRRRR   RRR R      R   
   194  116 C M  T 3  S+     0   0   29  594   77  MMM   M    M M  M M M M MMM  MM VMMMMMMMMERMMRRRRMTM   TMQ R      M   
   195  117 C N  T 3  S+     0   0   13  602   90  NNN   N    N N  N N N N NNN  NN NNNNNNNNNNNNNNNNNNNN   NNN N      N   
   196  118 C V  B <   +Q  193   0E   0  604   27  VVV   V    V V  V V V V VVV  VV VVVVVVVVVVVVVVVVVVVV   VVV V      V   
   197  119 C A        -     0   0    1  606   80  AAA   A    A A  A A A A AAA  AA AAAAAAAAAAAAAAAAAAAA   AAA A      A   
   198  120 C P        -     0   0    8  608   54  PPP   P    P P  P P P P PPP  PP PPPPPPPPPPPPPPPPPPPP   PPP P      P   
   199  121 C A        -     0   0    2  609   39  AAA   A    A A  A A A A AAA  AA AAAAAAAAAAAAAAAAAAAA   AAA A      A   
   200  122 C g  B     -c  290   0B   1  610   66  CCC   C    C C  C C C C CCC  CC CCCCCCCCCCCCCCCCCCCC   CCC C      C   
   201  123 C L        -     0   0   27  612    5  LLL   L    L L  L L L L LLL  LL LLLLLLLLLLLLLLLLLLLL   LLL L      L   
   202  124 C P        -     0   0    7  613   30  PPP   P    P P  P P P P PPP  PP PPPPPPPPPPPPPPPPPPPP   PPP P      P   
   203  124AC E     >  -     0   0   92  612   75  EEE   E    E E  E E E E EEE  AA EQQQQQEQEQQQEQQEEQEQ   EEE Q      E   
   204  125 C R  H  > S+     0   0  109  612   78  RRR   R    R R  R R R R RRR  RR KKKKKKKKKKKKKKKKKKKK   KKK K      K   
   205  126 C D  H  > S+     0   0  124  612   85  DDD   D    D D  D D D D DDD  DD DDDDDDDDDDDDDDDDDDND   NDD D      D   
   206  127 C W  H  >>S+     0   0    4  612   88  WWW   W    W W  W W W W WWW  WW WWWWWWWWWWWWWWWWWWWW   WWW W      W   
   207  128 C A  I  X>S+     0   0    0  612   75  AAA   A    A A  A A A A AAA  AA AAAAAAAAAAAAAAAAAAAA   AAA A      A   
   208  129 C E  I  <5S+     0   0   75  613   82  EEE   E    E E  E E E E EEE  EE EEEEEEEEEEEEEEEEEEEE   EEE E      E   
   209  130 C S  I  <5S+     0   0   70  614   66  SSS   S    S S  S S S S SSS  SS SSSSSSSSSASASSSAASAS   ASA A      S   
   210  131 C T  I  <5S+     0   0   18  108   73  TTT   T    T T  T T T T TTT  TT TTTTTTTTTTTTTTTTTTTT   TTT T      T   
   211  131AC L  I ><  S-     0   0  119  503   80  HHH   H    H H  H H H H HHH  HH HHHHHHHHHHHHHHHHHHHH   HHH H      H   
   227  146 C E  T 3  S+     0   0   47  527   75  EEE   E    E E  E E E E EEE  EE EEEEEEEEEEEEEEEEEEEE   EEE E      E   
   228  147 C K  T 3  S+     0   0  169  548   68  KKK   K    K K  K K K K KKK  KK MKKKKKKKKKMKKMKKKKRK   RMK K      M   
   229  149 C G  S <  S-     0   0   29  559   66  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   230  150 C R        -     0   0  213  584   86  RRR   R    R R  R R R R RRR  RR RRRRRRRRRRRRRRRRRRRR   RRR R      R   
   231  151 C Q  B     -R  224   0F  79  599   93  QQQ   Q    Q Q  Q Q Q Q QQQ  QQ LQQQQQAPPQLPTLPLLPPP   PTP Q      P   
   232  152 C S        -     0   0   14  607   51  SSS   S    S S  S S S S SSS  SS SSSSSSSSSSSSSSSSSSSS   SSS S      S   
   233  153 C T  S    S+     0   0   48  608   73  TTT   T    T T  T T T T TTT  TT PNNNNNTTAKTSTTTSSRSR   SVS S      V   
   234  154 C R  B    S-P  150   0D 102  608   85  RRR   R    R R  R R R R RRR  TT TIIIIIITTVTTTTITTTTT   TTT T      T   
   235  155 C L        -     0   0    3  610    3  LLL   L    L L  L L L L LLL  LL LLLLLLLLLLLLLLLLLLLL   LLL L      L   
   236  156 C K  E     -BD  98 221B  31  610   51  KKK   K    K K  K K K K KKK  KK KKKKKKKKKKKKKKKKKKKK   KKK K      K   
   237  157 C M  E     -BD  97 220B  18  611   94  MMM   M    M M  M M M M MMM  II MMMMMMMMMMMMMMMMMMMM   MMM M      M   
   238  158 C L  E     - D   0 219B   4  612   44  LLL   L    L L  L L L L LLL  LL LLLLLLLMLMLLLLLLLMLM   LLL L      L   
   239  159 C E  E     - D   0 218B 107  612   72  EEE   E    E E  E E E E EEE  EE EEEEEEEEEEEEEEEEEEEE   EEE T      E   
   240  160 C V  E     - D   0 217B   0  612   46  VVV   V    V V  V V V V VVV  VV VVVVVVVVVVVVVVVVVVVV   VVV V      V   
   241  161 C P  E     - D   0 216B  34  612   28  PPP   P    P P  P P P P PPP  PP PPPPPPPPPPPPPPPPPPPP   PPP P      P   
   242  162 C Y  E     -F  263   0B  36  613   46  YYY   Y    Y Y  Y Y Y Y YYY  YY YYYYYYYYYYYYYYYYYYYY   YYY Y      Y   
   243  163 C V  E     -F  262   0B  24  614   37  VVV   V    V V  V V V V VVV  VV VVVVVVVVVVVVVVVVVVVV   VVV V      V   
   244  164 C D     >  -     0   0   88  613   57  DDD   D    D D  D D D D DDD  DD DDDDDDDDDDDDDDDDDDDD   DDD D      D   
   245  165 C R  H  > S+     0   0   51  613   78  RRR   R    R R  R R R R RRR  RR RRRRRRRRRRRRRRRRRRRR   RRR R      R   
   246  166 C N  H  > S+     0   0  105  614   74  NNN   N    N N  N N N N NNN  NN NNNNNNNNNNNNNNNSSNNN   NNN N      N   
   247  167 C S  H  > S+     0   0   48  614   78  SSS   S    S S  S S S S SSS  TT TTTTTTTTTTSTTSTTTTTT   TTA T      T   
   248  168 C j  H  X S+     0   0    1  614    2  CCC   C    C C  C C C C CCC  CC CCCCCCCCCCCCCCCCCCCC   CCC C      C   
   249  169 C K  H >< S+     0   0   88  614   73  KKK   K    K K  K K K K KKK  KK KKKKKKKKKRKKKKKKKKKK   KKK K      K   
   250  170 C L  H 3< S+     0   0  150  574   89  LLL   L    L L  L L L L LLL  LL LLLLLLLLLLLLLRLLLLLL   LLL L      L   
   251  171 C S  H 3< S+     0   0   23  604   76  SSS   S    S S  S S S S SSS  SS SSSSSSSSSSSSSSSSSSSS   SSS S      S   
   252  172 C S    <<  -     0   0   20  607   83  SSS   S    S S  S S S S SSS  SS STTTTTSSSTSSSSSSSSSS   STS T      T   
   253  173 C S  S    S+     0   0   79  607   83  SSS   S    S S  S S S S SSS  SS SSSSSSSSSSSSKSSSSSSS   SGS G      R   
   254  174 C F  S    S-     0   0  124  607   79  FFF   F    F F  F F F F FFF  FF FFFFFFFFFFFFFFFFFFFF   FFF F      F   
   255  175 C I        -     0   0  100  608   87  III   I    I I  I I I I III  TT TSSSSSTSVSTTATTTTSLS   LSS T      I   
   256  176 C I        -     0   0   13  609   18  III   I    I I  I I I I III  II IIIIIIIIIIIIIIIIIIII   III I      I   
   257  177 C T    >   -     0   0   16  614   35  TTT   T    T T  T T T T TTT  TT TTTTTTTTTTTTTTTTTTTT   TTT T      T   
   258  178 C Q  T 3  S+     0   0  133  614   68  QQQ   Q    Q Q  Q Q Q Q QQQ  QQ QQQQQQQQQQQQTQQPPQPQ   PPP Q      S   
   259  179 C N  T 3  S+     0   0   24  614   60  NNN   N    N N  N N N N NNN  NN NNNNNNNNNNNNNNNNNNNN   NNN N      N   
   260  180 C M  E <   - G   0 311B   2  614   13  MMM   M    M M  M M M M MMM  MM MMMMMMMMMMMMMMMMMMMM   MMM M      M   
   261  181 C F  E     - G   0 310B   8  613   35  FFF   F    F F  F F F F FFF  FF FFFFFFFFFFFFFFFFFFFF   FFF F      F   
   262  182 C j  E     +FG 243 309B   1  614    1  CCC   C    C C  C C C C CCC  CC CCCCCCCCCCCCCCCCCCCC   CCC C      C   
   263  183 C A  E     +FG 242 308B   0  614   26  AAA   A    A A  A A A A AAA  AA AAAAAAAAAAAAAAAAAAAA   AAA A      A   
   264  184 C G  S    S-     0   0    3  614   10  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   265  185 C Y        -     0   0   56  591   57  YYY   Y    Y Y  Y Y Y Y YYY  YY YYYYYYYYYYYYYYYYYYYY   YYY Y      Y   
   266  185AC D  S    S-     0   0   81  594   83  DDD   N    H H  H H H H HHH  EE EEEEEEDDDDDDDDDDDDDD   DDD N      D   
   267  185BC T  S    S+     0   0   76  614   61  TTT   T    A A  A A A A AAA  AA AAAAAASSSAAAAATTTSES   ESA D      S   
   268  186 C K  S    S-     0   0  107  563   32  KKK   K    R R  K K K K KKK  RR RKKKKKKKNKRKKRNQQKQK   QKQ K      K   
   269  187 C Q  S    S+     0   0  102  569   37  QQQ   Q    Q Q  Q Q Q Q QQQ  QQ PLLLLLPPPQPLPPPPPPPP   PLP L      I   
   270  188 C E        +     0   0   33  613   55  EEE   E    E E  E E E E EEE  EE EEEEEEEEEEEEEEEEEEEE   EEE E      E   
   271  189 C D  B     -A   94   0A   7  614    4  DDD   D    D D  D D D D DDD  DD DDDDDDDDDDDDDDDDDDDD   DDD D      G   
   272  190 C A        -     0   0    7  614   42  AAA   A    A A  A A A A AAA  AA AAAAAAAAAAAAAAAAAAAA   AAA T      A   
   273  191 C k    >   -     0   0    7  614    3  CCC   C    C C  C C C C CCC  CC CCCCCCCCCCCCCCCCCCCC   CCC C      C   
   274  192 C Q  T 3  S+     0   0   90  614   25  QQQ   Q    Q Q  Q Q Q Q QQQ  QQ QQQQQQQQQQQQQQQQQQQQ   QQQ Q      Q   
   275  193 C G  T 3  S+     0   0    6  614    8  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   276  194 C D    X   +     0   0    0  614    0  DDD   D    D D  D D D D DDD  DD DDDDDDDDDDDDDDDDDDDD   DDD D      D   
   277  195 C S  T 3  S+     0   0   14  614    1  SSS   S    S S  S S S S SSS  SS SSSSSSSSSSSSSSSSSSSS   SSS S      D   
   278  196 C G  T 3  S+     0   0    0  614    0  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   279  197 C G    <   -     0   0    0  614    1  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   280  198 C P  E     - H   0 294B   1  614    2  PPP   P    P P  P P P P PPP  PP PPPPPPPPPPPPPPPPPPPP   PPP P      P   
   281  199 C H  E     -EH 219 293B   0  614   49  HHH   H    H H  H H H H HHH  HH HHHHHHHHHHHHHHHHHHHH   HHH H      H   
   282  200 C V  E     -EH 218 291B   3  614   26  VVV   V    V V  V V V V VVV  VV VVVVVVVVVVVVVVVVVVVV   VVV V      V   
   283  201 C T  E     - H   0 290B   0  614   66  TTT   T    T T  T T T T TTT  TT TTTTTTTTTTTTTTTTTTTT   TTT T      T   
   284  202 C R  E     + H   0 289B  99  614   70  RRR   R    R R  R R R R RRR  RR RRRRRRRRRRRRRRRRRRRR   RRR R      R   
   285  203 C F  E >  S- H   0 288B  22  614   71  FFF   F    F F  F F F F FFF  FF FFFFFFFFFFFFFFFFFFFF   FFF F      F   
   286  204 C K  T 3  S-     0   0   85  222   71  KKK   K    K K  K K K K KKK  KK KKKKKKKKKKRKKRKKKKRK   RKR Q      K   
   287  205 C D  T 3  S+     0   0  108  223   55  DDD   D    D D  D D D D DDD  DD NNNNNNDDDDDDDDDDDDDD   DDD D      D   
   288  206 C T  E <   - H   0 285B   3  233   75  TTT   T    T T  T T T T TTT  TT TTTTTTTTTTTTTTTTTTTT   TTT T      T   
   289  207 C Y  E     - H   0 284B  21  242   51  YYY   Y    Y Y  Y Y Y Y YYY  YY YYYYYYYYYYYYYYYYYYYY   YYY Y      Y   
   290  208 C F  E     -cH 200 283B   0  613   91  FFF   F    F F  F F F F FFF  FF FYYYYYFFFFFFFFFFFFFF   FFF Y      F   
   291  209 C V  E     + H   0 282B   1  613   38  VVV   V    V V  V V V V VVV  VV VVVVVVVVVVVVVVVVVVVV   VIV V      I   
   292  210 C T  E     +     0   0B   1  613   84  TTT   T    T T  T T T T TTT  TT TTTTTTTTTTTTTTTTTTTT   TTT T      T   
   293  211 C G  E     -IH 312 281B   0  613    0  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   294  212 C I  E     -IH 311 280B   0  613   19  III   I    I I  I I I I III  II IIIIIIIIIIIIIIIIIIII   III I      I   
   295  213 C V  E     +I  310   0B   7  613   14  VVV   V    V V  V V V V VVV  IV VVVVVVVVVVVVVVVVVVVV   VIV V      I   
   296  214 C S  E     -     0   0B   1  612    0  SSS   S    S S  S S S S SSS  SS SSSSSSSSSSSSSSSSSSSS   SSS S      S   
   297  215 C W  E     -I  309   0B  45  613    7  WWW   W    W W  W W W W WWW  WW WWWWWWWWWWWWWWWWWWWW   WWW W      W   
   298  216 C G        -     0   0   26  613    0  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   299  217 C E  S    S-     0   0   25  609   90  EEE   E    E E  E E E E EEE  EE EEEEEEEEEEEEEEEEEEEE   EEE E      E   
   300  218 C G  S    S-     0   0   19  612   13  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   301  220 C k  S    S-     0   0    7  613    2  CCC   C    C C  C C C C CCC  CC CCCCCCCCCCCCCCCCCCCC   CCC C      C   
   302  221 C A  S    S+     0   0    4  612   16  AAA   A    A A  A A A A AAA  AA AAAAAAAAAAAAAAAAAAAA   AAA A      A   
   303  222 C R    >   -     0   0  105  611   73  RRR   R    R R  R R R R RRR  RR RRRRRRRRRRRRQRRRRRRR   RRR R      R   
   304  223 C K  T 3  S+     0   0  152  611   64  KKK   K    K K  K K K K KKK  KK KKKKKKKKKKKKKKKKKKRK   RKK K      K   
   305  223AC G  T 3  S+     0   0   26  613   58  GGG   G    G G  G G G G GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   306  224 C K    <   -     0   0   43  613   85  KKK   K    K K  K K K K KKK  KK KKKKKKKKKKKKKKKKKKKK   KKK K      K   
   307  225 C Y        -     0   0   33  613   50  YYY   Y    Y Y  Y Y Y Y YYY  YY YYYYYYYYYYFYYFYFFYYY   YFF F      F   
   308  226 C G  E     -G  263   0B   4  611    2  GGG   G    G G  G G .   GGG  GG GGGGGGGGGGGGGGGGGGGG   GGG G      G   
   309  227 C I  E     -GI 262 297B   6  612   11  III   I    I I  I I I   III  II IIIIIIVIVIVVVVVVVVVV   VIV I      V   
   310  228 C Y  E     -GI 261 295B   1  612    1  YYY   Y    Y Y  Y Y Y   YYY  YY YYYYYYYYYYYYYYYYYYYY   YYY Y      Y   
   311  229 C T  E     -GI 260 294B   2  612   39  TTT   T    T T  T T T   TTT  TT TTTTTTTTTTTTTTTTTTTT   TTT T      T   
   312  230 C K  E >   - I   0 293B  21  612   42  KKK   K    K K  K K K   KKK  KK KKKKKKKKKKKKKKKKKKKK   KKK K      K   
   313  231 C V  G >  S+     0   0    1  611    8  VVV   V    V V  V V V   VVV  VV VVVVVVVVVVVVVVVVVVVV   VVV V      V   
   314  232 C T  G 3  S+     0   0    2  609   71  TTT   T    T T  T T T   TTT  SS TTTTTTTTTTSTTSTSSTTT   TTS T      T   
   315  233 C A  G <  S+     0   0   29  609   79  AAA   A    A A  A A A   AAA  GG ATTTTTSNSANANNNNNNNN   NNN N      N   
   316  234 C F  S <> S+     0   0    7  605   35  FFF   F    F F  F F F   FFF  FF FFFFFFFFFFFFFFFFFFFF   FFF F      F   
   317  235 C L  H  > S+     0   0   23  603   80  LLL   L    L L  L L L   LLL  LL LLLLLLLLLLLLLLLLLLLL   LLL L      L   
   318  236 C K  H  > S+     0   0  116  602   68  KKK   K    K K  K K K   KKK  KK KKKKKKKKKKKKKKKKKKKK   KKK K      N   
   319  237 C W  H  > S+     0   0   26  602    1  WWW   W    W W  W W W   WWW  WW WWWWWWWWWWWWWWWWWWWW   WWW W      W   
   320  238 C I  H  X S+     0   0    1  599   12  III   I    I I  I I I   III  II IIIIIIIIIIIIIIIIIIII   III I      I   
   321  239 C D  H  < S+     0   0   66  570   71  DDD   D    D D  D D D   DDD  DD NDDDDDDDDDEDDEDDDDED   EED E      E   
   322  240 C R  H >< S+     0   0  136  556   71  RRR   R    R R  R R R   RRR  RR RRRRRRRRRRKKRKKKKKRK   RRK K      R   
   323  241 C S  H >< S+     0   0    6  523   72  SSS   S    S S  S S S   SSS  SS SSSSSSCSSSSSSSSIISSS   SSI S      S   
   324  242 C M  T 3< S+     0   0   25  479   41  MMM   M    M M  M M M   MMM  MM MMMMMMMMMMMMMMMMMMMM   MMM M      M   
   325  243 C K  T <  S+     0   0  153  444   70  KKK   R    K K  K K K   KKK  KK KKKKKKKKKKRRKRRKKRRR   RKR R      K   
   326  244 C T    <         0   0   51  390   65  TTT   T    T T  T T T   TTT  TT TAAAAATAAAAAAAAAAGAG   A A A          
   327  245 C R              0   0  197  273   47  RRR   R    R R  R R R   RRR  RR QRRRRRKRRRRKKRRRRRRR   R   K          
## ALIGNMENTS   71 -  140
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1   49 L Q              0   0  101  671   35  QQQQQQQQQQ Q Q QQQ QQQ QQ Q    QQ QNQQQQQQQQQQQ Q QQQQQQQQQQQQQQQQQQQQ
     2   50 L a    >   +     0   0   22  858    0  CCCCCCCCCC C C CCC CCC CC C    CC CCCCCCCCCCCCC C CCCCCCCCCCCCCCCCCCCC
     3   51 L E  T 3  S+     0   0  187  858   80  EEEEEEEEEE E E EEE EEE EE E    KK EEQSLEESASLEE L EEEEEEESEEEEEEEDDDEE
     4   52 L T  T 3  S-     0   0  105  864   61  SSSSSSSSSS S N NNS SST TG G    PS SLSSSSSSSSSSS S SSSSSSSSSSSSSSSSSSSS
     5   53 L S    <   +     0   0   89  868   72  SNNSSSSSNS N N NSQ NNQ QH H    NN NSNNNNNNPNNNN S NNNNNNNNNNNNNNNNNNSN
     6   54 L P        +     0   0   10  878   31  PPPPPPPPPP P P PPP PPP PP P    PP PSPPPPPPPPPPP P PPPPPPPPPPPPPPPPPPPP
     7   55 L b        -     0   0   18  893   21  CCCCCCCCCC C C CCC CCC CC C    CC CCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
     8   56 L Q  S    S+     0   0   92  892   83  QLQQQQQQQQ Q Q QQQ LLQ QL L    RQ RDQHHLLHLHHLL QLLLLLLLLHLLLLLLLLLLLL
     9   57 L N  S    S-     0   0   63  893   51  NNNNNNNNNH N N NNN NNN NN N    YY NSYYYNNYNYYNN NNNNNNNNNYNNNNNNNNNNNN
    10   58 L Q  S    S-     0   0  152  893   57  QQQQQQQQQE Q Q QQH QQQ QQ Q    GG RLGGGGGGNGRGG GNGGGGGGGGGGGGGGGQQQGG
    11   59 L G        -     0   0   16  893   40  GGGGGGGGGG G G GGG GGG GG G    GG GAGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGG
    12   60 L K  E     -S   23   0G 117  852   79  ERKAAAAATR T N TTD RRV VH H    TS RLSQTRSHNQTMI KNMMSSSSSHSSMSSSSSSSLS
    13   61 L a  E     -S   22   0G  45  882   10  CCCCCCCCCC C C CCC CCC CC C    CC CCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
    14   62 L K  E     -S   21   0G 155  890   81  RKMRRRRRKK K K RRK KKK KK K    KK QLNKKKRKKKKKK EKKKKKKKKKKKKKKKKEEEKK
    15   63 L X  E     +S   20   0G 120  768   39  DDDDDDDDDD D D DDD DDD DD D    DD D.DDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDDD
    16   64 L G        -     0   0   44  862   73  GGSGGGGGGG G G GGG GGG GG G    GG G.GGGNDGGGGDE GGDDDDDDDGDDDDDDDLLLDD
    17   65 L L  S    S-     0   0  152  871   64  LLLIIIIILL L L LIV LLL LI I    II ILIIIIVIILIII MIIIIIIIILIIIIIIILLLII
    18   66 L G  S    S+     0   0   67  883   63  GGGGGGGGGD G G SGG GGG AG G    GN GSNGGNNGNGGNN NNNNNNNNNGNNNNNNNGGGNN
    19   67 L E        -     0   0  119  837   61  SEGGGGGGME M E EDE EEE ED D    ME L.ESSSSSLSSSS TLSSSSSSSSSSSASSSSSSSS
    20   68 L Y  E     -S   15   0G  37  883   11  YYYYYYYYYY Y Y YYY YYY YY Y    YY Y.YYYYYYYYYYY YYYYYYYYYYYYYYYYYYYYYY
    21   69 L T  E     -S   14   0G  71  886   82  TNTTTTTTTT T T ELT TTT TT T    TT T.TTTEETSTTEE TSEEEEEEETEEEEEEETTTEE
    22   70 L b  E     -S   13   0G  20  889    0  CCCCCCCCCC C C CCC CCC CC C    CC C.CCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
    23   71 L T  E     -S   12   0G  85  890   86  TTTTTTTTSA S I SIS TTL LT T    LF NSLTTWWTQSTWW WQWWWWWWWSWWWWWWWTTTWW
    24   72 L c        -     0   0   44  890    0  CCCCCCCCCC C C CCC CCC CC C    CC CECCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
    25   73 L L    >   -     0   0   62  890   88  TQLSSSSSVL V M QTM QQS SA A    LN LNNLLPRLPLLLR PPQQPPPPPLPPLPPPPLLLQP
    26   74 L E  T 3  S+     0   0  177  890   75  EEEEEEEEEE E E EEE EEA AE E    EP KSADAFLDEDPAK AEAAFFFFFDFFALFFFPPPVF
    27   75 L G  T 3  S+     0   0   29  893   20  GGGGGGGGGG G G GGG GGG GG G    GG GEGGGGGGGGGGG RGGGGGGGGGGGGGGGGGGGGG
    28   76 L F  E <   +T   36   0H  40  893    9  FYYFFFFFYY Y Y FYY YYY YF F    YF YFFYYFFYFYYFY FFFFFFFFFYFFFFFFFFFFFF
    29   77 L E  E     +T   35   0H  74  893   73  EEEEEEEEEE E E EEE EEE EE E    QE HPEQEEEQKQEEE SKEEEEEEEQEEEEEEEAAAEE
    30   78 L G  S >  S-     0   0   32  889    5  GGGGGGGGGG G G GGG GGG GG G    GG G.GGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGG
    31   79 L K  T 3  S+     0   0  156  891   73  KRKKKKKKQR Q K KKK RRK KK K    KK K.KKKKKKKKKKK KKKKKKKKKKKKKQKKKKKKKK
    32   80 L N  T 3  S-     0   0   33  892   62  NNNNNNNNDN D N NNN NNN NN N    NN N.NNNNNNNNNNN NNNNNNNNNNNNNNNNNDDDNN
    33   81 L c  S <  S+     0   0    1  892    3  CCCCCCCCCC C C CCC CCC CC C    CC C.CCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
    34   82 L E        +     0   0   87  891   44  EEEEEEEEEE E E EEE EED DE E    DE EQEEEEEEEEEEE EEEEEEEEEEEEEEEEEEEEEE
    35   83 L L  E    S-T   29   0H  96  889   88  LLLLLLLLLL P F LLF LLT TF F    TT IGTFHLLFLFHLL LLLLLLLLLFLLLLLLLIIILL
    36   84 L F  E     -T   28   0H 139  889   83  FPSFFFFFFS V S SFS PPT TS S    VV EPVVDDDVEVVDD EEDDDDDDDVDDgGDDDAAVDD
    37   85 L T        -     0   0   44  677   75  VMMVVVVVTT T K TTS MMT TT T    IK TvKILAtITIVAA MTAAVVVVVIVVtAVVV..IAV
    38   86 L R        +     0   0   57  408   92  RRRRRRRRRR R L RRV RGV VR R    PL PrLPL.dPIPV.. AI.......P..d......A..
    39   87 L K        +     0   0   96  535   81  KKKKKKKKKK K T KKA KKK KE E    KQ KKQKK.SKTKK.. KT.......K..A....KKK..
    40   88 L L        -     0   0   91  608   90  LFALLLLLLL L L LLY FFI II I    YL LLLFSSTFRYSRD QRTTTTTTTYTTRTTTTRRRTT
    41   89 L d  S  > S+     0   0   15  617   29  CCCCCCCCCC C C CCC CCC CC C    CC CCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
    42   90 L S  T  4 S+     0   0   98  624   84  SSSRRRRRSS S S SSS SSS SS S    KS GSSRRSSKSKRSS HSSSNNNNNKNNSSNNNDDDNN
    43   91 L L  T >4 S-     0   0  120  627   87  LQLLLLLLLV L L LLL RRL LL L    LL LLLIVIIIVILII VVIIIIIIIIIIIIIIIVVVII
    44   92 L D  G >4 S-     0   0  107  638   73  DDDDDDDDDD D D DDD NNN ND D    TN NDNNDKKNNNFKK NNKKKKKKKNKKKKKKKNNNKK
    45   93 L N  G >< S-     0   0    8  700   56  NNNNNNNNNN N N NNN NNN NN N    NN NNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNN
    46   94 L G  G <  S-     0   0    0  882   52  GGGGGGGGGG G G GGG GGG GG G    GG GGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGG
    47   95 L D  G <  S+     0   0   44  887   62  DDDDDDDDGD G E DDE DDD DG G    DD GDEDNRRDKDNRG GKRRRRRRRDRRRRRRRDDDRR
    48   96 L e    <   -     0   0    0  892    0  CCCCCCCCCC C C CCC CCC CC C    CC CCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
    49   97 L D  S    S-     0   0   59  892   74  DDDDDDDDDE D D DED DDE ED D    DD VDDEWTKEHEWKK MHKKEEKEEEEEKKKKEAAAKE
    50   98 L Q  S    S+     0   0    2  892   63  QQQQQQQQQQ Q Q QQQ QQQ QQ Q    HQ HQQQHQQQQQHQQ HQQQQQQQQQQQQQQQQHHHQQ
    51   99 L F  E     -U   62   0I   4  892   80  FFFFFFFFFF F F YFF FFF FF F    FF FFYFFFFFFFFFF FFFFFFFFFFFFFFFFFFFFFF
    52  100 L d  E     +U   61   0I  10  893    1  CCCCCCCCCC C C CCC CCC CC C    CC CCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
    53  101 L H  E     -U   60   0I  68  893   87  RRSRRRRRKR K K QQK RRK KR R    KK KRKSKKKSKSKKK IKKKKKKKKSKKKEKKKEEEKK
    54  102 L E  E     -U   59   0I  92  893   68  EEEEEEEEEE E E EEE EES SE E    PV VEAVPFKVTITTM VTRRNNNNNINNTRNNNPPPKN
    55  103 L E  S    S-     0   0  100  893   82  EEEEEEEEEE E E VVA EEV VE E    VV HEVrVssqnkVgN DnddsstsskssgdttsLLLgs
    56  104 L Q  S    S-     0   0  175  693   73  QQQQQQQQEQ E K QQK IIV VR R    KD RQDdQdddkvQde kkdddddddsdddndddgggdd
    57  105 L N  S    S+     0   0  154  838   66  NNGNNNNNNS N S NNN ..N NS S    NR ENRkNHNkPkNGn yPNNNNNNNkNNGNNNNfffNN
    58  106 L S  S    S-     0   0   58  853   65  SSSSSSSSSS S T SST SST TE E    GF SSDDDKKDGDDKK GGKKKKKKKDKKKKKKKGGGKK
    59  107 L V  E     -U   54   0I   7  890   79  VVVVVVVVVV V V VVV VVV VV V    VI VVVVTVVVLVTVV ALVVVVVVVVVVVVVVVAAAVV
    60  108 L V  E     -U   53   0I  45  891   88  VVVVVVVVLV L V AVV VVV VR R    VV DVVVQVVLKVQVV VKVVVVVVVMVVVVVVVKKKVV
    61  109 L e  E     +U   52   0I   5  893    1  CCCCCCCCCC C C CCC CCC CC C    CC CCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
    62  110 L S  E     -U   51   0I  24  893   75  SSASSSSSSS S S SSS SSS SS S    SS SSSSSSSSSSSSS DSSSSSSSSSSSSSSSSSSSSS
    63  111 L f        -     0   0   23  893    0  CCCCCCCCCC C C CCC CCC CC C    CC CCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
    64  112 L A    >   -     0   0    8  893   75  AAAAAAAAAA A A AAA AAA AA A    AT AATAATTAATATI AATTTTTTTTTTTTTTTAAATT
    65  113 L R  T 3  S+     0   0  149  893   80  KSSSSSSSSG S S KKK SSQ QH H    TN KRNDEEEDVSETS EVAAEEEEESEETEEEETTTTE
    66  114 L G  T 3  S+     0   0   24  893    8  GGGGGGGGGG G G GGG GGG GG G    GG DGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGG
    67  115 L Y  E <   -V   78   0J  20  893   11  YYYYYYYYYY Y Y YYY YYY YY Y    YY YYYYYYYYYYYYY YYYYYYYYYYYYYYYYYYYYYY
    68  116 L T  E     -V   77   0J  72  891   85  FIVFFFFFTV T I TTI III IV V    VV .TIARQRVIERRQ RIRRRRRRRERRRQRRRRRRRR
    69  117 L L  E     -V   76   0J  67  888   64  LLLLLLLLLL L L LIL LLL LL L    LL .LLLLLLLLLLLL LLLLLLLLLLLLLLLLLVVVLL
    70  118 L A    >   -     0   0   23  889   78  GDAGGGGGGA G G GGG DDG GG G    GG EGGAGAAAGAGAG AGAAAAAAAAAAAAAAATTTAA
    71  119 L D  T 3  S+     0   0  175  889   77  NDDNNNNNDD D D DND DDD DD D    AE SDEEDEEEPEVEE VPQQEEEEEEEEEKEEEDDDEE
    72  120 L N  T 3  S-     0   0   92  694   44  DNDDDDDDNN N D DDD NND DD D    DN RDNDNNNDDDDDD DDDDNNNNNDNNDDNNNDDDDN
    73  121 L G  S <  S+     0   0   16  713   66  GGGGGGGGGG G G SGG DDQ QS S    EG GGGGGQKGRGGQQ GRQQQQQQQGQQQQQQQGGGQQ
    74  122 L K  S    S+     0   0   71  687   76  KKKKKKKKKK K K KKK KKK KK K    KK KKKKFKKKFKFKK RFKKKKKKKKKKKKKKKLLLKK
    75  123 L A        -     0   0   22  685   66  SSSSSSSSSS S S SSS SSS SS S    SS YSSHSSSQSQSSS SSSSSSSSSQSSSSSSSDDDSS
    76  124 L f  E     -V   69   0J  12  847    9  CCCCCCCCCC C C CCC CCC CC C    CC CCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
    77  125 L I  E     -V   68   0J  78  846   80  LIVIIIIIIV I I III III IV V    II IVLVIEEVIVIEE EIEEEEEEEVEEEEEEEQQQEE
    78  126 L P  E     -V   67   0J  62  850   71  SSSSSSSSSS S P SSP SSP PS S    PP PSPAAPPAPSAPP PPPPPPPPPSPPPPPPPPPPPP
    79  127 L T  S    S+     0   0  103  652   80  TTTTTTTTTT T T TTT TTT TT T    TT QTTTEATTEKEAA REAAAAAAAKAAAAAAAEEEAA
    80  128 L G  S    S-     0   0   32  788   69  AEGAAAAAEE E E EEE EVV VE E    ED VEEVGVVVVVGVV GVVVVVVVVVVVVVVVVTTTVV
    81  129 L P  S    S+     0   0  116  601   75  PPPPPPPPLP L P VMP SAP PR R    PK PPKKEPPKPKDPP QPPPPPPPPKPPPPPPPEEEPP
    82  130 L Y  S    S+     0   0   59  794   86  FYFFFFFFFF F Y FFY YPF FF F    FY YFYYFFFYYYFFY YYFFFFFFFYFFFFFFFFFFFF
    83  131 L P    >   -     0   0   17  799   62  PPPPPPPPPP P P PPP PTP PP P    PS PPSPSPPPPPSPP PPPPPPPPPPPPPPPPPPPPPP
    84  132 L g  T 3  S+     0   0   16  800    5  CCCCCCCCCC C C CCC CCC CC C    CC CCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCC
    85  133 L G  T 3  S+     0   0    0  712   37  GGGGGGGGGG G G GGG G G GG G    GG GGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGG
    86  134 L K    <   -     0   0   69  588   68  KKKKKKKKKK K K KKK K K KK K    KR RKRKRRRKKKRRR RKRRRRRRRKRRRRRRRKKKRR
    87  135 L Q        -     0   0   37  477   65  TLRIIIIIVT V Y TVE L L LF F    VR IQRVNVVVVVIVV LVVVVVVVVVVVVIVVVTTTVV
    88  136 L T        +     0   0    4  428   78  NTTTTTTTTT T T TTT T T TT T    YH  IHFISSSALISS  ASSSSSSSLSSSSSSSAAASS
    89  137 L L        +     0   0  105  372   61  KLLTTTTTLT L V GGL L V VQ Q    LM  LMLK VV MKVL  FVVVVVVVVVVVIVVVLLLVV
    90  138 L E              0   0  104  274   69  G TGGGGGGR G D GGE P G GG G    KR  GKVS SV KSS      SSSSSKSSS SSS   SS
    91  139 L R              0   0  231  199   47  R RRRRRRRR R R RRR Q R RR R    RR  RRRR  R RR       QQQQQRQQ  QQQ   HQ
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2            I I I   I   I  I II V  I                                    
    94   17 C V  B     -A  271   0A   7  590    9            V V V   V   V  V VV V  V             I                      
    95   18 C G  S    S+     0   0   25  591    6            G G G   G   G  G GG G  N             N                      
    96   19 C G  S    S-     0   0   26  592    0            G G G   G   G  G GG G  G             G                      
    97   20 C Q  E     -B  237   0B  98  593   95            R R R   R   R  D RD R  V             Q                      
    98   21 C E  E     -B  236   0B  80  594   67            E E D   D   D  E DE D  D             D                      
    99   22 C h        -     0   0    8  594   58            C C C   C   C  C CC C  C             C                      
   100   23 C K    >   -     0   0  123  593   78            H H Q   N   K  K KL R  L             P                      
   101   24 C D  T 3  S+     0   0   60  594   85            D D E   D   D  L EP P  P             P                      
   102   25 C G  T 3  S+     0   0    0  595   74            G G G   G   G  G GG G  G             G                      
   103   26 C E  S <  S+     0   0   36  595   66            E E E   E   E  E EQ E  E             Q                      
   104   27 C h    >   +     0   0    4  595   92            C C C   C   C  C CC C  C             C                      
   105   28 C P  T 3   +     0   0    0  599    9            P P P   P   P  P PP P  P             P                      
   106   29 C W  T 3  S+     0   0    5  600   26            W W W   W   W  W WW W  W             W                      
   107   30 C Q  E <   -J  122   0C   7  601   26            Q Q Q   Q   Q  Q QqQQ  Q             Q                      
   108   31 C A  E     -JK 121 146C   1  593   49            A A A   A   .  A .vAA  A             A                      
   109   32 C L  E     -JK 120 145C   3  598   68            L L L   L   .  V .LVL  L             L                      
   110   33 C L  E     -JK 119 144C   0  601    9            L L L   L   .  L .LLL  L             L                      
   111   34 C I  E     -JK 117 143C   0  601   81            V V I   I   .  I .NLV  I             I                      
   112   35 C N  E >   - K   0 142C  30  601   88            n n Y   K   .  N .ENS  N             N                      
   113   36 C E  T 3  S+     0   0   63  117   78            e e E   E   .  E ..EE  E             E                      
   114   37 C E  T 3  S-     0   0  136  242   77            N N N   N   .  K .EEE  D             D                      
   115   38 C N  S <  S+     0   0   84  565   53            G G K   N   .  E .GGN  N             S                      
   116   39 C E        -     0   0  100  589   94            Q Q E   E   .  E .EEE  I             I                      
   117   40 C G  E     +J  111   0C  14  600   57            G G G   G   .  E .EEG  G             G                      
   118   41 C F  E     +     0   0C  28  611   33            F F F   F   .  F FFFF  F             F                      
   119   42 C i  E     -J  110   0C   0  612    1            C C C   C   .  C .CCC  C             C                      
   120   43 C G  E     -J  109   0C   1  612    1            G G G   G   .  G .GGG  G             G                      
   121   44 C G  E     -J  108   0C   0  612    9            G G G   G   .  G .GGG  G             G                      
   122   45 C T  E     -JL 107 130C   0  612   45            T T T   T   .  T .TTT  T             T                      
   123   46 C I  E     + L   0 129C   0  612   23            I I I   I   .  I .III  I             I                      
   124   47 C L        -     0   0    6  612   27            L L L   L   .  L .LLL  L             V                      
   125   48 C S  S    S-     0   0   22  612   56            N N N   N   .  N .NNS  N             S                      
   126   49 C E  S    S+     0   0   99  612   63            E E E   E   .  E .EEK  E             E                      
   127   50 C F  S    S+     0   0   42  612   83            Y Y Y   F   .  D .NND  Y             Y                      
   128   51 C Y  E     - M   0 185C   7  612   34            Y Y F   Y   .  F .FFF  F             I                      
   129   52 C I  E     -LM 123 184C   0  612   14            I I V   I   .  I .III  V             I                      
   130   53 C L  E     +LM 122 183C   0  612   27            L L L   L   .  L .LLL  L             L                      
   131   54 C T  E     - M   0 182C   0  612   43            S S S   T   .  T .TTT  S             T                      
   132   55 C A    >>  -     0   0    0  613    2            A A A   A   .  A KAAA  A             A                      
   133   56 C A  G >4 S+     0   0    0  613    9            A A A   A   .  A LAAA  A             A                      
   134   57 C H  G >4 S+     0   0    7  613    0            H H H   H   .  H VHHH  H             Q                      
   135   58 C i  G X4 S+     0   0    0  613    1            C C C   C   .  C CCCC  C             C                      
   136   59 C L  G << S+     0   0   31  613   66            M M M   L   .  I DIIM  M             V                      
   137   60 C Y  G <  S+     0   0  109  613   87            H H Y   D   .  N ENNN  N             A                      
   138   61 C Q  S <  S+     0   0   95  613   78            Q Q P   Q   .  Q GQQQ  Q             Q                      
   139   61AC A        -     0   0   16  373   75            A A L   A   .  S .TTT  S             T                      
   140   62 C K  S    S-     0   0  172  387   77            K K K   K   .  K .KKK  L             R                      
   141   63 C R  S    S-     0   0  162  602   78            R R R   L   .  E QEEY  S             H                      
   142   64 C F  E     -K  112   0C  36  609   54            F F F   F   .  I EIIF  T             L                      
   143   65 C K  E     -K  111   0C  67  609   79            K K Q   K   .  K CNKK  R             K                      
   144   66 C V  E     -KN 110 161C   0  609   16            V V V   V   .  V GVVV  V             L                      
   145   67 C R  E     -KN 109 160C  40  609   55            R R L   R   .  V TVVT  V             R                      
   146   68 C V  E     +KN 108 159C   1  610   43            V V V   V   V  V SVVV  V             L                      
   147   69 C G  S    S+     0   0    9  610   15            G G G   A   S  G GGGG  G             G                      
   148   70 C D        +     0   0   11  611   58            E E E   A   D  E AEEE  E             V                      
   149   71 C R  S    S+     0   0   24  611   73            R R R   L   R  V CVVL  F             S                      
   150   72 C N  B >   -P  234   0D  18  611   65            D D D   .   N  D DDDN  D             N                      
   151   73 C T  T 3  S+     0   0   56  611   80            T T T   .   T  R RRRR  T             T                      
   152   74 C E  T 3  S-     0   0  119  611   84            E E R   .   E  E DEEE  L             S                      
   153   75 C Q  S <  S-     0   0  130  610   85            K K K   .   K  K TKK.  V             H                      
   154   76 C E        +     0   0  165  610   85            K K E   .   E  E eKK.  N             S                      
   155   77 C E        -     0   0   93  469   27            D D D   .   D  E eEET  E             G                      
   156   78 C G  S    S+     0   0   46  578   34            S S G   .   G  H GQQR  G             G                      
   157   79 C G  S    S+     0   0   47  585   75            S S N   .   N  S NSSE  R             N                      
   158   80 C E        -     0   0   37  472   30            E E E   .   E  E EEEG  E             E                      
   159   81 C A  E     -N  146   0C  27  487   57            M M E   .   M  T MSST  V             A                      
   160   82 C V  E     -N  145   0C  71  590   83            A A A   .   V  T VMMA  T             L                      
   161   83 C H  E     -N  144   0C  14  599   76            H H H   .   H  H HHHH  H             H                      
   162   84 C E        -     0   0   90  602   78            E E E   .   E  T ETTR  D             V                      
   163   85 C V  E     -O  186   0C  27  607   64            V V V   .   V  A VVVV  V             A                      
   164   86 C E  E    S+     0   0C  70  608   73            E E E   .   E  E EDDE  D             D                      
   165   87 C V  E     -O  185   0C  13  609   72            K K K   .   V  K MKKK  E             A                      
   166   88 C V  E     -O  184   0C  72  610   46            V V V   .   I  I TIII  I             I                      
   167   89 C I  E     +O  183   0C  27  610   43            I I L   .   V  F VLII  L             V                      
   168   90 C K  E     -O  182   0C  68  610   82            V V T   .   K  V KVVI  I             T                      
   169   91 C H    >   -     0   0   19  611   13            H H H   .   H  H HHHH  H             H                      
   170   92 C N  T 3  S+     0   0  156  611   61            S S K   .   K  S SSSP  K             H                      
   171   93 C R  T 3  S+     0   0  150  608   73            K K G   .   G  K RKKK  N             G                      
   172   94 C F    <   -     0   0   24  611    5            F F F   .   F  Y FFFF  Y             Y                      
   173   95 C T     >  -     0   0   56  611   68            V V V   .   D  I VIDV  M             S                      
   174   96 C K  T  4 S+     0   0  145  561   78            K K L   .   N  A RAAK  A             P                      
   175   97 C E  T  4 S+     0   0  174  569   91            K K E   .   K  E EEEL  D             Q                      
   176   98 C T  T  4 S-     0   0   44  598   57            T T T   .   T  T TTTT  T             T                      
   177   99 C Y    ><  +     0   0   60  604   65            Y Y F   .   Y  Y YYYY  Y             Y                      
   178  100 C D  T 3   +     0   0   25  609   37            D D D   .   N  D DDDD  H             S                      
   179  101 C F  T 3  S+     0   0   21  595   66            F F N   .   C  N FNNY  N             N                      
   180  102 C D    <   +     0   0    1  609    0            D D D   .   D  D DDDD  D             D                      
   181  103 C I        +     0   0    0  611   13            I I I   .   I  I IIIM  I             V                      
   182  104 C A  E     -MO 131 168C   0  611   60            A A A   .   A  A AAAA  A             A                      
   183  105 C V  E     -MO 130 167C   0  612   16            V V L   .   V  L VLLV  L             L                      
   184  106 C L  E     -MO 129 166C   0  613   30            I I I   L   L  I LLLI  I             V                      
   185  107 C R  E     -MO 128 165C  40  613   43            K K K   K   K  K KKKK  K             K                      
   186  108 C L  E     - O   0 163C   0  613   16            L L L   L   L  L LLLL  L             L                      
   187  109 C K  S    S+     0   0  101  613   69            K K K   K   K  K RKKK  S             A                      
   188  110 C T  S    S-     0   0   82  614   74            T T K   T   T  E TEED  K             T                      
   189  111 C P        -     0   0   48  614   39            P P P   P   P  P PPPS  P             P                      
   190  112 C I        -     0   0    4  562   63            I I I   I   I  I IIII  I             I                      
   191  113 C T        -     0   0   95  566   73            T T R   K   K  Q RRRN  K             R                      
   192  114 C F        +     0   0   56  612   34            F F F   F   F  F FFFF  F             F                      
   193  115 C R  B >   -Q  196   0E  52  613   63            R R R   R   R  S RSST  T             T                      
   194  116 C M  T 3  S+     0   0   29  594   77            M M R   M   M  E HEEQ  K             R                      
   195  117 C N  T 3  S+     0   0   13  602   90            N N N   N   N  Y NYYN  F             Y                      
   196  118 C V  B <   +Q  193   0E   0  604   27            V V V   V   V  V VVVI  I             I                      
   197  119 C A        -     0   0    1  606   80            S S A   A   A  V AIII  I             L                      
   198  120 C P        -     0   0    8  608   54            P P P   P   P  P PPPP  P             P                      
   199  121 C A        -     0   0    2  609   39            A A A   A   A  A AAAA  A             A                      
   200  122 C g  B     -c  290   0B   1  610   66            C C C   C   C  C CCCC  C             C                      
   201  123 C L        -     0   0   27  612    5            L L L   L   L  L LLLI  L             L                      
   202  124 C P        -     0   0    7  613   30            P P P   P   P  P PPPS  P             P                      
   203  124AC E     >  -     0   0   92  612   75            E E E   E   E  Q EKKD  E             E                      
   204  125 C R  H  > S+     0   0  109  612   78            K K K   K   K  A KAAP  R             Q                      
   205  126 C D  H  > S+     0   0  124  612   85            D D D   D   D  D DDDD  E             D                      
   206  127 C W  H  >>S+     0   0    4  612   88            W W W   W   W  F WFFF  F             F                      
   207  128 C A  I  X>S+     0   0    0  612   75            A A A   A   A  A AAAA  A             M                      
   208  129 C E  I  <5S+     0   0   75  613   82            E E E   E   E  N ENND  E             E                      
   209  130 C S  I  <5S+     0   0   70  614   66            D D A   S   S  E AEEQ  R             K                      
   210  131 C T  I  <5S+     0   0   18  108   73            I I V   T   T  V TVVV  I             V                      
   211  131AC L  I ><  S-     0   0  119  503   80            H H H   H   H  F HFYH  R             l                      
   227  146 C E  T 3  S+     0   0   47  527   75            E E E   E   E  E EEDE  E             G                      
   228  147 C K  T 3  S+     0   0  169  548   68            K K K   M   M  A RGGR  G             E                      
   229  149 C G  S <  S-     0   0   29  559   66            G G G   G   G  G GGGG  G             G                      
   230  150 C R        -     0   0  213  584   86            R R R   R   R  R RRQH  L             Q                      
   231  151 C Q  B     -R  224   0F  79  599   93            P P T   R   T  L LTLQ  Q             P                      
   232  152 C S        -     0   0   14  607   51            S S S   S   S  S SSPA  S             S                      
   233  153 C T  S    S+     0   0   48  608   73            T T E   V   V  K SKKT  T             A                      
   234  154 C R  B    S-P  150   0D 102  608   85            V V T   T   T  R TKKK  V             I                      
   235  155 C L        -     0   0    3  610    3            L L L   L   L  L LLLL  L             L                      
   236  156 C K  E     -BD  98 221B  31  610   51            K K K   K   K  K KKKQ  Q             Q                      
   237  157 C M  E     -BD  97 220B  18  611   94            M M M   M   M  V MVVM  K             R                      
   238  158 C L  E     - D   0 219B   4  612   44            L L L   L   L  L LLLL  L             L                      
   239  159 C E  E     - D   0 218B 107  612   72            E E T   E   E  E EEAQ  T             S                      
   240  160 C V  E     - D   0 217B   0  612   46            V V V   V   V  V VVLV  V             V                      
   241  161 C P  E     - D   0 216B  34  612   28            P P P   P   P  P PPPP  P             P                      
   242  162 C Y  E     -F  263   0B  36  613   46            Y Y F   Y   Y  Y YYFY  Y             Y                      
   243  163 C V  E     -F  262   0B  24  614   37            V V V   V   V  V VVVV  V             V                      
   244  164 C D     >  -     0   0   88  613   57            E E D   D   D  D DNNE  D             D                      
   245  165 C R  H  > S+     0   0   51  613   78            R R R   R   R  R RRSR  R             W                      
   246  166 C N  H  > S+     0   0  105  614   74            S T N   N   N  S SNTH  S             Q                      
   247  167 C S  H  > S+     0   0   48  614   78            T T T   T   T  T TTTR  K             T                      
   248  168 C j  H  X S+     0   0    1  614    2            C C C   C   C  C CCCC  C             C                      
   249  169 C K  H >< S+     0   0   88  614   73            K K K   K   K  K KKKK  I             M                      
   250  170 C L  H 3< S+     0   0  150  574   89            Q Q L   L   L  Q LQQE  E             D                      
   251  171 C S  H 3< S+     0   0   23  604   76            S S S   S   S  S SSSS  S             S                      
   252  172 C S    <<  -     0   0   20  607   83            S S S   T   T  T STTS  S             T                      
   253  173 C S  S    S+     0   0   79  607   83            S S T   P   P  N SNSN  K             P                      
   254  174 C F  S    S-     0   0  124  607   79            F F F   F   F  F FLFF  F             L                      
   255  175 C I        -     0   0  100  608   87            D D T   S   S  A AAVA  K             S                      
   256  176 C I        -     0   0   13  609   18            I I V   I   I  I IIVI  I             I                      
   257  177 C T    >   -     0   0   16  614   35            T T T   T   T  T TTTT  S             S                      
   258  178 C Q  T 3  S+     0   0  133  614   68            P P S   P   P  E PEEE  V             L                      
   259  179 C N  T 3  S+     0   0   24  614   60            N N N   N   N  N NNNN  R             R                      
   260  180 C M  E <   - G   0 311B   2  614   13            M M M   M   K  M MMMM  M             M                      
   261  181 C F  E     - G   0 310B   8  613   35            F F F   F   F  F FFFF  F             F                      
   262  182 C j  E     +FG 243 309B   1  614    1            C C C   C   C  C CCCC  C             C                      
   263  183 C A  E     +FG 242 308B   0  614   26            A A A   A   A  A AAAA  A             A                      
   264  184 C G  S    S-     0   0    3  614   10            G G G   G   G  G GGGG  G             G                      
   265  185 C Y        -     0   0   56  591   57            Y Y Y   Y   Y  Y YYYF  Y             Y                      
   266  185AC D  S    S-     0   0   81  594   83            D D E   D   D  E DDDE  D             D                      
   267  185BC T  S    S+     0   0   76  614   61            S S S   S   S  T ATTT  Q             S                      
   268  186 C K  S    S-     0   0  107  563   32            R R I   K   K  E QEEE  E             M                      
   269  187 C Q  S    S+     0   0  102  569   37            P P S   L   L  Q PQEV  E             G                      
   270  188 C E        +     0   0   33  613   55            E E E   E   E  K EKKK  K             E                      
   271  189 C D  B     -A   94   0A   7  614    4            D D D   D   D  D DDDD  D             D                      
   272  190 C A        -     0   0    7  614   42            A A A   A   A  A AAAA  A             S                      
   273  191 C k    >   -     0   0    7  614    3            C C C   C   C  C CCCC  C             F                      
   274  192 C Q  T 3  S+     0   0   90  614   25            Q Q E   Q   Q  Q QQQQ  Q             Q                      
   275  193 C G  T 3  S+     0   0    6  614    8            G G G   G   G  G GGGG  G             G                      
   276  194 C D    X   +     0   0    0  614    0            D D D   D   D  D DDDD  D             D                      
   277  195 C S  T 3  S+     0   0   14  614    1            S S S   A   S  S SSSS  S             S                      
   278  196 C G  T 3  S+     0   0    0  614    0            G G G   G   G  G GGGG  G             G                      
   279  197 C G    <   -     0   0    0  614    1            G G G   G   G  G GGGG  G             G                      
   280  198 C P  E     - H   0 294B   1  614    2            P P P   P   P  P PPPP  P             P                      
   281  199 C H  E     -EH 219 293B   0  614   49            H H H   H   H  H HHHH  H             H                      
   282  200 C V  E     -EH 218 291B   3  614   26            V V V   V   V  V VVVV  V             V                      
   283  201 C T  E     - H   0 290B   0  614   66            T T T   T   T  T TTTT  T             T                      
   284  202 C R  E     + H   0 289B  99  614   70            K K K   Q   R  R RRRP  R             R                      
   285  203 C F  E >  S- H   0 288B  22  614   71            Y Y Y   F   F  Y FYYF  Y             Y                      
   286  204 C K  T 3  S-     0   0   85  222   71            K K K   K   K  K RKKK  Q             H                      
   287  205 C D  T 3  S+     0   0  108  223   55            D D D   D   D  D DDDD                G                      
   288  206 C T  E <   - H   0 285B   3  233   75            T T T   T   T  T TTTT                T                      
   289  207 C Y  E     - H   0 284B  21  242   51            Y Y Y   Y   Y  Y YYYY                F                      
   290  208 C F  E     -cH 200 283B   0  613   91            F F F   F   F  F FFFF                F                      
   291  209 C V  E     + H   0 282B   1  613   38            V V V   I   I  V VVVV                I                      
   292  210 C T  E     +     0   0B   1  613   84            T T T   T   T  T TTTT                T                      
   293  211 C G  E     -IH 312 281B   0  613    0            G G G   G   G  G GGGG                G                      
   294  212 C I  E     -IH 311 280B   0  613   19            I I I   I   I  I IIII                I                      
   295  213 C V  E     +I  310   0B   7  613   14            V V V   I   I  V VVVV                R                      
   296  214 C S  E     -     0   0B   1  612    0            S S S   S   S  S SSSS                S                      
   297  215 C W  E     -I  309   0B  45  613    7            W W W   W   W  W WWWW                W                      
   298  216 C G        -     0   0   26  613    0            G G G   G   G  G GGGG                G                      
   299  217 C E  S    S-     0   0   25  609   90            E E E   E   E  E EEEE                K                      
   300  218 C G  S    S-     0   0   19  612   13            G G G   G   G  G GGGG                G                      
   301  220 C k  S    S-     0   0    7  613    2            C C C   C   C  C CCCC                H                      
   302  221 C A  S    S+     0   0    4  612   16            A A A   A   A  A AAAA                T                      
   303  222 C R    >   -     0   0  105  611   73            Q Q R   R   R  R RRRQ                R                      
   304  223 C K  T 3  S+     0   0  152  611   64            N N K   K   K  K KKKK                K                      
   305  223AC G  T 3  S+     0   0   26  613   58            G G G   G   G  G GGGG                G                      
   306  224 C K    <   -     0   0   43  613   85            K K K   K   K  K KKKK                K                      
   307  225 C Y        -     0   0   33  613   50            F F Y   F   F  Y YYYY                F                      
   308  226 C G  E     -G  263   0B   4  611    2            G G G   G   G  G GGGG                G                      
   309  227 C I  E     -GI 262 297B   6  612   11            V V I   V   I  I VVVV                I                      
   310  228 C Y  E     -GI 261 295B   1  612    1            Y Y Y   Y   Y  Y YYYY                Y                      
   311  229 C T  E     -GI 260 294B   2  612   39            T T T   T   T  T TTTT                T                      
   312  230 C K  E >   - I   0 293B  21  612   42            K K K   K   K  K KKKK                Q                      
   313  231 C V  G >  S+     0   0    1  611    8            A A V   V   V  L VLLV                V                      
   314  232 C T  G 3  S+     0   0    2  609   71            A A T   S   T  S TSSS                S                      
   315  233 C A  G <  S+     0   0   29  609   79            T T A   N   N  R NRRK                K                      
   316  234 C F  S <> S+     0   0    7  605   35            F F Y   F   F  F FFFL                F                      
   317  235 C L  H  > S+     0   0   23  603   80            L L L   L   L  L LLLY                N                      
   318  236 C K  H  > S+     0   0  116  602   68            S S G   N   K  R KRRK                R                      
   319  237 C W  H  > S+     0   0   26  602    1            W W W   W   W  W WWWW                W                      
   320  238 C I  H  X S+     0   0    1  599   12            I I I   I   I  V IVVL                I                      
   321  239 C D  H  < S+     0   0   66  570   71            K K K   E   E  R ER R                K                      
   322  240 C R  H >< S+     0   0  136  556   71            R R R   R   K  T ST G                E                      
   323  241 C S  H >< S+     0   0    6  523   72            M M S   S   S  V VV V                G                      
   324  242 C M  T 3< S+     0   0   25  479   41            M M M   M   M  M TM L                I                      
   325  243 C K  T <  S+     0   0  153  444   70            R R R   K   K  R S  K                K                      
   326  244 C T    <         0   0   51  390   65            Q Q T          Q E                                          
   327  245 C R              0   0  197  273   47            K K K          K Q                                          
## ALIGNMENTS  141 -  210
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1   49 L Q              0   0  101  671   35  QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQQQQQQQ QQQQQ QQQ
     2   50 L a    >   +     0   0   22  858    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
     3   51 L E  T 3  S+     0   0  187  858   80  SVEKEESSEESSSNEEEDDDDQESEQESEDAELEAEEE ELDSEEMSESDEDLLMNENSEIDDSEALDDE
     4   52 L T  T 3  S-     0   0  105  864   61  SSSPSSSSSSSSSSSSSSSSSSSSSSSSSPSSSSSSSS SSPSSPSSPSSSPSSSPSPSSSSSSSSSSSP
     5   53 L S    <   +     0   0   89  868   72  NSNSNNNNNNNNNNNNNNNNNNNNNNKNNNSNNDNNNN NNNNNNNNNNSNNNNRNNNNNQSNNDNKSSQ
     6   54 L P        +     0   0   10  878   31  PPPPPPPPPPPPPPPPPPPPPLPPPLPPPPPPPPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP
     7   55 L b        -     0   0   18  893   21  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
     8   56 L Q  S    S+     0   0   92  892   83  HQLQLLHHLLHHHHLLLLLLLLLHLLQHLKQLLLQLLL RLKHLLLHLHQLDLKLKLKHLLQLHLQVQQA
     9   57 L N  S    S-     0   0   63  893   51  YNNNNHYYNNYYYYNNNNNNNNNYNNNYNNNNNNNNNN NNNYNNNYNYNNHNNNNNNYNNNNYNNNNNN
    10   58 L Q  S    S-     0   0  152  893   57  GGGQGGGRGGRRRGGGGQQQQNGRGNGRGGGGGGGDGD RGGGGGGGGGGGGQGQGGGRGKGGRGGNGGD
    11   59 L G        -     0   0   16  893   40  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGGGGGGG GGAGGGGGGGGGSGGGAGAGGGGGGGGGGGG
    12   60 L K  E     -S   23   0G 117  852   79  QTSTMVTIMITTISLSSSSSSSSTMSVILVLIAISVIV RVVTILVTLTSILSRSRVRTVVSQTISRSST
    13   61 L a  E     -S   22   0G  45  882   10  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    14   62 L K  E     -S   21   0G 155  890   81  KEKEKKKKKKKKKKKKKEEEEEKKKEEKKEKKKKEKKK QKEKKKKKKKDKKKEKAKAKKKDKKKEKDDL
    15   63 L X  E     +S   20   0G 120  768   39  DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDDGDDDDDDDDDDDDDDDDD
    16   64 L G        -     0   0   44  862   73  GGDQDDGGDDGGGGDDDLLLLGDGDGEGDADDDDQDDD GDAGDDGGDGQSGLDIDDDGDGQDGDQGQQL
    17   65 L L  S    S-     0   0  152  871   64  IMIMIIIIIIIIIIIIILLLLIIIIILIIVIIVILIII IVVIIITIIIFIILVLIIVIIIFIIILIFFI
    18   66 L G  S    S+     0   0   67  883   63  GSNGNNGGNNGGGNNNNGGGGNNGNNSGNSNSSNQNSN GSSGNNNGNGQDGGSGGNGGNGQNGNQGQQG
    19   67 L E        -     0   0  119  837   61  SASTSSSSSSSSSSSASSSSSSFSSSSSSSSSASSSSS LDSNSSASSSDADSNSSSSSSRDASSSTDDG
    20   68 L Y  E     -S   15   0G  37  883   11  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYF
    21   69 L T  E     -S   14   0G  71  886   82  TIESEETTEETTTTEEETTTTTETETKTETVEVEIEEE TVTTEEETETVESTITVEVTETVETEISVVQ
    22   70 L b  E     -S   13   0G  20  889    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    23   71 L T  E     -S   12   0G  85  890   86  SWWNWWTTWWTTTTWWWTTTTWWTWWWTWWWWWWFWWW NWWTWWWTWTRWTSWTWWWTWFRWTWFYRRF
    24   72 L c        -     0   0   44  890    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    25   73 L L    >   -     0   0   62  890   88  LPPLQQLLQQLLLLQQPLLLLTPLQTKLQPTQQQLRQR LQPLQQRLQLPQLRPALQLLQPPLLQPLPPP
    26   74 L E  T 3  S+     0   0  177  890   75  DIFPAPSSATFSSAIYFPPPPSLFASKSIASVQADAVA KQAAAVGAVPPLKPASAVAPVEPPPAEEPAE
    27   75 L G  T 3  S+     0   0   29  893   20  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGNEGGGGGGGGNGLEGNGDGEEE
    28   76 L F  E <   +T   36   0H  40  893    9  YFFFFFYYFFYYYYFFFFFFFFFYFFFYFYFFYFFFFF YYYYFFYYFYYFFFYFYFYYFFYFYFFFYYR
    29   77 L E  E     +T   35   0H  74  893   73  QIEVEEEEEEEEEDEEEAAAAKEEEKIEEEDESEEEEE HSEQEEEEEEEEEAETEEEDEQEEEEEKEED
    30   78 L G  S >  S-     0   0   32  889    5  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    31   79 L K  T 3  S+     0   0  156  891   73  KKKKTKKKTKKKKQKKKKKKKKKKTKKKKKKRKKRKRK KKKKRKKKKKKRKTRRRKRKKYKKKKRHKKS
    32   80 L N  T 3  S-     0   0   33  892   62  NNNNNNNNNNNNNNNNNDDDDNNNNNNNNNNNNNNNNN NNNNNNNNNNSNNHNNNNNNNNSNNNNNSSR
    33   81 L c  S <  S+     0   0    1  892    3  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    34   82 L E        +     0   0   87  891   44  EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE EEEDEEEQEEEEQEEEEEEEEEEEEEEEEEQ
    35   83 L L  E    S-T   29   0H  96  889   88  FLLILLYRLLRRRHLLLIIIIILRLIIRLIILLLTLLL ILIYLLIYLHTLLILILVLKVITLKLTITKY
    36   84 L F  E     -T   28   0H 139  889   83  VEDVDYVVDDVVVIDDDVAVVDDVDDEVDdEDADNDDD EEDLDDDVDLADVIDVDDDVDAAEVDNVAAe
    37   85 L T        -     0   0   44  677   75  IMVTAALLAVLLLTASVI.IIVALAVTLAtTALVtVAV TL.IAAALALvAIIAISVSLVIvELVkIvvv
    38   86 L R        +     0   0   57  408   92  PA.A..YY..YYYH...A.AAS.Y.SAY..V.P.q... PP.Y...Y.Fn.LA.A...Y.Pn.F.lPnkA
    39   87 L K        +     0   0   96  535   81  KR.K..KK..KKKK...KKKKK.K.KKK..R.V.L... KVFK...Q.KL.QK.K...E.QL.E.LQLLT
    40   88 L L        -     0   0   91  608   90  YQTKTTSSTTSSSSTTTRRRRMTSTMQST.RTITITTT LITSTTSSTSKSFRTRTTTSTLKSSTILKKN
    41   89 L d  S  > S+     0   0   15  617   29  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    42   90 L S  T  4 S+     0   0   98  624   84  KDNDSSRRSNRRRKSSNDDDDSNRSSSRSADNSNMNNN GSARSNSRNRINTDSDANARNEIKRNEEIMS
    43   91 L L  T >4 S-     0   0  120  627   87  IVIVIIVVIIVVVVIIIVVVVYIVIYIVIILIIINIII LIIVIIIVIFYINVTVTITVIVYIVINTYYT
    44   92 L D  G >4 S-     0   0  107  638   73  NNKDKKDDKKDDDDKKKNNNNEKDKENDKKNKMKNKKK NMKDKKKDKFDKNNKNKKKDKKDNFKDKDDE
    45   93 L N  G >< S-     0   0    8  700   56  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNY
    46   94 L G  G <  S-     0   0    0  882   52  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    47   95 L D  G <  S+     0   0   44  887   62  DGRGRRDNRRNNNEMRRDDDDGRNRGGNMGGRGRDRRR GGGNRRGNRNGRGDGDGRGNRGGRNRGGGGY
    48   96 L e    <   -     0   0    0  892    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    49   97 L D  S    S-     0   0   59  892   74  EMKEKKWWKKWWWWKEKAAAAGKWKGAWKKMKDKEKKK VDKWKKKWKWEKSMKMKNKWNEEMWKDEEEE
    50   98 L Q  S    S+     0   0    2  892   63  QQQHQQHHQQHHHQQQQHHHHQQHQQHHQHHQHQQQQQ HHHHQQQHQHQQHHQHHQHHQHQHHQQHQQH
    51   99 L F  E     -U   62   0I   4  892   80  FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFLFYFFF FMFFFFFFFFYFFFFFFFFFFFYFFFYFYYF
    52  100 L d  E     +U   61   0I  10  893    1  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    53  101 L H  E     -U   60   0I  68  893   87  SLKVKKKKKKKKKKKRKEEEENKKKNKKKREKRKSKKK KRRKKKKKKKAKSEKDRKNKKKATKKSHAAH
    54  102 L E  E     -U   59   0I  92  893   68  IVNLRNPHRLPPSNKKNPPPPNTPRNMHKHPNKLDLNL VDHPNTMPTPDTLPNSNLSSLVDKSLNVDDE
    55  103 L E  S    S-     0   0  100  893   82  kHtLdsVVddVVVVgnsLLLLdgVddeVgDhsDgHgsg HDDVsgNVgVQdDLNLDgdVgDEsVghREEi
    56  104 L Q  S    S-     0   0  175  693   73  vkdeddQQddQQQEdndggggvdQdv.Qdpqdpdaddd RppQddkQdQqkHgdgpdpQdqqdQdeNqqi
    57  105 L N  S    S+     0   0  154  838   66  kyNhNNNNNNNNNNNNNffffQSNNQrNNqENkNaNNN .kqNNSnNSNeNFfgfhNHNNgeNNNAReaN
    58  106 L S  S    S-     0   0   58  853   65  DGKKKKGDKKDDDTKKKGGGGGKDKGQDKKKKKKRKKK .KKEKKKEKDKKRGIGKKKEKTKHEKKAKKR
    59  107 L V  E     -U   54   0I   7  890   79  VVVTVVIIVVIIIVVIVAAAASVIVSRIVVVVVVRVVV EVVVIVAIVTRVVAAAVVVVVARLIVRVRRR
    60  108 L V  E     -U   53   0I  45  891   88  MVVQVIQQVVQQQELIIKKKKIVQVIVQLVAIIVSVIV SIVQILVQLQVIVKVKVVVQVVVMQVSQVVK
    61  109 L e  E     +U   52   0I   5  893    1  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC VCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    62  110 L S  E     -U   51   0I  24  893   75  SDSQSSSSSSSSSSSSSSSSSSSSSSHSSSSSSSWSSS DSSSSSHSSSFSSSSSSSSSSSFSSSWSFFS
    63  111 L f        -     0   0   23  893    0  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    64  112 L A    >   -     0   0    8  893   75  AATATTAATTAAATTTTAAAAVTATVAATAATATHTTT SAAATTTATAATAVAAATAATAAAATHAAAA
    65  113 L R  T 3  S+     0   0  149  893   80  KDEYDAEEDTEEEDTEETTTTHEEDHAETAKESAETET CSAEETTETEEEETPTPTPETKESEAEDEDK
    66  114 L G  T 3  S+     0   0   24  893    8  GGGGGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG AGGTGGGSGSGGGGGGGGGSGGGGSGGGGDG
    67  115 L Y  E <   -V   78   0J  20  893   11  YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY KYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY
    68  116 L T  E     -V   77   0J  72  891   85  VRRKRRLLRQLLLIRRRRRRRKRLRKELRKKQKQTQQQ DKKLQRRLRRTQERKRKKKRKNARRQTYAAN
    69  117 L L  E     -V   76   0J  67  888   64  LLLLLLLLLLLLLLLLLVVVVLLLLLVLLLLLLLLLLL YLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
    70  118 L A    >   -     0   0   23  889   78  AAASAAGGAAGGGDAAATTTTAAGAAGGAQAAAAQAAA EAQGAAAGAGAAGAKMNANGAAAGGAQAAAS
    71  119 L D  T 3  S+     0   0  175  889   77  ELEEEEEEEEEEENEEEDDDDEEEEETEEEEEEEAEEE SEEDEPEDPDSEEDAQAEGDEASKDEAPSSD
    72  120 L N  T 3  S-     0   0   92  694   44  DDNDDDDDDDDDDDDNNDDDDDNDDDDDDDNDNDNDDD RNDDDDDDDDDDDDDDDDDDDDDDDDDNDDN
    73  121 L G  S <  S+     0   0   16  713   66  GSQGQQGGQQGGGGQQQGGGGAQGQARGQGRQGQGQQQ GGGGQQQGQGGQEGQGGRGGRRGKGQGNGGG
    74  122 L K  S    S+     0   0   71  687   76  KRRLKKHHKKHHHQKKKLLLLKKHKKKHKKRKKRVRKR KKKHKKKYKHVKSLRVKRKRRKVKHRVKVVF
    75  123 L A        -     0   0   22  685   66  HSSTSSSSSSSSSSSSSDDDDSSSSSSSSSDSTSSSSS YTSSSSSSSSSSTSGSSSSSSASSSSSNSSA
    76  124 L f  E     -V   69   0J  12  847    9  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    77  125 L I  E     -V   68   0J  78  846   80  VEEEEEVVEEVVVVEEEQQQQEEVEEEVEEVEEETEEE IEEVEEEVKVIETQEEDEDVETIEVEAHIIN
    78  126 L P  E     -V   67   0J  62  850   71  SPPPPPAAPPAAAAPPPPPPPPPAPPPAPPAPAPPPPP PAPAPPPAPAPPPPPAPPPAPSPPApPsPPP
    79  127 L T  S    S+     0   0  103  652   80  SMAIAAGGAAGGGTAAA....EAGAETGAT.TAATATA QATGAAEGAEQAKETEAAAEA.QAEvT.QQT
    80  128 L G  S    S-     0   0   32  788   69  VGVVVVGGVVGGGAVVVeeeeVVGVVGGVVeVVVVVVV VVVGVVVGVGVVVTVVVVVGVdVVGfV.VaG
    81  129 L P  S    S+     0   0  116  601   75  QEPKPPDNPPNNNNPPPeeeePPNPPPNPPaPPPEPPP PPPDPPPDPDKPPEPEPPPDPpKPDpEtKkN
    82  130 L Y  S    S+     0   0   59  794   86  YYFFFFFFFFFFFYFFFFFFFYFFFYFFFYFFYFYFFF YYYFFFYFFFYFFFFFFFFFFFYFFFYFYYY
    83  131 L P    >   -     0   0   17  799   62  PPPPPPSSPPSSSPPPPPPPPPPSPPSSPPPPPPPPPP PPPSPPPSPSPPPPPPPPPSPKPPSPPKPPS
    84  132 L g  T 3  S+     0   0   16  800    5  CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    85  133 L G  T 3  S+     0   0    0  712   37  GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG
    86  134 L K    <   -     0   0   69  588   68  KSRKRKRRRRRRRKRRRKKKKKRRRKIRRRKRERKRRR RRRRRRRRRRKRRRKRRRRRRHTRRRKATKR
    87  135 L Q        -     0   0   37  477   65  VLVTVVNNVVNNNIVVVTTTTVINVVVNVILAVVIVAV IVINVVVNVNIVITITIVINVLIANVIIIIH
    88  136 L T        +     0   0    4  428   78  F SSSSIISSIIIKSSSAAAA SIS SISTGSSSPSSS  STISSSISIPSQVTATSTIS PAISPVP K
    89  137 L L        +     0   0  105  372   61  V V VVKKVVKKKRVVVLLLL MKV LKV LI VVVIV    KVVVKVKVIVL L V KV VVKVVTV L
    90  138 L E              0   0  104  274   69  K S SSTTSPTTTTSSS     STS STS SS P PSP    AASPASA PQT T P AP  AAP D   
    91  139 L R              0   0  231  199   47  R Q HHRRHHRRRK HQ     NRH  R     H H H    R H RHR   Q   H RH   RH K   
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2                                        I                               
    94   17 C V  B     -A  271   0A   7  590    9                                        V                               
    95   18 C G  S    S+     0   0   25  591    6                                        G                               
    96   19 C G  S    S-     0   0   26  592    0                                        G                               
    97   20 C Q  E     -B  237   0B  98  593   95                                        T                               
    98   21 C E  E     -B  236   0B  80  594   67                                        E                               
    99   22 C h        -     0   0    8  594   58                                        C                               
   100   23 C K    >   -     0   0  123  593   78                                        P                               
   101   24 C D  T 3  S+     0   0   60  594   85                                        K                               
   102   25 C G  T 3  S+     0   0    0  595   74                                        G                               
   103   26 C E  S <  S+     0   0   36  595   66                                        E                               
   104   27 C h    >   +     0   0    4  595   92                                        C                               
   105   28 C P  T 3   +     0   0    0  599    9                                        P                               
   106   29 C W  T 3  S+     0   0    5  600   26                                        W                               
   107   30 C Q  E <   -J  122   0C   7  601   26                                        Q                               
   108   31 C A  E     -JK 121 146C   1  593   49                                        V                               
   109   32 C L  E     -JK 120 145C   3  598   68                                        L                               
   110   33 C L  E     -JK 119 144C   0  601    9                                        L                               
   111   34 C I  E     -JK 117 143C   0  601   81                                        L                               
   112   35 C N  E >   - K   0 142C  30  601   88                                        H                               
   113   36 C E  T 3  S+     0   0   63  117   78                                        K                               
   114   37 C E  T 3  S-     0   0  136  242   77                                        G                               
   115   38 C N  S <  S+     0   0   84  565   53                                        K                               
   116   39 C E        -     0   0  100  589   94                                        .                               
   117   40 C G  E     +J  111   0C  14  600   57                                        A                               
   118   41 C F  E     +     0   0C  28  611   33                                        F                               
   119   42 C i  E     -J  110   0C   0  612    1                                        C                               
   120   43 C G  E     -J  109   0C   1  612    1                                        G                               
   121   44 C G  E     -J  108   0C   0  612    9                                        G                               
   122   45 C T  E     -JL 107 130C   0  612   45                                        V                               
   123   46 C I  E     + L   0 129C   0  612   23                                        I                               
   124   47 C L        -     0   0    6  612   27                                        Y                               
   125   48 C S  S    S-     0   0   22  612   56                                        K                               
   126   49 C E  S    S+     0   0   99  612   63                                        P                               
   127   50 C F  S    S+     0   0   42  612   83                                        T                               
   128   51 C Y  E     - M   0 185C   7  612   34                                        W                               
   129   52 C I  E     -LM 123 184C   0  612   14                                        I                               
   130   53 C L  E     +LM 122 183C   0  612   27                                        L                               
   131   54 C T  E     - M   0 182C   0  612   43                                        T                               
   132   55 C A    >>  -     0   0    0  613    2                                        A                               
   133   56 C A  G >4 S+     0   0    0  613    9                                        S                               
   134   57 C H  G >4 S+     0   0    7  613    0                                        H                               
   135   58 C i  G X4 S+     0   0    0  613    1                                        C                               
   136   59 C L  G << S+     0   0   31  613   66                                        M                               
   137   60 C Y  G <  S+     0   0  109  613   87                                        E                               
   138   61 C Q  S <  S+     0   0   95  613   78                                        d                               
   139   61AC A        -     0   0   16  373   75                                        v                               
   140   62 C K  S    S-     0   0  172  387   77                                        R                               
   141   63 C R  S    S-     0   0  162  602   78                                        F                               
   142   64 C F  E     -K  112   0C  36  609   54                                        L                               
   143   65 C K  E     -K  111   0C  67  609   79                                        E                               
   144   66 C V  E     -KN 110 161C   0  609   16                                        V                               
   145   67 C R  E     -KN 109 160C  40  609   55                                        I                               
   146   68 C V  E     +KN 108 159C   1  610   43                                        A                               
   147   69 C G  S    S+     0   0    9  610   15                                        G                               
   148   70 C D        +     0   0   11  611   58                                        E                               
   149   71 C R  S    S+     0   0   24  611   73                                        H                               
   150   72 C N  B >   -P  234   0D  18  611   65                                        N                               
   151   73 C T  T 3  S+     0   0   56  611   80                                        T                               
   152   74 C E  T 3  S-     0   0  119  611   84                                        E                               
   153   75 C Q  S <  S-     0   0  130  610   85                                        V                               
   154   76 C E        +     0   0  165  610   85                                        L                               
   155   77 C E        -     0   0   93  469   27                                        E                               
   156   78 C G  S    S+     0   0   46  578   34                                        G                               
   157   79 C G  S    S+     0   0   47  585   75                                        T                               
   158   80 C E        -     0   0   37  472   30                                        E                               
   159   81 C A  E     -N  146   0C  27  487   57                                        Q                               
   160   82 C V  E     -N  145   0C  71  590   83                                        R                               
   161   83 C H  E     -N  144   0C  14  599   76                                        L                               
   162   84 C E        -     0   0   90  602   78                                        Q                               
   163   85 C V  E     -O  186   0C  27  607   64                                        V                               
   164   86 C E  E    S+     0   0C  70  608   73                                        S                               
   165   87 C V  E     -O  185   0C  13  609   72                                        Q                               
   166   88 C V  E     -O  184   0C  72  610   46                                        V                               
   167   89 C I  E     +O  183   0C  27  610   43                                        I                               
   168   90 C K  E     -O  182   0C  68  610   82                                        T                               
   169   91 C H    >   -     0   0   19  611   13                                        H                               
   170   92 C N  T 3  S+     0   0  156  611   61                                        Q                               
   171   93 C R  T 3  S+     0   0  150  608   73                                        N                               
   172   94 C F    <   -     0   0   24  611    5                                        Y                               
   173   95 C T     >  -     0   0   56  611   68                                        S                               
   174   96 C K  T  4 S+     0   0  145  561   78                                        K                               
   175   97 C E  T  4 S+     0   0  174  569   91                                        T                               
   176   98 C T  T  4 S-     0   0   44  598   57                                        T                               
   177   99 C Y    ><  +     0   0   60  604   65                                        V                               
   178  100 C D  T 3   +     0   0   25  609   37                                        D                               
   179  101 C F  T 3  S+     0   0   21  595   66                                        H                               
   180  102 C D    <   +     0   0    1  609    0                                        D                               
   181  103 C I        +     0   0    0  611   13                                        V                               
   182  104 C A  E     -MO 131 168C   0  611   60                                        A                               
   183  105 C V  E     -MO 130 167C   0  612   16                                        L                               
   184  106 C L  E     -MO 129 166C   0  613   30                                        L                               
   185  107 C R  E     -MO 128 165C  40  613   43                                        R                               
   186  108 C L  E     - O   0 163C   0  613   16                                        L                               
   187  109 C K  S    S+     0   0  101  613   69                                        A                               
   188  110 C T  S    S-     0   0   82  614   74                                        G                               
   189  111 C P        -     0   0   48  614   39                                        P                               
   190  112 C I        -     0   0    4  562   63                                        V                               
   191  113 C T        -     0   0   95  566   73                                        R                               
   192  114 C F        +     0   0   56  612   34                                        Y                               
   193  115 C R  B >   -Q  196   0E  52  613   63                                        S                               
   194  116 C M  T 3  S+     0   0   29  594   77                                        T                               
   195  117 C N  T 3  S+     0   0   13  602   90                                        Y                               
   196  118 C V  B <   +Q  193   0E   0  604   27                                        A                               
   197  119 C A        -     0   0    1  606   80                                        V                               
   198  120 C P        -     0   0    8  608   54                                        P                               
   199  121 C A        -     0   0    2  609   39                                        A                               
   200  122 C g  B     -c  290   0B   1  610   66                                        C                               
   201  123 C L        -     0   0   27  612    5                                        L                               
   202  124 C P        -     0   0    7  613   30                                        P                               
   203  124AC E     >  -     0   0   92  612   75                                        T                               
   204  125 C R  H  > S+     0   0  109  612   78                                        R                               
   205  126 C D  H  > S+     0   0  124  612   85                                        R                               
   206  127 C W  H  >>S+     0   0    4  612   88                                        L                               
   207  128 C A  I  X>S+     0   0    0  612   75                                        A                               
   208  129 C E  I  <5S+     0   0   75  613   82                                        E                               
   209  130 C S  I  <5S+     0   0   70  614   66                                        R                               
   210  131 C T  I  <5S+     0   0   18  108   73                                        E                               
   211  131AC L  I ><  S-     0   0  119  503   80                                        S                               
   227  146 C E  T 3  S+     0   0   47  527   75                                        E                               
   228  147 C K  T 3  S+     0   0  169  548   68                                        K                               
   229  149 C G  S <  S-     0   0   29  559   66                                        G                               
   230  150 C R        -     0   0  213  584   86                                        P                               
   231  151 C Q  B     -R  224   0F  79  599   93                                        T                               
   232  152 C S        -     0   0   14  607   51                                        S                               
   233  153 C T  S    S+     0   0   48  608   73                                        D                               
   234  154 C R  B    S-P  150   0D 102  608   85                                        L                               
   235  155 C L        -     0   0    3  610    3                                        L                               
   236  156 C K  E     -BD  98 221B  31  610   51                                        R                               
   237  157 C M  E     -BD  97 220B  18  611   94                                        R                               
   238  158 C L  E     - D   0 219B   4  612   44                                        L                               
   239  159 C E  E     - D   0 218B 107  612   72                                        R                               
   240  160 C V  E     - D   0 217B   0  612   46                                        V                               
   241  161 C P  E     - D   0 216B  34  612   28                                        P                               
   242  162 C Y  E     -F  263   0B  36  613   46                                        R                               
   243  163 C V  E     -F  262   0B  24  614   37                                        I                               
   244  164 C D     >  -     0   0   88  613   57                                        R                               
   245  165 C R  H  > S+     0   0   51  613   78                                        T                               
   246  166 C N  H  > S+     0   0  105  614   74                                        Q                               
   247  167 C S  H  > S+     0   0   48  614   78                                        R                               
   248  168 C j  H  X S+     0   0    1  614    2                                        C                               
   249  169 C K  H >< S+     0   0   88  614   73                                        Q                               
   250  170 C L  H 3< S+     0   0  150  574   89                                        E                               
   251  171 C S  H 3< S+     0   0   23  604   76                                        E                               
   252  172 C S    <<  -     0   0   20  607   83                                        S                               
   253  173 C S  S    S+     0   0   79  607   83                                        G                               
   254  174 C F  S    S-     0   0  124  607   79                                        V                               
   255  175 C I        -     0   0  100  608   87                                        R                               
   256  176 C I        -     0   0   13  609   18                                        L                               
   257  177 C T    >   -     0   0   16  614   35                                        T                               
   258  178 C Q  T 3  S+     0   0  133  614   68                                        Q                               
   259  179 C N  T 3  S+     0   0   24  614   60                                        N                               
   260  180 C M  E <   - G   0 311B   2  614   13                                        M                               
   261  181 C F  E     - G   0 310B   8  613   35                                        F                               
   262  182 C j  E     +FG 243 309B   1  614    1                                        C                               
   263  183 C A  E     +FG 242 308B   0  614   26                                        A                               
   264  184 C G  S    S-     0   0    3  614   10                                        G                               
   265  185 C Y        -     0   0   56  591   57                                        Y                               
   266  185AC D  S    S-     0   0   81  594   83                                        I                               
   267  185BC T  S    S+     0   0   76  614   61                                        E                               
   268  186 C K  S    S-     0   0  107  563   32                                        G                               
   269  187 C Q  S    S+     0   0  102  569   37                                        R                               
   270  188 C E        +     0   0   33  613   55                                        Q                               
   271  189 C D  B     -A   94   0A   7  614    4                                        D                               
   272  190 C A        -     0   0    7  614   42                                        S                               
   273  191 C k    >   -     0   0    7  614    3                                        C                               
   274  192 C Q  T 3  S+     0   0   90  614   25                                        K                               
   275  193 C G  T 3  S+     0   0    6  614    8                                        G                               
   276  194 C D    X   +     0   0    0  614    0                                        D                               
   277  195 C S  T 3  S+     0   0   14  614    1                                        S                               
   278  196 C G  T 3  S+     0   0    0  614    0                                        G                               
   279  197 C G    <   -     0   0    0  614    1                                        G                               
   280  198 C P  E     - H   0 294B   1  614    2                                        P                               
   281  199 C H  E     -EH 219 293B   0  614   49                                        L                               
   282  200 C V  E     -EH 218 291B   3  614   26                                        V                               
   283  201 C T  E     - H   0 290B   0  614   66                                        T                               
   284  202 C R  E     + H   0 289B  99  614   70                                        E                               
   285  203 C F  E >  S- H   0 288B  22  614   71                                        Y                               
   286  204 C K  T 3  S-     0   0   85  222   71                                        R                               
   287  205 C D  T 3  S+     0   0  108  223   55                                        G                               
   288  206 C T  E <   - H   0 285B   3  233   75                                        T                               
   289  207 C Y  E     - H   0 284B  21  242   51                                        W                               
   290  208 C F  E     -cH 200 283B   0  613   91                                        F                               
   291  209 C V  E     + H   0 282B   1  613   38                                        L                               
   292  210 C T  E     +     0   0B   1  613   84                                        L                               
   293  211 C G  E     -IH 312 281B   0  613    0                                        G                               
   294  212 C I  E     -IH 311 280B   0  613   19                                        I                               
   295  213 C V  E     +I  310   0B   7  613   14                                        V                               
   296  214 C S  E     -     0   0B   1  612    0                                        S                               
   297  215 C W  E     -I  309   0B  45  613    7                                        W                               
   298  216 C G        -     0   0   26  613    0                                        G                               
   299  217 C E  S    S-     0   0   25  609   90                                        R                               
   300  218 C G  S    S-     0   0   19  612   13                                        G                               
   301  220 C k  S    S-     0   0    7  613    2                                        C                               
   302  221 C A  S    S+     0   0    4  612   16                                        A                               
   303  222 C R    >   -     0   0  105  611   73                                        R                               
   304  223 C K  T 3  S+     0   0  152  611   64                                        P                               
   305  223AC G  T 3  S+     0   0   26  613   58                                        G                               
   306  224 C K    <   -     0   0   43  613   85                                        Q                               
   307  225 C Y        -     0   0   33  613   50                                        Y                               
   308  226 C G  E     -G  263   0B   4  611    2                                        G                               
   309  227 C I  E     -GI 262 297B   6  612   11                                        I                               
   310  228 C Y  E     -GI 261 295B   1  612    1                                        Y                               
   311  229 C T  E     -GI 260 294B   2  612   39                                        T                               
   312  230 C K  E >   - I   0 293B  21  612   42                                        R                               
   313  231 C V  G >  S+     0   0    1  611    8                                        V                               
   314  232 C T  G 3  S+     0   0    2  609   71                                        S                               
   315  233 C A  G <  S+     0   0   29  609   79                                        N                               
   316  234 C F  S <> S+     0   0    7  605   35                                        Y                               
   317  235 C L  H  > S+     0   0   23  603   80                                        L                               
   318  236 C K  H  > S+     0   0  116  602   68                                        D                               
   319  237 C W  H  > S+     0   0   26  602    1                                        W                               
   320  238 C I  H  X S+     0   0    1  599   12                                        I                               
   321  239 C D  H  < S+     0   0   66  570   71                                        H                               
   322  240 C R  H >< S+     0   0  136  556   71                                        N                               
   323  241 C S  H >< S+     0   0    6  523   72                                                                        
   324  242 C M  T 3< S+     0   0   25  479   41                                                                        
   325  243 C K  T <  S+     0   0  153  444   70                                                                        
   326  244 C T    <         0   0   51  390   65                                                                        
   327  245 C R              0   0  197  273   47                                                                        
## ALIGNMENTS  211 -  280
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1   49 L Q              0   0  101  671   35  Q  QQQQQQQ Q QQQQQQ  QQQQQQQQQQQQQQ QQ  KQ  QQQ QQQ QQ Q QQQQQQQQQ Q  
     2   50 L a    >   +     0   0   22  858    0  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCC CCCCCCCCCCCCCCCCCCCC  
     3   51 L E  T 3  S+     0   0  187  858   80  ALLNALAAAA N SSSSNALLANAKEEEEASLAASLDALLDA  AEQ VVVLDAKALATKAAAAAAVE  
     4   52 L T  T 3  S-     0   0  105  864   61  STTSSSSSSS S SSSSSSSSSPSPPPPPSSSSSSTPSTTSS  SSP PPPTPSSSTSSPSSSSSSSS  
     5   53 L S    <   +     0   0   89  868   72  SNNNSNSSSS N NNNNNSSSSNSPQQQQNNNSSNNNNNNNN  NSP PPPNNGNNNNNSNSSSSNQS  
     6   54 L P        +     0   0   10  878   31  PPPPPPPPPP P PPPPPPPPPPPPPPPPPPPPPPPQPPPPP  PPPPPPPPQPPPPPPPPPPPPPPP  
     7   55 L b        -     0   0   18  893   21  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC  
     8   56 L Q  S    S+     0   0   92  892   83  QKKKQMQQQQ K HHHHKQQQQKQQAAAAQQMQQHKLQRRQQ  QLQQQQQRLQQQRQQQLQQQQQLL  
     9   57 L N  S    S-     0   0   63  893   51  NNNNNNNNNN N YYYYNNNNNNNNNNNNNNNNNYNNNNNNN  NNNNNNNNNNNNNNNNNNNNNNNN  
    10   58 L Q  S    S-     0   0  152  893   57  GNNGGGGGGG G RRHRGGGGGGGGDDDDGGGGGHNNGNNNG  GEGGEEENNGGGNGGQGGGGGGNE  
    11   59 L G        -     0   0   16  893   40  GGGAGGGGGG A GGGGAGGGGAGGGGGGGGGGGGGGGGGGG  GGGGGGGGGGAGGGGGGGGGGGGG  
    12   60 L K  E     -S   23   0G 117  852   79  STTVSTSSSS V TTTTMSSSSVSVTTTTSSTSSTTISTTKS  SSELVVVTISRSTSSTSSSSSSSS  
    13   61 L a  E     -S   22   0G  45  882   10  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC  
    14   62 L K  E     -S   21   0G 155  890   81  KIIKKFEKKK K KKKKKKssKKKELLLLEQFKKKIKVVVQE  EREVKKKVKEQKVKEEEEEEEKQR  
    15   63 L X  E     +S   20   0G 120  768   39  D..DDDDDDD D DDDDDDqqDDDDDDDDDDDDDD.DD...D  DDDDDDD.DDDD.DDDDDDDDDDD  
    16   64 L G        -     0   0   44  862   73  QYYGQQQQQQ G GGGGGQAAQEQGLLLLQQQQQGYGEYYDQ  QHGQGGGYGQGQYQQQQQQQQQNH  
    17   65 L L  S    S-     0   0  152  871   64  LLLVLHLLLL V IIIIVLSSLILVIIIILLHLLILVLLLII  IIILVVVLVLVLLLLMLFFFFLII  
    18   66 L G  S    S+     0   0   67  883   63  QggSQQRQQQ S GGGGSQSSQNQNGGGGQQQQQGgKQaasQ  QGNQNNNaKQNQaQQGQQQQQQRG  
    19   67 L E        -     0   0  119  837   61  SssSSSSSSS S SSSSSS..SSSGGGGGSSSSSSsMSssgS  SYTSSSSsMSNSsSSTASSSSSSY  
    20   68 L Y  E     -S   15   0G  37  883   11  YYYYYYYYYY Y YYYYYYYYYYYYFFFFYYYYYYYYYYYYY  YFYYYYYYYYYYYYYYYYYYYYYF  
    21   69 L T  E     -S   14   0G  71  886   82  IIIEIIIIII E TTTTEISSIVILQQQQIIIIITVTVYYII  ISTIVVVYTVLIYIVSIIIIIITS  
    22   70 L b  E     -S   13   0G  20  889    0  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC  
    23   71 L T  E     -S   12   0G  85  890   86  FQQMFTFFFF M TTTTMFFFFWFLFFFFFFTFFTQIFLLLF  FAYFWWWLIFWFLFFNFFFFFFTA  
    24   72 L c        -     0   0   44  890    0  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC  
    25   73 L L    >   -     0   0   62  890   88  LYSPLPPLLL P LLLLPLLLLPLQPPPPPRPLLLLPLSSPL  LANLKKKSPPVLALLLPLLLLLSA  
    26   74 L E  T 3  S+     0   0  177  890   75  PEEPPMDPPP P PPPPPPPPPAPPEEEEEAMPPPENAEEEA  ASPDPPPENEDPEPPPELLLLPSS  
    27   75 L G  T 3  S+     0   0   29  893   20  AGGGAGGAAA G NNNNGARRAGANEEEEDGGDDNGGDGGGD  DGNDDDDGGGGSGSEGGGGGGSGG  
    28   76 L F  E <   +T   36   0H  40  893    9  FFFYFYFFFF Y YYYYYFFFFYFFRRRRFFYFFYFFFYYYF  FFFFFFFYFFFFYFFFFFFFFFYF  
    29   77 L E  E     +T   35   0H  74  893   73  EEEGEEEEEE G EEEEGESSEGESDDDDEEEEEEEEEEEEE  ETNESSSEEEEEEEEVEEEEEEET  
    30   78 L G  S >  S-     0   0   32  889    5  GGGGGGGGGG G GGGGGGGGG.GGGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGG  
    31   79 L K  T 3  S+     0   0  156  891   73  RKKRRRRRRR R KKKKRRLLRKRKSSSSRRRRRKKNRKKIR  RQKRRRRKNRWRKRRKRRRRRRKQ  
    32   80 L N  T 3  S-     0   0   33  892   62  NYYNNHNNNN N NNNNNNNNNNNNRRRRNNHNNNYNNYYNN  NINNNNNYNNNNYNNNNNNNNNDI  
    33   81 L c  S <  S+     0   0    1  892    3  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC  
    34   82 L E        +     0   0   87  891   44  EQQEEEEEEE E EEEEEEEEEEEEQQQQEEEEEEQEEEEQE  EEEEEEEEEEEEEEEEEEEEEEAE  
    35   83 L L  E    S-T   29   0H  96  889   88  TEEITTTTTT I KKKKITLLTITIYYYYTTTMMKELKKKHK  KIITIIIKLTIKKKTITTTTTKFI  
    36   84 L F  E     -T   28   0H 139  889   83  HaaDHNDHYY D VVVVDYddYDYDEEEENNNYYVvTNGGEN  NVENEEEGTDANGNNVNNNNNNAG  
    37   85 L T        -     0   0   44  677   75  keeSklkkkk S LLLLSkttkFkVllllkklkkLeKkllSk  kVLkVVVlKqkklkkTkkkkkkKr  
    38   86 L R        +     0   0   57  408   92  qtt.qmqqqq . YFFY.qhhq.qNaaavlqmqqFt.qttSq  qAKqSSSt.qeqtqqAqqqqqqNa  
    39   87 L K        +     0   0   96  535   81  LLL.LLLLLL . QKKQ.LEEL.LKTTTTLLLLLKLILLLKL  LKKLKKKLILILLLLKLLLLLLEK  
    40   88 L L        -     0   0   91  608   90  IKKTIKIIII T SSSSTISSITIQNNNNIMKIISKGIKKCI  IRQIQQQKGIDIKIIKIIIIIICR  
    41   89 L d  S  > S+     0   0   15  617   29  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCHC  CCCCCCCCCCCCCCCCCCCCCCHC  
    42   90 L S  T  4 S+     0   0   98  624   84  VLLAVIAVVV A RRRRAVLLMAVLSSSSEVIVVRLVLQQPM  MDSLSSSQVTNVQVSDMIIIIVPD  
    43   91 L L  T >4 S-     0   0  120  627   87  NYYTNYNNNN T VAAVTNLLNINVTTTTNNYNNAYFNYYLY  YVLNVVVYFNFNYNNVNNNNNNLV  
    44   92 L D  G >4 S-     0   0  107  638   73  ELLKEDDEEE K DFFDKEEEEKENEEEEDDDEEFLRAVVTE  ENNEKKKVRDAEVEEDDEEEEERN  
    45   93 L N  G >< S-     0   0    8  700   56  NNNNNNNNNN N NNNNNNNNNNNNYYYYNNNNNNNNNNNRN  NNNNNNNNNNNNNNNNNNNNNNTN  
    46   94 L G  G <  S-     0   0    0  882   52  GGGGGGGGGG G GGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGDG  
    47   95 L D  G <  S+     0   0   44  887   62  GGGGGQGGGG G NNNNGGGGGGGGYYYYGGQGGNGGGGGGG  GDGGGGGGGGLGGGGGGGGGGGGD  
    48   96 L e    <   -     0   0    0  892    0  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC  
    49   97 L D  S    S-     0   0   59  892   74  EEEEEEEEEE E WWWWEEDDEKESEEEEDQEEEWENEEEQE  EMSESSSENEEEEEEEEEEEEEQM  
    50   98 L Q  S    S+     0   0    2  892   63  QQQHQHQQQQ H HHHHHQHHQHQHHHHHQQHQQHHHQQQQQ  QHHQHHHQHQQQQQQHQQQQQQHH  
    51   99 L F  E     -U   62   0I   4  892   80  YFFFYFYYYY F FFFFFYFFYFYFFFFFYYFYYFFFYFFFY  YFFYFFFFFYFYFYYFYYYYYYFF  
    52  100 L d  E     +U   61   0I  10  893    1  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC  
    53  101 L H  E     -U   60   0I  68  893   87  SDDRSHGSSS R KKKKRSEESSSVHHHHSHHSSKDLIDDHS  STLSVVVDLTNSDSSVSSSSSSHT  
    54  102 L E  E     -U   59   0I  92  893   68  DGGHDDADDD H RRRRHDEEDHDMEEEENDDDDRGDDGGPD  DSMDMMMGDDNDGDDLDDDDDDPS  
    55  103 L E  S    S-     0   0  100  893   82  HssdHNDhhh d VVVVdhDDhqhkiiiihrNHhVsQkssgH  HMsneeesQhmhsHhLhHhhHHGM  
    56  104 L Q  S    S-     0   0  175  693   73  t..ptspggg p QQQQpgeegpg.ddddedsmgQ.ed..rv  vgde....eeng.aeeeaggaaQg  
    57  105 L N  S    S+     0   0  154  838   66  twwQttaTTT Q SSSSQArrAHTnnnnnAAtaASpkTaa.s  ss.TdddakgGAaaAhAtTTtaDs  
    58  106 L S  S    S-     0   0   58  853   65  KKKKKSGKKK K EEEEKKRRKKKQRRRRKGSKKERAPRRSQ  QGVKVVVRA.SKRKKKGKKKKKSG  
    59  107 L V  E     -U   54   0I   7  890   79  RRRARRRRRR A TTTTARLLRVRARRRRRRRRRTRPRRRFR  RAPRSSSRPRRRRRRTRRRRRRYA  
    60  108 L V  E     -U   53   0I  45  891   88  SKKVSQFSSS V QQQQVSNNSVSVKKKKFTQSSQTVSSSKS  SKVSVVVSVSESSSSQSSSSSSIK  
    61  109 L e  E     +U   52   0I   5  893    1  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC  
    62  110 L S  E     -U   51   0I  24  893   75  RAASRSWRRR S SSSSSRSSQSRRSSSSRHSWWSSTRSSSR  RSRRHHHSTWSWSWWVWRRRRWSS  
    63  111 L f        -     0   0   23  893    0  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCHCCCCCCCC  
    64  112 L A    >   -     0   0    8  893   75  HAAAHAHHHH A AAAAAHAAHAHAAAAAHHAHHAAVHAAAH  HAAHAAAAVHAHAHHMHHHHHHAA  
    65  113 L R  T 3  S+     0   0  149  893   80  EPPSEEEEEE S EEEESEDDEAETKKKKEEEEEESKKEESE  ERADVVVEKEEEEEEDEEEEEEQR  
    66  114 L G  T 3  S+     0   0   24  893    8  GGGGGGGGGG G SSSSGGGGGGGGGGGGGGGGGSGGGGGGG  GGGGGGGGGGGGGGGTGGGGGGGG  
    67  115 L Y  E <   -V   78   0J  20  893   11  YYYYYYYYYY Y YYYYYYYYYYYYYYYYYYYYYYYYYYYYY  YYYYYYYYYYHYYYYNYYYYYYYY  
    68  116 L T  E     -V   77   0J  72  891   85  SVAKSKASSS K RLRRKSFFSKSINNNNTTKSSRSRTAATT  TKTTQQQARATSASSSASSSSSKK  
    69  117 L L  E     -V   76   0J  67  888   64  LLLLLLLLLL L LLLLLLLLLLLLLLLLLLLLLLLLLLLLL  LLLLLLLLLLLLLLLQLLLLLLLL  
    70  118 L A    >   -     0   0   23  889   78  LGGHLGQLLL H GGGGHLDDLHLGSSSSQLGLLGGQMAAGL  LLGMGGGAQQGLALQKQLLLLLGL  
    71  119 L D  T 3  S+     0   0  175  889   77  AEEEAAAAAA E VVVVEAEEAEAPDDDDAGAAAVVDADDEP  PQLAPPPDDEEADAPMEAAAAAQQ  
    72  120 L N  T 3  S-     0   0   92  694   44  DDDDDDDDDD D DDDDDDDDDDDNNNNNDDDDDDDDDDDDN  NDDDDDDDDDDDDDD.DDDDDDDD  
    73  121 L G  S <  S+     0   0   16  713   66  GRKGGGGGGG G GGGGGGGGGGGKGGGGEGGGGGGGGGGDG  GGKGRRRGGGGGGGG.GGGGGGYG  
    74  122 L K  S    S+     0   0   71  687   76  VKKKVLVVVV K HHHHKVRRVKVKFFFFVVLVVHKHVTTKV  VLRVRRRTHVIVTVVDVVVVVVKL  
    75  123 L A        -     0   0   22  685   66  SSSSSSSSSS S SSSSSSSSSSSSAAAASSSSSSTTSSSSS  SNSSSSSSTSSSSSSTSSSSSSSN  
    76  124 L f  E     -V   69   0J  12  847    9  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC  
    77  125 L I  E     -V   68   0J  78  846   80  TIIKTEATTT K VVVVKTTTTETENNNNATETTVIEEVVFT  TDETEEEVEVVMVMAEEMMMMMID  
    78  126 L P  E     -V   67   0J  62  850   71  PAAPPPPPPP P AAAAPPSSPPPPPPPPPPPPPAAPPSSPP  PPPPPPPSPPPPSPPPPPPPPPPP  
    79  127 L T  S    S+     0   0  103  652   80  TQQATTTTTT A EEEEETTTTTT.TTTTTATTTEQ.TQQNT  THSTTTTQ.TATQTTITTTTTTHH  
    80  128 L G  S    S-     0   0   32  788   69  VVVVVVVVVV V GGGGVVGGVVViGGGGVVVVVGVvVVVeV  VVEVGGGVvVVVVVVVVVVVVVDV  
    81  129 L P  S    S+     0   0  116  601   75  EQQPENEEEE P DDDDPEPPEPEpNNNNEENEEDQaEDDdD  DDQEQQQDaEEEDEEKEEEEEEKD  
    82  130 L Y  S    S+     0   0   59  794   86  YYYYYYYYYY Y FFFFYYIIYFYFYYYYYYYYYFYFYYYCY  YFFYFFFYFYYYYYYFYYYYYYCF  
    83  131 L P    >   -     0   0   17  799   62  PPPPPPPPPP P SSSSPPAAPPPSSSSSPPPPPSPPPPPAP  PPSPSSSPPPPPPPPPPPPPPPAP  
    84  132 L g  T 3  S+     0   0   16  800    5  CCCCCCCCCC C CCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC  
    85  133 L G  T 3  S+     0   0    0  712   37  GGGGGGGGGG G GGGGGGGGGGGGGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGG  
    86  134 L K    <   -     0   0   69  588   68  KKKRKKKKKK R RRRRRKMMKRKRRRRRKKKKKRRRKKK K  KRRKRRRKRKKKQKKKKKKKKK R  
    87  135 L Q        -     0   0   37  477   65  IAAIIIIIII I NNNNIIVVIIIVHHHHIIIIINALMII V  VTVIVVVILIAIIIITIIIIII T  
    88  136 L T        +     0   0    4  428   78  PPPTPPPPPP T IIIITPPPPTPNKKKKPPPPPIP PPP P  PADPHHHP PPPPPPSPPPPPP A  
    89  137 L L        +     0   0  105  372   61  ILL IVVIII   KKKK IVVI ILLLLLVVVIIKL  VV     LIVIIIV VVIVII VIIIII L  
    90  138 L E              0   0  104  274   69   EE          AAAA       SAAAA     AQ  QQ      T SSSQ    Q             
    91  139 L R              0   0  231  199   47               RRRR                 R   KK           K    K             
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2            V V                             IV                        VV
    94   17 C V  B     -A  271   0A   7  590    9            V V                             VV                        II
    95   18 C G  S    S+     0   0   25  591    6            G G                             GG                        NN
    96   19 C G  S    S-     0   0   26  592    0            G G                             GG                        GG
    97   20 C Q  E     -B  237   0B  98  593   95            E E                             EE                        LL
    98   21 C E  E     -B  236   0B  80  594   67            D N                             ND                        II
    99   22 C h        -     0   0    8  594   58            A A                             AA                        CC
   100   23 C K    >   -     0   0  123  593   78            K K                             KA                        PP
   101   24 C D  T 3  S+     0   0   60  594   85            P P                             PR                        KK
   102   25 C G  T 3  S+     0   0    0  595   74            G G                             GG                        GG
   103   26 C E  S <  S+     0   0   36  595   66            Q Q                             QQ                        HH
   104   27 C h    >   +     0   0    4  595   92            F I                             FF                        CC
   105   28 C P  T 3   +     0   0    0  599    9            P P                             PP                        PP
   106   29 C W  T 3  S+     0   0    5  600   26            W W                             WW                        WW
   107   30 C Q  E <   -J  122   0C   7  601   26            Q Q                             QQ                        QQ
   108   31 C A  E     -JK 121 146C   1  593   49            V V                             .V                        AA
   109   32 C L  E     -JK 120 145C   3  598   68            L I                             VL                        MM
   110   33 C L  E     -JK 119 144C   0  601    9            L L                             LL                        LL
   111   34 C I  E     -JK 117 143C   0  601   81            N N                             LH                        SS
   112   35 C N  E >   - K   0 142C  30  601   88            G G                             NG                        EE
   113   36 C E  T 3  S+     0   0   63  117   78            . .                             G.                        ..
   114   37 C E  T 3  S-     0   0  136  242   77            E E                             KE                        .N
   115   38 C N  S <  S+     0   0   84  565   53            T I                             VI                        NN
   116   39 C E        -     0   0  100  589   94            E E                             EA                        NI
   117   40 C G  E     +J  111   0C  14  600   57            A A                             AA                        IY
   118   41 C F  E     +     0   0C  28  611   33            F F                             FF                        yT
   119   42 C i  E     -J  110   0C   0  612    1            C C                             CC                        cC
   120   43 C G  E     -J  109   0C   1  612    1            G G                             GG                        GG
   121   44 C G  E     -J  108   0C   0  612    9            G G                             GG                        AA
   122   45 C T  E     -JL 107 130C   0  612   45            S A                             SS                        II
   123   46 C I  E     + L   0 129C   0  612   23            I I                             II                        II
   124   47 C L        -     0   0    6  612   27            V I                             IV                        LL
   125   48 C S  S    S-     0   0   22  612   56            N N                             NN                        SS
   126   49 C E  S    S+     0   0   99  612   63            E E                             EE                        EE
   127   50 C F  S    S+     0   0   42  612   83            K K                             KK                        QQ
   128   51 C Y  E     - M   0 185C   7  612   34            W W                             WW                        WW
   129   52 C I  E     -LM 123 184C   0  612   14            I I                             VV                        VV
   130   53 C L  E     +LM 122 183C   0  612   27            V V                             VV                        LL
   131   54 C T  E     - M   0 182C   0  612   43            T T                             TT                        TT
   132   55 C A    >>  -     0   0    0  613    2            A A                             AA                        AA
   133   56 C A  G >4 S+     0   0    0  613    9            A A                             AA                        AA
   134   57 C H  G >4 S+     0   0    7  613    0            H H                             HH                        HH
   135   58 C i  G X4 S+     0   0    0  613    1            C C                             CC                        CC
   136   59 C L  G << S+     0   0   31  613   66            I L                             II                        VV
   137   60 C Y  G <  S+     0   0  109  613   87            L K                             KK                        WW
   138   61 C Q  S <  S+     0   0   95  613   78            P P                             PP                        rr
   139   61AC A        -     0   0   16  373   75            G G                             DG                        aa
   140   62 C K  S    S-     0   0  172  387   77            I D                             DV                        HH
   141   63 C R  S    S-     0   0  162  602   78            K K                             NK                        LL
   142   64 C F  E     -K  112   0C  36  609   54            I I                             II                        FF
   143   65 C K  E     -K  111   0C  67  609   79            E E                             TT                        NN
   144   66 C V  E     -KN 110 161C   0  609   16            V V                             VV                        VV
   145   67 C R  E     -KN 109 160C  40  609   55            V V                             VV                        TT
   146   68 C V  E     +KN 108 159C   1  610   43            A A                             AA                        VV
   147   69 C G  S    S+     0   0    9  610   15            G G                             GG                        GG
   148   70 C D        +     0   0   11  611   58            K E                             EE                        EE
   149   71 C R  S    S+     0   0   24  611   73            H H                             YH                        HH
   150   72 C N  B >   -P  234   0D  18  611   65            N N                             NN                        DD
   151   73 C T  T 3  S+     0   0   56  611   80            I I                             IT                        RR
   152   74 C E  T 3  S-     0   0  119  611   84            E D                             QE                        EE
   153   75 C Q  S <  S-     0   0  130  610   85            K E                             EK                        II
   154   76 C E        +     0   0  165  610   85            K K                             TP                        FF
   155   77 C E        -     0   0   93  469   27            E E                             EE                        EE
   156   78 C G  S    S+     0   0   46  578   34            D D                             NP                        KK
   157   79 C G  S    S+     0   0   47  585   75            T T                             TT                        TT
   158   80 C E        -     0   0   37  472   30            E E                             EE                        EE
   159   81 C A  E     -N  146   0C  27  487   57            Q Q                             QQ                        QQ
   160   82 C V  E     -N  145   0C  71  590   83            R R                             KK                        HH
   161   83 C H  E     -N  144   0C  14  599   76            R R                             RR                        RR
   162   84 C E        -     0   0   90  602   78            N N                             NN                        RR
   163   85 C V  E     -O  186   0C  27  607   64            V V                             VV                        VV
   164   86 C E  E    S+     0   0C  70  608   73            T I                             II                        II
   165   87 C V  E     -O  185   0C  13  609   72            Q R                             RR                        KK
   166   88 C V  E     -O  184   0C  72  610   46            I T                             IA                        VV
   167   89 C I  E     +O  183   0C  27  610   43            I I                             II                        LL
   168   90 C K  E     -O  182   0C  68  610   82            L P                             PP                        II
   169   91 C H    >   -     0   0   19  611   13            H H                             YY                        HH
   170   92 C N  T 3  S+     0   0  156  611   61            H H                             HH                        PP
   171   93 C R  T 3  S+     0   0  150  608   73            S Q                             KG                        GG
   172   94 C F    <   -     0   0   24  611    5            Y Y                             YY                        YY
   173   95 C T     >  -     0   0   56  611   68            n n                             nn                        NN
   174   96 C K  T  4 S+     0   0  145  561   78            f i                             ii                        KK
   175   97 C E  T  4 S+     0   0  174  569   91            N N                             NN                        TT
   176   98 C T  T  4 S-     0   0   44  598   57            K K                             KK                        SS
   177   99 C Y    ><  +     0   0   60  604   65            Y Y                             YY                        SS
   178  100 C D  T 3   +     0   0   25  609   37            S S                             NS                        DD
   179  101 C F  T 3  S+     0   0   21  595   66            H H                             HH                        KK
   180  102 C D    <   +     0   0    1  609    0            D D                             DD                        DD
   181  103 C I        +     0   0    0  611   13            I I                             II                        LL
   182  104 C A  E     -MO 131 168C   0  611   60            A A                             AA                        AA
   183  105 C V  E     -MO 130 167C   0  612   16            L L                             LL                        MM
   184  106 C L  E     -MO 129 166C   0  613   30            L L                             LL                        LL
   185  107 C R  E     -MO 128 165C  40  613   43            E E                             EE                        KK
   186  108 C L  E     - O   0 163C   0  613   16            L L                             LL                        LL
   187  109 C K  S    S+     0   0  101  613   69            D D                             DD                        HH
   188  110 C T  S    S-     0   0   82  614   74            K K                             KE                        RR
   189  111 C P        -     0   0   48  614   39            P P                             PP                        PP
   190  112 C I        -     0   0    4  562   63            L L                             LL                        VV
   191  113 C T        -     0   0   95  566   73            S I                             TE                        KK
   192  114 C F        +     0   0   56  612   34            L L                             LL                        LL
   193  115 C R  B >   -Q  196   0E  52  613   63            N N                             NN                        GG
   194  116 C M  T 3  S+     0   0   29  594   77            S S                             SS                        LL
   195  117 C N  T 3  S+     0   0   13  602   90            Y Y                             YY                        YY
   196  118 C V  B <   +Q  193   0E   0  604   27            V V                             VV                        VV
   197  119 C A        -     0   0    1  606   80            T T                             TT                        VV
   198  120 C P        -     0   0    8  608   54            P P                             PP                        PP
   199  121 C A        -     0   0    2  609   39            I I                             II                        II
   200  122 C g  B     -c  290   0B   1  610   66            C C                             CC                        CC
   201  123 C L        -     0   0   27  612    5            I V                             II                        LL
   202  124 C P        -     0   0    7  613   30            A A                             AA                        PP
   203  124AC E     >  -     0   0   92  612   75            N N                             ND                        AA
   204  125 C R  H  > S+     0   0  109  612   78            R K                             RR                        QQ
   205  126 C D  H  > S+     0   0  124  612   85            E E                             EE                        NN
   206  127 C W  H  >>S+     0   0    4  612   88            Y Y                             YY                        SS
   207  128 C A  I  X>S+     0   0    0  612   75            T T                             TT                        TT
   208  129 C E  I  <5S+     0   0   75  613   82            N N                             NN                        II
   209  130 C S  I  <5S+     0   0   70  614   66            I I                             II                        ss
   210  131 C T  I  <5S+     0   0   18  108   73            . .                             ..                        tt
   211  131AC L  I ><  S-     0   0  119  503   80            F F                             FF                        SS
   227  146 C E  T 3  S+     0   0   47  527   75            S N                             NN                        RR
   228  147 C K  T 3  S+     0   0  169  548   68            Q K                             RR                        FF
   229  149 C G  S <  S-     0   0   29  559   66            G G                             GG                        GG
   230  150 C R        -     0   0  213  584   86            R R                             RR                        PP
   231  151 C Q  B     -R  224   0F  79  599   93            T Q                             QS                        PP
   232  152 C S        -     0   0   14  607   51            A A                             AA                        AA
   233  153 C T  S    S+     0   0   48  608   73            S S                             SS                        TT
   234  154 C R  B    S-P  150   0D 102  608   85            I I                             II                        II
   235  155 C L        -     0   0    3  610    3            L L                             LL                        LL
   236  156 C K  E     -BD  98 221B  31  610   51            Q Q                             QQ                        QQ
   237  157 C M  E     -BD  97 220B  18  611   94            Y Y                             YY                        RR
   238  158 C L  E     - D   0 219B   4  612   44            L L                             LL                        LL
   239  159 C E  E     - D   0 218B 107  612   72            R R                             RK                        TT
   240  160 C V  E     - D   0 217B   0  612   46            V V                             VV                        LL
   241  161 C P  E     - D   0 216B  34  612   28            P P                             PP                        PP
   242  162 C Y  E     -F  263   0B  36  613   46            L L                             FL                        RR
   243  163 C V  E     -F  262   0B  24  614   37            V V                             VV                        VV
   244  164 C D     >  -     0   0   88  613   57            D D                             DD                        PP
   245  165 C R  H  > S+     0   0   51  613   78            R R                             RR                        LL
   246  166 C N  H  > S+     0   0  105  614   74            A A                             AA                        QQ
   247  167 C S  H  > S+     0   0   48  614   78            T T                             TT                        EE
   248  168 C j  H  X S+     0   0    1  614    2            C C                             CC                        CC
   249  169 C K  H >< S+     0   0   88  614   73            L L                             LL                        RR
   250  170 C L  H 3< S+     0   0  150  574   89            R R                             RR                        LL
   251  171 C S  H 3< S+     0   0   23  604   76            S S                             SS                        HH
   252  172 C S    <<  -     0   0   20  607   83            T T                             TT                        TT
   253  173 C S  S    S+     0   0   79  607   83            K K                             KK                        KK
   254  174 C F  S    S-     0   0  124  607   79            F F                             FF                        LL
   255  175 C I        -     0   0  100  608   87            T S                             TT                        NN
   256  176 C I        -     0   0   13  609   18            I I                             II                        II
   257  177 C T    >   -     0   0   16  614   35            Y Y                             YY                        TT
   258  178 C Q  T 3  S+     0   0  133  614   68            N N                             NN                        RR
   259  179 C N  T 3  S+     0   0   24  614   60            N N                             NH                        NN
   260  180 C M  E <   - G   0 311B   2  614   13            M M                             MM                        MM
   261  181 C F  E     - G   0 310B   8  613   35            F F                             FF                        LL
   262  182 C j  E     +FG 243 309B   1  614    1            C C                             CC                        CC
   263  183 C A  E     +FG 242 308B   0  614   26            A A                             AA                        AA
   264  184 C G  S    S-     0   0    3  614   10            G G                             GG                        GG
   265  185 C Y        -     0   0   56  591   57            F Y                             FY                        LL
   266  185AC D  S    S-     0   0   81  594   83            H R                             DH                        KK
   267  185BC T  S    S+     0   0   76  614   61            E E                             VE                        TT
   268  186 C K  S    S-     0   0  107  563   32            G G                             GG                        GG
   269  187 C Q  S    S+     0   0  102  569   37            G G                             GG                        GG
   270  188 C E        +     0   0   33  613   55            R K                             KK                        RR
   271  189 C D  B     -A   94   0A   7  614    4            D D                             DD                        DD
   272  190 C A        -     0   0    7  614   42            S S                             SS                        AA
   273  191 C k    >   -     0   0    7  614    3            C C                             CC                        CC
   274  192 C Q  T 3  S+     0   0   90  614   25            Q E                             EQ                        EE
   275  193 C G  T 3  S+     0   0    6  614    8            G G                             GG                        GG
   276  194 C D    X   +     0   0    0  614    0            D D                             DD                        DD
   277  195 C S  T 3  S+     0   0   14  614    1            S S                             SS                        SS
   278  196 C G  T 3  S+     0   0    0  614    0            G G                             GG                        GG
   279  197 C G    <   -     0   0    0  614    1            G G                             GG                        GG
   280  198 C P  E     - H   0 294B   1  614    2            P P                             PP                        PP
   281  199 C H  E     -EH 219 293B   0  614   49            H H                             HH                        LL
   282  200 C V  E     -EH 218 291B   3  614   26            V V                             VV                        VV
   283  201 C T  E     - H   0 290B   0  614   66            T T                             TT                        TT
   284  202 C R  E     + H   0 289B  99  614   70            E E                             EE                        YY
   285  203 C F  E >  S- H   0 288B  22  614   71            V V                             VV                        YY
   286  204 C K  T 3  S-     0   0   85  222   71            E E                             EE                        KK
   287  205 C D  T 3  S+     0   0  108  223   55            G G                             GG                        KK
   288  206 C T  E <   - H   0 285B   3  233   75            T T                             TT                        TT
   289  207 C Y  E     - H   0 284B  21  242   51            N S                             SS                        WW
   290  208 C F  E     -cH 200 283B   0  613   91            F F                             FF                        FF
   291  209 C V  E     + H   0 282B   1  613   38            L L                             LL                        LL
   292  210 C T  E     +     0   0B   1  613   84            T T                             TT                        TT
   293  211 C G  E     -IH 312 281B   0  613    0            G G                             GG                        GG
   294  212 C I  E     -IH 311 280B   0  613   19            I I                             II                        VV
   295  213 C V  E     +I  310   0B   7  613   14            I I                             II                        VV
   296  214 C S  E     -     0   0B   1  612    0            S S                             SS                        SS
   297  215 C W  E     -I  309   0B  45  613    7            W W                             WW                        WW
   298  216 C G        -     0   0   26  613    0            G G                             GG                        GG
   299  217 C E  S    S-     0   0   25  609   90            E E                             EE                        KK
   300  218 C G  S    S-     0   0   19  612   13            E E                             EE                        GG
   301  220 C k  S    S-     0   0    7  613    2            C C                             CC                        CC
   302  221 C A  S    S+     0   0    4  612   16            A A                             AA                        AA
   303  222 C R    >   -     0   0  105  611   73            M M                             IM                        NN
   304  223 C K  T 3  S+     0   0  152  611   64            K K                             KK                        EE
   305  223AC G  T 3  S+     0   0   26  613   58            G G                             GG                        NN
   306  224 C K    <   -     0   0   43  613   85            K K                             KK                        LL
   307  225 C Y        -     0   0   33  613   50            Y Y                             YY                        YY
   308  226 C G  E     -G  263   0B   4  611    2            G G                             GG                        GG
   309  227 C I  E     -GI 262 297B   6  612   11            I I                             VI                        VV
   310  228 C Y  E     -GI 261 295B   1  612    1            Y Y                             YY                        YY
   311  229 C T  E     -GI 260 294B   2  612   39            T T                             TT                        VV
   312  230 C K  E >   - I   0 293B  21  612   42            K K                             RK                        RR
   313  231 C V  G >  S+     0   0    1  611    8            V V                             VV                        VV
   314  232 C T  G 3  S+     0   0    2  609   71            S S                             SS                        TT
   315  233 C A  G <  S+     0   0   29  609   79            R R                             WR                        NN
   316  234 C F  S <> S+     0   0    7  605   35            Y Y                             YY                        FF
   317  235 C L  H  > S+     0   0   23  603   80            V V                             V                         LL
   318  236 C K  H  > S+     0   0  116  602   68            N N                             N                         DD
   319  237 C W  H  > S+     0   0   26  602    1            W W                             W                         WW
   320  238 C I  H  X S+     0   0    1  599   12                                                                      II
   321  239 C D  H  < S+     0   0   66  570   71                                                                      GG
   322  240 C R  H >< S+     0   0  136  556   71                                                                      NN
   323  241 C S  H >< S+     0   0    6  523   72                                                                      II
   324  242 C M  T 3< S+     0   0   25  479   41                                                                      II
   325  243 C K  T <  S+     0   0  153  444   70                                                                      AA
   326  244 C T    <         0   0   51  390   65                                                                      TT
   327  245 C R              0   0  197  273   47                                                                      NN
## ALIGNMENTS  281 -  350
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1   49 L Q              0   0  101  671   35           Q Q   Q Q  QQQ QQQ QQQQQQQQQQQ QQQQ E RQQQQRQQQ QQ Q QQQQ  Q 
     2   50 L a    >   +     0   0   22  858    0  CCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCC CSCCCCCCCCCCCCCCCCCCCCC
     3   51 L E  T 3  S+     0   0  187  858   80  KKKKKKKKKAEA LKSSAKKVSALADA AAVVVVVVVVVVAAQVSV EATTTSATAKAALAKLTVRIIRI
     4   52 L T  T 3  S-     0   0  105  864   61  SSSSSSSSSSRS TSSTSSQPSSSSSS SSPPPPPPPPPSSSSPVE SPTTTSSTSSSSVSSSTPSSSSS
     5   53 L S    <   +     0   0   89  868   72  TTTTTTTTTNNN NTNNNANNNNHNNN NNPPPPPPPPPQNNNPME NSNNNSNNNSNNNNSNNNNQQNQ
     6   54 L P        +     0   0   10  878   31  PPPPPPPPPPPP PPPPPPPNPPPPPP PPPPPPPPPPPPPPPPPT PPPPPPPPPPPPPPPPPNPPPPP
     7   55 L b        -     0   0   18  893   21  CCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCC
     8   56 L Q  S    S+     0   0   92  892   83  VVVVVVVVVQVL RVKKQKQVKQAQQQ QQQQQQQQQQQLQQVQQN QQVVVQQVQLQRFQLMVVQLLQL
     9   57 L N  S    S-     0   0   63  893   51  NNNNNNNNNNNN NNNNNNNNNNHNNN NNNNNNNNNNNNNNNNNY NNHHHHNHNNNNNNNNHNHYHHH
    10   58 L Q  S    S-     0   0  152  893   57  KKKKKKKKKGKG NKNGSQGGNGQGGG GGEEEEEEEEENGGAENE NGGGGGGGGGGGNGGGGGGNNGN
    11   59 L G        -     0   0   16  893   40  GGGGGGGGGGGG GGGGGGGTGGGGGG GGGGGGGGGGGGGGVGGE GGKKKGGKGGGGGGGGKTGGGGG
    12   60 L K  E     -S   23   0G 117  852   79  RRRRRRRRRLIS TRVVTTICVSLTTS TTVVVVVVVVVTSTCVVA TSCCCLSCSSSSTSSTCCTSSTS
    13   61 L a  E     -S   22   0G  45  882   10  CCCCCCCCCCCC CCCCCCCICCCCCC CCCCCCCCCCCCCCKCCR CCVVVCCVCCCCCCCCVICCCCC
    14   62 L K  E     -S   21   0G 155  890   81  KKKKKKKKKLkE VKKkDQtDKEKQTE VVKKKKKKKKKQEQDKVE VEDDDEEDQsEEIEsFDDKQQKQ
    15   63 L X  E     +S   20   0G 120  768   39  DDDDDDDDDDqD .DDrDHe.DDDDDD EEDDDDDDDDDDDD.D.. ND...DD.EeDD.DeD..DDDDD
    16   64 L G        -     0   0   44  862   73  GGGGGGGGGAHQ YGGHQQRQGQGHQQ NNGGGGGGGGGNQHGGS. SQLLLSQLDGQQYQGQLQGSSGS
    17   65 L L  S    S-     0   0  152  871   64  IIIIIIIIILYL LIIYFSYVILILFL FFIIIIIIIIIILLIIM. QLLLLILLFPFLMLPHLVIIIII
    18   66 L G  S    S+     0   0   67  883   63  GGGGGGGGGQDQ aGNNQGSGNQGKQQ QQNNNNNNNNNRQKGNg. DQQQQRQQQSQQgQSQQGGWWGW
    19   67 L E        -     0   0  119  837   61  SSSSSSSSSA.A sSE.DT.SQSTSNS TTSSSSSSSSSSSSRStA AADDDDSDG.SSsS.SDSRGGRG
    20   68 L Y  E     -S   15   0G  37  883   11  YYYYYYYYYYYY YYYYYYYYYYYYYY YYYYYYYYYYYYYYFYYF YYFFFYYFYYYYYYYYFYYYYYY
    21   69 L T  E     -S   14   0G  71  886   82  TTTTTTTTTTII YTTFVELTTISVII IIVVVVVVVVVTIVDVQE TISSSTISVTIIEITISTTTTTT
    22   70 L b  E     -S   13   0G  20  889    0  CCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCD CCCCCCCCCCCCCCCCCCCCCCC
    23   71 L T  E     -S   12   0G  85  890   86  FFFFFFFFFLLF LFYIRSLLYFYFIF LLWWWWWWWWWTFFIWHT FFTTTTFTFYFFQFYTTLTTTTT
    24   72 L c        -     0   0   44  890    0  CCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCE CCCCCCCCCCCCCCCCCCCCCCC
    25   73 L L    >   -     0   0   62  890   88  LLLLLLLLLQPP ALLPPQPHLLQLPL LLKKKKKKKKKSLLNKPK PPDDDTPDLLPPPPLADHASSAS
    26   74 L E  T 3  S+     0   0  177  890   75  SSSSSSSSSKPE ESSPVPPPSDALID MMPPPPPPPPPSDLEPET EDSSSTDSPPEDEDPMSPEPPEP
    27   75 L G  T 3  S+     0   0   29  893   20  GGGGGGGGGGLG GGGKEGRGGDGDDD EEDDDDDDDDDGNDGDGV GGGGGGDGDEESGDEGGGAGGAG
    28   76 L F  E <   +T   36   0H  40  893    9  YYYYYYYYYYFF YYYFYFYFYFYFYF FFFFFFFFFFFYFFWFFP FFFFFFFFFFFFYFFYFFYYYYY
    29   77 L E  E     +T   35   0H  74  893   73  QQQQQQQQQVTE EQDGETEEDQQEEQ EESSSSSSSSSEEEESGr NEEEEEQEEREQEQREEESEESE
    30   78 L G  S >  S-     0   0   32  889    5  GGGGGGGGGGGG GGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGp GGGGGGGGGGGGGGGGGGGGGGG
    31   79 L K  T 3  S+     0   0  156  891   73  FFFFFFFFFRKR KFNDKKQRNRFRRR RRRRRRRRRRRKRRRRQQ RRKKKKRKRVRRRRVRKRHSSHS
    32   80 L N  T 3  S-     0   0   33  892   62  NNNNNNNNNNQN YNTNNNNHTNNNNN NNNNNNNNNNNDNNLNRL NNHHHDNHNNHNYNNHHHDNNDN
    33   81 L c  S <  S+     0   0    1  892    3  CCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCP CCCCCCCCCCCCCCCCCCCCCCC
    34   82 L E        +     0   0   87  891   44  EEEEEEEEEEEE EEEEEEEDEEEEEE EEEEEEEEEEEAEEKEER EEDDDAEDQEEEQEEEDNQEEQE
    35   83 L L  E    S-T   29   0H  96  889   88  IIIIIIIIIFLT KIIEKITFITIKIT IIIIIIIIIIIFTKIITL ETLLLFTLILTTTTLTLFTLLTL
    36   84 L F  E     -T   28   0H 139  889   83  VVVVVVVVVDEN GVSEAVEPSNVSGN SSEEEEEEEEEANSEEkP AdRRRANRNeNNdDeNRSDAADA
    37   85 L T        -     0   0   44  677   75  IIIIIIIIIlVk lIKKvTVvKkIkpk kkVVVVVVVVVKkkvVet iqrrrKkrkrkklkrlrvKKKKK
    38   86 L R        +     0   0   57  408   92  PPPPPPPPPa.q tP..kA.a.lPqkl qqSSSSSSSSSNqqySfr tqaaaNqaqpql.qpmaaSNNSN
    39   87 L K        +     0   0   96  535   81  QQQQQQQQQLVL LQLFLRFTLQELLQ LLKKKKKKKKKELLSKLQ LLTTTELTLDLL.LDLTTQEEQE
    40   88 L L        -     0   0   91  608   90  LLLLLLLLLNHI KLGEKQENGVLIKV IIQQQQQQQQQCIINQKL KINNNCINITIVGITKNSCCCCC
    41   89 L d  S  > S+     0   0   15  617   29  CCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCCCCCCCHCCCCCC CCCCCRCCCCCCCCCCCCPHHPH
    42   90 L S  T  4 S+     0   0   98  624   84  EEEEEEEEESWM QETWIDQSTMEAIM DDSSSSSSSSSPVASSLS LASSSHMSDLEVLMLISSSPPSP
    43   91 L L  T >4 S-     0   0  120  627   87  NNNNNNNNNYYN YNFYFVYEFNNNYN FFVVVVVVVVVLNNLVYL YNLLLQNLNVNNYNVYLEAEEAE
    44   92 L D  G >4 S-     0   0  107  638   73  EEEEEEEEEDND VERKDNKDREREDE DDNNNNNNNNNREENNQD LENNNGENEEEEQEEDNDGRRGR
    45   93 L N  G >< S-     0   0    8  700   56  NNNNNNNNNNNN NNNNNNNNNNNNNN NNNNNNNNNNNTNNNNNN NNNNNKNNNNNNNNNNNNPTTPT
    46   94 L G  G <  S-     0   0    0  882   52  GGGGGGGGGGGG GGGGGGGGGGGGGG GGGGGGGGGGGDGGGGGG GGGGGEGGGGGGGGGGGGLDDLD
    47   95 L D  G <  S+     0   0   44  887   62  GGGGGGGGGRGG GGGGGGGGGGGDDG GGGGGGGGGGGGGDGGQD GGDDDGGDGGGGHGGQDGAGGAG
    48   96 L e    <   -     0   0    0  892    0  CCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCC
    49   97 L D  S    S-     0   0   59  892   74  EEEEEEEEEEQE EEQWEMQDEEEDDE NNSSSSSSSSSQEDMSQE EEDDDQQDEEEEEQEEDDEQQEQ
    50   98 L Q  S    S+     0   0    2  892   63  HHHHHHHHHHQQ QHHQQHQHHQHQQQ QQHHHHHHHHHHQQHHHQ HQHHHHQHQHQQHQHHHHHHHHH
    51   99 L F  E     -U   62   0I   4  892   80  FFFFFFFFFFYY FFFYYFYSFYFYYY YYFFFFFFFFFFYYFFFF FYDDDFYDYFYYFYFFDSFFFFF
    52  100 L d  E     +U   61   0I  10  893    1  CCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCC
    53  101 L H  E     -U   60   0I  68  893   87  KKKKKKKKKVTS DKQRTSIQQSSRVS SSVVVVVVVVVHSRTVDR NGHHHYSHSDSSNSDHHQRLLRL
    54  102 L E  E     -U   59   0I  92  893   68  VVVVVVVVVEDD GVGDDRNEGDVDDD DDMMMMMMMMMPDDNMGE DAEEEPDEDENDSDEDEEPPPPP
    55  103 L E  S    S-     0   0  100  893   82  VVVVVVVVVTnh sVSsKTrsShAHSh nnqqqqqqqqqGhHTqse tDsssghsRdHrShdNsssGGsG
    56  104 L Q  S    S-     0   0  175  693   73  RRRRRRRRReee .RDrqgrnDeRvpe ee.........Qeve... .pddd.edvave.easdn.QQ.Q
    57  105 L N  S    S+     0   0  154  838   66  GGGGGGGGGslA vGEfkgvtEAGttA TTdddddddddDTttdas galllnAldrtGgArtltaEEaE
    58  106 L S  S    S-     0   0   58  853   65  NNNNNNNNNANG RNQHKGSSKGNKLG IIIIIIIIIIISRKSISS QGAAASRATRKGrRRGASASSAS
    59  107 L V  E     -U   54   0I   7  890   79  VVVVVVVVVRVR RVFVRAVRFHVRRH RRSSSSSSSSSYRRRSRV RRRRRYRRRLRRRRLRRRYYYYY
    60  108 L V  E     -U   53   0I  45  891   88  RRRRRRRRRKTS SRSELEQRSSETQS RRVVVVVVVVVISTVVKV SFTTTHSTINSSKSNQTRRTTRT
    61  109 L e  E     +U   52   0I   5  893    1  CCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCC
    62  110 L S  E     -U   51   0I  24  893   75  SSSSSSSSSTSW SSSSFSSGSYSSFY YYHHHHHHHHHSRSSHFS EWSSSSWSRSWRFWSSSGFSSFS
    63  111 L f        -     0   0   23  893    0  CCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCC
    64  112 L A    >   -     0   0    8  893   75  AAAAAAAAAAAH AAAADAALAQAHAQ EEAAAAAAAAAAHHAAAA AHIIIAHIHAHHAHAAILAAAAA
    65  113 L R  T 3  S+     0   0  149  893   80  DDDDDDDDDDKE EDKKDMQPKEAEEE RRVVVVVVVVVQEEQVHR QEKKKDEKEDEEDEDEKLRQQRQ
    66  114 L G  T 3  S+     0   0   24  893    8  GGGGGGGGGGGG GGDDDGGGDGGDGG GGGGGGGGGGGGGDGGGG GGGGGGGGGGGGGGGSGGGGGGG
    67  115 L Y  E <   -V   78   0J  20  893   11  YYYYYYYYYYYY YYYYYYYYYYYYYY YYHHHHHHHHHYYYYHYY YYYYYYYYYYYYYYYYYYYYYYY
    68  116 L T  E     -V   77   0J  72  891   85  EEEEEEEEEAKA AEKATKKTKAFTRA AARRRRRRRRRKATRRTV AAQQQETQTGTTQTGKQTTRRTR
    69  117 L L  E     -V   76   0J  67  888   64  LLLLLLLLLLLL LLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLL
    70  118 L A    >   -     0   0   23  889   78  GGGGGGGGGFGQ AGHHAVEAHQAQAQ AAGGGGGGGGGGQQNGAG GQQQQGQQQDQQAQDGQANGGNG
    71  119 L D  T 3  S+     0   0  175  889   77  PPPPPPPPPEEE DPAESGEDADSPSD PPLLLLLLLLLQDPDLSD EADDDKDDPATDDDAADDSEESE
    72  120 L N  T 3  S-     0   0   92  694   44  DDDDDDDDDDDD DDDDD.DDDDDDDD DDDDDDDDDDDDDDDDDD DDNNNDDNDDDDNDDDNDDDDDD
    73  121 L G  S <  S+     0   0   16  713   66  DDDDDDDDDDGG GDGGGDGGGGDEQG GGKKKKKKKKKYGEYKGG GGSSSKGSKGGGGGGGSGGRHGR
    74  122 L K  S    S+     0   0   71  687   76  KKKKKKKKKEKV TKKKVVKRKVKVMV VVKKKKKKKKKKVVKKRK EVRRRKVRVLVVKVLLRRRKKRK
    75  123 L A        -     0   0   22  685   66  SSSSSSSSSSSS SSSRSKSSSSSSSS TTSSSSSSSSSSSSTSQS TSKKKQSKSSSSKSSSKSSQQSQ
    76  124 L f  E     -V   69   0J  12  847    9  CCCCCCCCCCCC CCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCC
    77  125 L I  E     -V   68   0J  78  846   80  QQQQQQQQQMEE VQQVIQAQRMEKLM NNEEEEEEEEEIAKQEIV EAATTIMTINAAVMNETQSVVSV
    78  126 L P  E     -V   67   0J  62  850   71  SSSSSSSSSPKP SSPQPPEPPPSPPP PPPPPPPPPPPPPPPPAS PPPPPPPPPAPPPPAPPPPPPPP
    79  127 L T  S    S+     0   0  103  652   80  NNNNNNNNNTST QNVAQEASMTNKET VVTTTTTTTTTHTKATET QTKKKLIKTKTTKIKEKSNHHNH
    80  128 L G  S    S-     0   0   32  788   69  EEEEEEEEERDV VEVGVGVVVVEVVV VVGDDDDDDDDDVVVDVG DVNNNDVNVEVVVVEVNVVDDVD
    81  129 L P  S    S+     0   0  116  601   75  TTTTTTTTTERE DTPPKSPPPEPEEE DD.QQQQQQQQKEEEQE. LEDDDQEDEVEEAEVDDPQQQQQ
    82  130 L Y  S    S+     0   0   59  794   86  FFFFFFFFFFYY YFFFYFFFFYFYYY YY.FFFFFFFFCYYFFFL YYAAACYAYVYYFYVYAFNCCNC
    83  131 L P    >   -     0   0   17  799   62  RRRRRRRRRPAP PRPPPPPAPPKPPP PPESSSSSSSSAPPPSPT PPSSSAPSPVPPPPVPSAPAAPA
    84  132 L g  T 3  S+     0   0   16  800    5  CCCCCCCCCCCC CCCCCCCCCCCCCC CCPCCCCCCCCCCCCCCP CCCCCCCCCCCCCCCCCCCCCCC
    85  133 L G  T 3  S+     0   0    0  712   37  GGGGGGGGGGGG GGGGGGGGGGGGGG GGPGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGG
    86  134 L K    <   -     0   0   69  588   68  GGGGGGGGGK K QGR KIKKRKARKK RRKHHHHHHHHMRRKHQS KKQQQRKQKKKKRKKKQKTVVTV
    87  135 L Q        -     0   0   37  477   65  IIIIIIIIII I III IR IIIIIII MMLIIIIIIIILIILILS IIIIILIIIVIIVIVVIITLLTL
    88  136 L T        +     0   0    4  428   78  IIIIIIIIIP P PIQ PT VQPIPPP PPKNNNNNNNN PPKNPT PPRRR PRPLPPAPLPRAETTET
    89  137 L L        +     0   0  105  372   61  TTTTTTTTTI V VTV VI VVISVVI VVLMMMMMMMM VVIM   IVIII VIVLVV VLVIVMSSMS
    90  138 L E              0   0  104  274   69  EEEEEEEEE    QEQ  S DQ G      QSSSSSSSS    S     PPQ  P T    T PDSEESE
    91  139 L R              0   0  231  199   47  NNNNNNNNN    KN     R  K      N                  KKK  K Q    Q KK KK K
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2                                                L                       
    94   17 C V  B     -A  271   0A   7  590    9                                                I                       
    95   18 C G  S    S+     0   0   25  591    6                                                E                       
    96   19 C G  S    S-     0   0   26  592    0                                                G                       
    97   20 C Q  E     -B  237   0B  98  593   95                                                K                       
    98   21 C E  E     -B  236   0B  80  594   67                                                A                       
    99   22 C h        -     0   0    8  594   58                                                G                       
   100   23 C K    >   -     0   0  123  593   78                                                R                       
   101   24 C D  T 3  S+     0   0   60  594   85                                                R                       
   102   25 C G  T 3  S+     0   0    0  595   74                                                G                       
   103   26 C E  S <  S+     0   0   36  595   66                                                D                       
   104   27 C h    >   +     0   0    4  595   92                                                S                       
   105   28 C P  T 3   +     0   0    0  599    9                                                P                       
   106   29 C W  T 3  S+     0   0    5  600   26                                                W                       
   107   30 C Q  E <   -J  122   0C   7  601   26                                                Q                       
   108   31 C A  E     -JK 121 146C   1  593   49                                                I                       
   109   32 C L  E     -JK 120 145C   3  598   68                                                L                       
   110   33 C L  E     -JK 119 144C   0  601    9                                                L                       
   111   34 C I  E     -JK 117 143C   0  601   81                                                Q                       
   112   35 C N  E >   - K   0 142C  30  601   88                                                N                       
   113   36 C E  T 3  S+     0   0   63  117   78                                                .                       
   114   37 C E  T 3  S-     0   0  136  242   77                                                S                       
   115   38 C N  S <  S+     0   0   84  565   53              G                                 K                       
   116   39 C E        -     0   0  100  589   94              S              E                  G                       
   117   40 C G  E     +J  111   0C  14  600   57              G              A                  K                       
   118   41 C F  E     +     0   0C  28  611   33              F              F                  f                       
   119   42 C i  E     -J  110   0C   0  612    1              C              C                  c                       
   120   43 C G  E     -J  109   0C   1  612    1              G              G                  G                       
   121   44 C G  E     -J  108   0C   0  612    9              G              G                  G                       
   122   45 C T  E     -JL 107 130C   0  612   45              T              A                  V                       
   123   46 C I  E     + L   0 129C   0  612   23              L              I                  L                       
   124   47 C L        -     0   0    6  612   27              I              I                  I                       
   125   48 C S  S    S-     0   0   22  612   56              S              N                  H                       
   126   49 C E  S    S+     0   0   99  612   63              D              E                  P                       
   127   50 C F  S    S+     0   0   42  612   83              Q              K                  F                       
   128   51 C Y  E     - M   0 185C   7  612   34              W              W                  W                       
   129   52 C I  E     -LM 123 184C   0  612   14              V              V                  V                       
   130   53 C L  E     +LM 122 183C   0  612   27              V              V                  L                       
   131   54 C T  E     - M   0 182C   0  612   43              S              T                  T                       
   132   55 C A    >>  -     0   0    0  613    2              A              A                  A                       
   133   56 C A  G >4 S+     0   0    0  613    9              A              A                  A                       
   134   57 C H  G >4 S+     0   0    7  613    0              H              H                  H                       
   135   58 C i  G X4 S+     0   0    0  613    1              C              C                  C                       
   136   59 C L  G << S+     0   0   31  613   66              M              L                  T                       
   137   60 C Y  G <  S+     0   0  109  613   87              Q              K                  D                       
   138   61 C Q  S <  S+     0   0   95  613   78              G              P                  S                       
   139   61AC A        -     0   0   16  373   75              .              G                  G                       
   140   62 C K  S    S-     0   0  172  387   77              P              D                  D                       
   141   63 C R  S    S-     0   0  162  602   78              V              K                  G                       
   142   64 C F  E     -K  112   0C  36  609   54              D              I                  F                       
   143   65 C K  E     -K  111   0C  67  609   79              H              E                  K                       
   144   66 C V  E     -KN 110 161C   0  609   16              V              V                  V                       
   145   67 C R  E     -KN 109 160C  40  609   55              T              V                  R                       
   146   68 C V  E     +KN 108 159C   1  610   43              V              A                  L                       
   147   69 C G  S    S+     0   0    9  610   15              G              G                  G                       
   148   70 C D        +     0   0   11  611   58              D              E                  K                       
   149   71 C R  S    S+     0   0   24  611   73              Y              Y                  Y                       
   150   72 C N  B >   -P  234   0D  18  611   65              D              N                  H                       
   151   73 C T  T 3  S+     0   0   56  611   80              K              I                  R                       
   152   74 C E  T 3  S-     0   0  119  611   84              L              D                  L                       
   153   75 C Q  S <  S-     0   0  130  610   85              R              E                  R                       
   154   76 C E        +     0   0  165  610   85              A              K                  T                       
   155   77 C E        -     0   0   93  469   27              E              E                  E                       
   156   78 C G  S    S+     0   0   46  578   34              P              D                  V                       
   157   79 C G  S    S+     0   0   47  585   75              G              T                  N                       
   158   80 C E        -     0   0   37  472   30              E              E                  E                       
   159   81 C A  E     -N  146   0C  27  487   57              Q              Q                  Q                       
   160   82 C V  E     -N  145   0C  71  590   83              Q              R                  T                       
   161   83 C H  E     -N  144   0C  14  599   76              I              R                  V                       
   162   84 C E        -     0   0   90  602   78              Q              N                  W                       
   163   85 C V  E     -O  186   0C  27  607   64              V              V                  V                       
   164   86 C E  E    S+     0   0C  70  608   73              Q              I                  N                       
   165   87 C V  E     -O  185   0C  13  609   72              K              Q                  K                       
   166   88 C V  E     -O  184   0C  72  610   46              V              T                  C                       
   167   89 C I  E     +O  183   0C  27  610   43              L              I                  V                       
   168   90 C K  E     -O  182   0C  68  610   82              V              P                  K                       
   169   91 C H    >   -     0   0   19  611   13              H              H                  H                       
   170   92 C N  T 3  S+     0   0  156  611   61              P              H                  E                       
   171   93 C R  T 3  S+     0   0  150  608   73              H              H                  N                       
   172   94 C F    <   -     0   0   24  611    5              F              Y                  Y                       
   173   95 C T     >  -     0   0   56  611   68              H              N                  T                       
   174   96 C K  T  4 S+     0   0  145  561   78              A              .                  K                       
   175   97 C E  T  4 S+     0   0  174  569   91              F              .                  E                       
   176   98 C T  T  4 S-     0   0   44  598   57              T              .                  T                       
   177   99 C Y    ><  +     0   0   60  604   65              F              .                  S                       
   178  100 C D  T 3   +     0   0   25  609   37              D              .                  D                       
   179  101 C F  T 3  S+     0   0   21  595   66              S              .                  N                       
   180  102 C D    <   +     0   0    1  609    0              D              .                  D                       
   181  103 C I        +     0   0    0  611   13              V              .                  I                       
   182  104 C A  E     -MO 131 168C   0  611   60              A              .                  A                       
   183  105 C V  E     -MO 130 167C   0  612   16              L              A                  M                       
   184  106 C L  E     -MO 129 166C   0  613   30              L              S                  L                       
   185  107 C R  E     -MO 128 165C  40  613   43              R              I                  H                       
   186  108 C L  E     - O   0 163C   0  613   16              L              N                  L                       
   187  109 C K  S    S+     0   0  101  613   69              A              K                  V                       
   188  110 C T  S    S-     0   0   82  614   74              R              Y                  E                       
   189  111 C P        -     0   0   48  614   39              P              S                  P                       
   190  112 C I        -     0   0    4  562   63              V              L                  V                       
   191  113 C T        -     0   0   95  566   73              L              I                  M                       
   192  114 C F        +     0   0   56  612   34              R              L                  Y                       
   193  115 C R  B >   -Q  196   0E  52  613   63              G              N                  N                       
   194  116 C M  T 3  S+     0   0   29  594   77              P              S                  K                       
   195  117 C N  T 3  S+     0   0   13  602   90              T              Y                  Y                       
   196  118 C V  B <   +Q  193   0E   0  604   27              A              V                  A                       
   197  119 C A        -     0   0    1  606   80              A              T                  L                       
   198  120 C P        -     0   0    8  608   54              P              P                  P                       
   199  121 C A        -     0   0    2  609   39              A              I                  I                       
   200  122 C g  B     -c  290   0B   1  610   66              C              C                  C                       
   201  123 C L        -     0   0   27  612    5              L              V                  L                       
   202  124 C P        -     0   0    7  613   30              P              A                  P                       
   203  124AC E     >  -     0   0   92  612   75              D              N                  T                       
   204  125 C R  H  > S+     0   0  109  612   78              P              R                  R                       
   205  126 C D  H  > S+     0   0  124  612   85              H              E                  D                       
   206  127 C W  H  >>S+     0   0    4  612   88              L              Y                  L                       
   207  128 C A  I  X>S+     0   0    0  612   75              S              T                  A                       
   208  129 C E  I  <5S+     0   0   75  613   82              K              N                  E                       
   209  130 C S  I  <5S+     0   0   70  614   66              Y              I                  h                       
   210  131 C T  I  <5S+     0   0   18  108   73              L              .                  l                       
   211  131AC L  I ><  S-     0   0  119  503   80              R              F                  I                       
   227  146 C E  T 3  S+     0   0   47  527   75              H              N                  Q                       
   228  147 C K  T 3  S+     0   0  169  548   68              L              K                  K                       
   229  149 C G  S <  S-     0   0   29  559   66              G              G                  K                       
   230  150 C R        -     0   0  213  584   86              R              R                  N                       
   231  151 C Q  B     -R  224   0F  79  599   93              S              Q                  Y                       
   232  152 C S        -     0   0   14  607   51              S              A                  S                       
   233  153 C T  S    S+     0   0   48  608   73              R              S                  T                       
   234  154 C R  B    S-P  150   0D 102  608   85              F              I                  L                       
   235  155 C L        -     0   0    3  610    3              L              L                  L                       
   236  156 C K  E     -BD  98 221B  31  610   51              R              Q                  S                       
   237  157 C M  E     -BD  97 220B  18  611   94              R              Y                  Y                       
   238  158 C L  E     - D   0 219B   4  612   44              V              L                  I                       
   239  159 C E  E     - D   0 218B 107  612   72              T              R                  E                       
   240  160 C V  E     - D   0 217B   0  612   46              L              V                  I                       
   241  161 C P  E     - D   0 216B  34  612   28              P              P                  P                       
   242  162 C Y  E     -F  263   0B  36  613   46              V              L                  M                       
   243  163 C V  E     -F  262   0B  24  614   37              V              V                  V                       
   244  164 C D     >  -     0   0   88  613   57              S              D                  P                       
   245  165 C R  H  > S+     0   0   51  613   78              F              R                  R                       
   246  166 C N  H  > S+     0   0  105  614   74              E              A                  N                       
   247  167 C S  H  > S+     0   0   48  614   78              D              T                  E                       
   248  168 C j  H  X S+     0   0    1  614    2              C              C                  C                       
   249  169 C K  H >< S+     0   0   88  614   73              R              L                  A                       
   250  170 C L  H 3< S+     0   0  150  574   89              A              R                  Q                       
   251  171 C S  H 3< S+     0   0   23  604   76              S              S                  V                       
   252  172 C S    <<  -     0   0   20  607   83              T              T                  M                       
   253  173 C S  S    S+     0   0   79  607   83              E              T                  R                       
   254  174 C F  S    S-     0   0  124  607   79              Q              F                  H                       
   255  175 C I        -     0   0  100  608   87              V              T                  T                       
   256  176 C I        -     0   0   13  609   18              I              I                  I                       
   257  177 C T    >   -     0   0   16  614   35              T              Y                  S                       
   258  178 C Q  T 3  S+     0   0  133  614   68              D              N                  D                       
   259  179 C N  T 3  S+     0   0   24  614   60              N              N                  N                       
   260  180 C M  E <   - G   0 311B   2  614   13              M              M                  M                       
   261  181 C F  E     - G   0 310B   8  613   35              F              F                  L                       
   262  182 C j  E     +FG 243 309B   1  614    1              C              C                  C                       
   263  183 C A  E     +FG 242 308B   0  614   26              A              A                  A                       
   264  184 C G  S    S-     0   0    3  614   10              G              G                  G                       
   265  185 C Y        -     0   0   56  591   57              Y              Y                  T                       
   266  185AC D  S    S-     0   0   81  594   83              L              R                  L                       
   267  185BC T  S    S+     0   0   76  614   61              D              E                  G                       
   268  186 C K  S    S-     0   0  107  563   32              A              G                  D                       
   269  187 C Q  S    S+     0   0  102  569   37              S              G                  R                       
   270  188 C E        +     0   0   33  613   55              V              K                  K                       
   271  189 C D  B     -A   94   0A   7  614    4              D              D                  D                       
   272  190 C A        -     0   0    7  614   42              A              S                  A                       
   273  191 C k    >   -     0   0    7  614    3              C              C                  C                       
   274  192 C Q  T 3  S+     0   0   90  614   25              R              E                  I                       
   275  193 C G  T 3  S+     0   0    6  614    8              G              G                  G                       
   276  194 C D    X   +     0   0    0  614    0              D              D                  D                       
   277  195 C S  T 3  S+     0   0   14  614    1              S              S                  S                       
   278  196 C G  T 3  S+     0   0    0  614    0              G              G                  G                       
   279  197 C G    <   -     0   0    0  614    1              G              G                  G                       
   280  198 C P  E     - H   0 294B   1  614    2              P              P                  P                       
   281  199 C H  E     -EH 219 293B   0  614   49              F              H                  M                       
   282  200 C V  E     -EH 218 291B   3  614   26              V              V                  I                       
   283  201 C T  E     - H   0 290B   0  614   66              V              T                  T                       
   284  202 C R  E     + H   0 289B  99  614   70              N              E                  K                       
   285  203 C F  E >  S- H   0 288B  22  614   71              Y              V                  Y                       
   286  204 C K  T 3  S-     0   0   85  222   71              R              E                  K                       
   287  205 C D  T 3  S+     0   0  108  223   55              G              G                  D                       
   288  206 C T  E <   - H   0 285B   3  233   75              T              T                  T                       
   289  207 C Y  E     - H   0 284B  21  242   51              W              S                  W                       
   290  208 C F  E     -cH 200 283B   0  613   91              F              F                  F                       
   291  209 C V  E     + H   0 282B   1  613   38              L              L                  L                       
   292  210 C T  E     +     0   0B   1  613   84              T              T                  V                       
   293  211 C G  E     -IH 312 281B   0  613    0              G              G                  G                       
   294  212 C I  E     -IH 311 280B   0  613   19              V              I                  L                       
   295  213 C V  E     +I  310   0B   7  613   14              V              I                  V                       
   296  214 C S  E     -     0   0B   1  612    0              S              S                  S                       
   297  215 C W  E     -I  309   0B  45  613    7              W              W                  W                       
   298  216 C G        -     0   0   26  613    0              G              G                  G                       
   299  217 C E  S    S-     0   0   25  609   90              E              E                  E                       
   300  218 C G  S    S-     0   0   19  612   13              G              E                  G                       
   301  220 C k  S    S-     0   0    7  613    2              C              C                  C                       
   302  221 C A  S    S+     0   0    4  612   16              A              A                  G                       
   303  222 C R    >   -     0   0  105  611   73              A              I                  K                       
   304  223 C K  T 3  S+     0   0  152  611   64              E              K                  K                       
   305  223AC G  T 3  S+     0   0   26  613   58              G              G                  E                       
   306  224 C K    <   -     0   0   43  613   85              K              K                  K                       
   307  225 C Y        -     0   0   33  613   50              F              Y                  F                       
   308  226 C G  E     -G  263   0B   4  611    2              G              G                  G                       
   309  227 C I  E     -GI 262 297B   6  612   11              V              I                  V                       
   310  228 C Y  E     -GI 261 295B   1  612    1              Y              Y                  Y                       
   311  229 C T  E     -GI 260 294B   2  612   39              T              T                  T                       
   312  230 C K  E >   - I   0 293B  21  612   42              R              K                  K                       
   313  231 C V  G >  S+     0   0    1  611    8              L              V                  V                       
   314  232 C T  G 3  S+     0   0    2  609   71              G              S                  S                       
   315  233 C A  G <  S+     0   0   29  609   79              N              R                  Q                       
   316  234 C F  S <> S+     0   0    7  605   35              F              Y                  Y                       
   317  235 C L  H  > S+     0   0   23  603   80              L              V                  L                       
   318  236 C K  H  > S+     0   0  116  602   68              N              N                  E                       
   319  237 C W  H  > S+     0   0   26  602    1              W              W                  W                       
   320  238 C I  H  X S+     0   0    1  599   12              I              I                  I                       
   321  239 C D  H  < S+     0   0   66  570   71              T              K                  Q                       
   322  240 C R  H >< S+     0   0  136  556   71              S              E                  H                       
   323  241 C S  H >< S+     0   0    6  523   72              T              K                  H                       
   324  242 C M  T 3< S+     0   0   25  479   41              V              T                  I                       
   325  243 C K  T <  S+     0   0  153  444   70                             K                                          
   326  244 C T    <         0   0   51  390   65                                                                        
   327  245 C R              0   0  197  273   47                                                                        
## ALIGNMENTS  351 -  420
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1   49 L Q              0   0  101  671   35   Q QR   Q Q       R   Q RHQ QQ   RQQ   QQ QQ    Q    R       HQQQ Q   
     2   50 L a    >   +     0   0   22  858    0  CC CCCCCCCCCCCCCCCCCCCC CCCCCC  CCCCC CCC CCCC  CC C C       CCCCCC   
     3   51 L E  T 3  S+     0   0  187  858   80  IA ASIIIDIAIIKKKSLTILKD QQRTAA  ESAAE KAA ASVV  QV L S       ANNNDD   
     4   52 L T  T 3  S-     0   0  105  864   61  SS SSSSSSSSSSSSSVAPSASS DSEGSE  SSEEP PEE ESSS  SS S S       SPPPPS   
     5   53 L S    <   +     0   0   89  868   72  QN NSQQQQQNQQNNNMQGQQNN NNNSNK  ASNNH RKK KNQQ  NQ N S       SNHHQQ   
     6   54 L P        +     0   0   10  878   31  PP PPPPPPPPPPPPPPPPPPPP PPVPPP  PPPPPPPPP PPPP  PP P P       PPPPPP   
     7   55 L b        -     0   0   18  893   21  CC CCCCCCCCCCCCCCCCCCCC CCCCCC  CCCCCCCCC CCCC  CC C C       CCCCCC   
     8   56 L Q  S    S+     0   0   92  892   83  LQ QLLLLLLQLLLLLQQQLQLQ VEFQKK  SQKKNCQKK KQLL  VL Q Q       ELHHPL   
     9   57 L N  S    S-     0   0   63  893   51  HN NHHHHNHNHHNNNNNNHNNN NNNHNN  NHNNNENNN NHNN  NN N H       HNNNNN   
    10   58 L Q  S    S-     0   0  152  893   57  NG GNNNNNNGNNGGGNNGNNGG GNGGGG  GGGGGHGGG GNNN  AN G N       DDGGGN   
    11   59 L G        -     0   0   16  893   40  GG GSGGGGGGGGGGGGGGGGGG GSGGGA  VGAATGGAA AGGG  EG G G       GGTTTG   
    12   60 L K  E     -S   23   0G 117  852   79  ST TVSSSSSTSSSSSVVTSVST ITVTSM  CLMMCVTMM MATT  CT T V       LHCCCS   
    13   61 L a  E     -S   22   0G  45  882   10  CC CCCCCCCCCCCCCCCCCCCC CCCCCC  QCCCICCCC CCCC  KC C C       CCKKIC   
    14   62 L K  E     -S   21   0G 155  890   81  QV QKQQQQQQQQsssVVIQVsI sYThES  DESSDIiSS SQEE  DE Q E       tTDDDQ   
    15   63 L X  E     +S   20   0G 120  768   39  DD DDDDDDDDDDeee..ND.eD d.VhDD  .DDD.DdDD DDDD  .D H D       qD...D   
    16   64 L G        -     0   0   44  862   73  SQ HSSSSSSDSSGGGSSNSSGR QLSGNS  GSSSGGGSS SSHH  GH T S       NKSSGS   
    17   65 L L  S    S-     0   0  152  871   64  IF LIIIIIIFIISSSMMEIMSH RLELFV  IIVVILSVV VIII  II H I       AIFFII   
    18   66 L G  S    S+     0   0   67  883   63  WQ KRWWWRWRWWSSSggEWgSQ GkGGQG  GRGGGGSGG GRRR  GR T R       DGGGGR   
    19   67 L E        -     0   0  119  837   61  GS SSGGGSGLGG...taSGa.D .sRNSG  RGGGSS.GG GSSS  RS V G       SGAASS   
    20   68 L Y  E     -S   15   0G  37  883   11  YY YYYYYYYYYYYYYYYYYYYY YYYYYY  YYYYFFYYY FYYY  FY Y Y       YYFFFY   
    21   69 L T  E     -S   14   0G  71  886   82  TI VTTTTITITTTTTQQTTQTF VTAKID  DTDDQTTDD DTSS  DS M T       MTEEQI   
    22   70 L b  E     -S   13   0G  20  889    0  CC CCCCCCCCCCCCCCCCCCCC CCCCCC  CCCCCCCCC CCCC  CC C C       CCCCCC   
    23   71 L T  E     -S   12   0G  85  890   86  TF FDTTTNTFTTFFFHLLTLFI VLVTLV  ITVVIALVV VTTT  IT V I       LNSSIN   
    24   72 L c        -     0   0   44  890    0  CC CCCCCCCCCCCCCCCCCCCC CCCCCC  CCCCCCCCC CCCC  CC C C       CCCCCC   
    25   73 L L    >   -     0   0   62  890   88  SP PTSSSSSLSSLLLPPLSPLP PAMNPK  NTKKNKLKK KTSS  NS P A       ATNNKS   
    26   74 L E  T 3  S+     0   0  177  890   75  PA LDPPPRPPPPPPPEEPPEPP PPPTDS  EASSEAPSS SDPP  EP R E       PDEEER   
    27   75 L G  T 3  S+     0   0   29  893   20  GR DGGGGGGNGGEEEGGQGGEE RGRGDG  GGGGGGQGG GGGG  GG G G       GLGGGG   
    28   76 L F  E <   +T   36   0H  40  893    9  YF FFYYYYYFYYFFFFFFYFFH FFYFFF  WFFFWWFFF FYYY  WY W Y       FFWWWY   
    29   77 L E  E     +T   35   0H  74  893   73  EE EEEEEEESEESSSGNMENSE ISTTEF  EETTEERTT TEEE  EE E E       SLEEEE   
    30   78 L G  S >  S-     0   0   32  889    5  GG GGGGGGGGGGGGGGGGGGGG GGGGGG  GGGGGGGGG GGGG  GG G G       GGGGGG   
    31   79 L K  T 3  S+     0   0  156  891   73  SR RMSSSRSRSSVVVQRLSRVR SRKARV  QEVVRRVVV AEKK  RK R E       RLRRRR   
    32   80 L N  T 3  S-     0   0   33  892   62  NN NNNNNNNNNNDDDRHNNHDN HNHNNH  LDHHLFNHH LNTT  LT V N       HNLLLN   
    33   81 L c  S <  S+     0   0    1  892    3  CC CCCCCCCCCCCCCCCCCCCC CCCCCC  CCCCCCCCC CCCC  CC C C       CCCCCC   
    34   82 L E        +     0   0   87  891   44  EE EAEEEAEEEEEEEEEEEEEE EEEEEE  QAEEEQDEE ENAA  GA S A       EEQQGA   
    35   83 L L  E    S-T   29   0H  96  889   88  LT KFLLLYLTLLLLLTTFLTLI TRTTTT  NFNNHNQKK KFMM  YM Q F       QMYYHY   
    36   84 L F  E     -T   28   0H 139  889   83  AD NAAAAAANAAeeeNKeAKeR EvEVnD  EADDEEeDD DAAA  EA D A       sDEEEA   
    37   85 L T        -     0   0   44  677   75  Kk kKKKKKKrKKqqqkvqKvqp VkVKnQ  vKQQvvkEE EKKK  vK T K       gMvvvK   
    38   86 L R        +     0   0   57  408   92  Nl qNNNNNNlNNppptfsNfpk .p.IqT  yNTTyysTT TNNN  yN R N       tSyyyN   
    39   87 L K        +     0   0   96  535   81  EL LEEEEEELEEDDDELDELDL FDFLLV  DELLTSDLL LEEE  SE E E       DQTTTE   
    40   88 L L        -     0   0   91  608   90  CI ICCCCCCICCTTTLKSCKTK DSEFIC  NCCCNNSCC CCCC  NC S C       SCNNNC   
    41   89 L d  S  > S+     0   0   15  617   29  HC CRHHHHHCHHCCCCCCHCCC CCCSCM  CRTTCCCVV TQHH  CH C H       CPCCCH   
    42   90 L S  T  4 S+     0   0   98  624   84  PK AHPPPPPDPPLLLELLPLLF QLESEL  SHWWSSLVV LYLL  SL K H       LTSSSP   
    43   91 L L  T >4 S-     0   0  120  627   87  EY NEEEEEENEELLLNYLEYLF YHYPND  IQKKLVVDD EKEE  LE V Q       HNTTIE   
    44   92 L D  G >4 S-     0   0  107  638   73  RE EMRRRRRERREEEEQERQEK KNKNEK  DGNNNNQSS KTRR  NR N A       DGNNNR   
    45   93 L N  G >< S-     0   0    8  700   56  TN NDITTTTNITNNNNNNTNNN NNNINT  NKKKNNNDD DRTT  NT N K       NPNNNT   
    46   94 L G  G <  S-     0   0    0  882   52  DG GEDDDDDGDDGGGGGGDGGG GGGDGK  GETTGGGKK QEDD  GD G V       GSGGGD   
    47   95 L D  G <  S+     0   0   44  887   62  GG DGGGGGGGGGGGGGQGGQGN GGGEGG  GGGGGGAGG GGGG  GG R G       GAGGGG   
    48   96 L e    <   -     0   0    0  892    0  CC CCCCCCCCCCCCCCCCCCCC CCCCCC  CCCCCCCCC CCCC  CC C C       CCCCCC   
    49   97 L D  S    S-     0   0   59  892   74  QD DQQQQQQEQQEEEEQDQQEE LEFAQS  EQSSAAESS SQQQ  SQ D D       EQEEAQ   
    50   98 L Q  S    S+     0   0    2  892   63  HQ QHHHHHHQHHHHHHHHHHHQ HHHsQQ  HHQQHHHQQ QHHH  HH h H       HHQQHH   
    51   99 L F  E     -U   62   0I   4  892   80  FY YFFFFFFYFFFFFFFFFFFF YFYtYF  FFFFYYFFF FFFF  FF a F       FFFFYF   
    52  100 L d  E     +U   61   0I  10  893    1  CC CCCCCCCCCCCCCCCCCCCC CCCCCC  CCCCCCCCC CCCC  CC A C       CCCCCC   
    53  101 L H  E     -U   60   0I  68  893   87  LL RYLLLHLSLLHHHKNDLNHV SESVSK  NYKKTLNKK KYHH  TH A Y       TTSSTH   
    54  102 L E  E     -U   59   0I  92  893   68  PD DPPPPPPDPPEEEVSEPSED NEDDNP  EPPPEVEPP PPPP  QP A P       EIQQEP   
    55  103 L E  S    S-     0   0  100  893   82  Gn HeGGGGGRGGnnnVsDGsnS sNsGhg  vGggdeDgg ggGG  pG g g       QkdddG   
    56  104 L Q  S    S-     0   0  175  693   73  Qe v.QQQQQkQQaaaReaQeap pNpVeq  sR..k.a.. ieQQ  nQ r .       D.ddqQ   
    57  105 L N  S    S+     0   0  154  838   66  ET tnEEEEEdEErrrG.rE.qt kGsNT.  kNttqdrtt ..SS  tS R n       GgnnqE   
    58  106 L S  S    S-     0   0   58  853   65  SV KSSSSSSTSSRRRNSRSSRL KESTKS  YSSSQARSS SSSS  RS G S       WSQQQS   
    59  107 L V  E     -U   54   0I   7  890   79  YR RIYYYYYRYYGGGVHLYHGR VRVYRY  RYYYRRLFF YYYY  RY A Y       RYRRRY   
    60  108 L V  E     -U   53   0I  45  891   88  TQ TRTTTTTITTNNNRKATKNQ TFTTSE  YYEEYRNVV EHMM  VM V R       NHYYHT   
    61  109 L e  E     +U   52   0I   5  893    1  CC CCCCCCCCCCCCCCCCCCCC CCCCCC  CCCCCCCCC CCCC  CC C C       CCCCCC   
    62  110 L S  E     -U   51   0I  24  893   75  SH SSSSSSSRSSSSSSYSSYSF SSSVWS  SSSSMSSSS SSSS  SS S S       SSSSSS   
    63  111 L f        -     0   0   23  893    0  CC CCCCCCCCCCCCCCCCCCCC CCCCCC  CCCCCCCCC CCCC  CC C C       CCCCCC   
    64  112 L A    >   -     0   0    8  893   75  AE HAAAAAAHAAAAAAAAAAAA ATAAHA  AAAAAAAAA AAAA  AA A A       AVAAAA   
    65  113 L R  T 3  S+     0   0  149  893   80  QP EEQQQKQAQQDDDDEDQEDE EDDPKR  SDRRPPDQQ RKKK  TK P D       DTPPLK   
    66  114 L G  T 3  S+     0   0   24  893    8  GG DGGGGGGGGGGGGGGGGGGG GGGLGG  GGGGGDGGG GGGG  GG G G       GGGGGG   
    67  115 L Y  E <   -V   78   0J  20  893   11  YY YYYYYYYYYYYYYYYHYYYY YYYYYW  YYWWYYYWW WYYY  YY Y Y       YYYYYY   
    68  116 L T  E     -V   77   0J  72  891   85  RA VKRRRKRTRRDDDEKKRKDR EFVTTK  REKKKKSKK KEKK  KK H E       YRRRQK   
    69  117 L L  E     -V   76   0J  67  888   64  LL LLLLLLLLLLLLLLLLLLLL LLL LL  LLLLELLII LLLL  LL L L       LLQQEL   
    70  118 L A    >   -     0   0   23  889   78  GA QGGGGGGQGGDDDGADGADA EGE QE  SGSSEAGSS NGGG  DG A G       DHMMSG   
    71  119 L D  T 3  S+     0   0  175  889   77  EP PQEEEAEPEEVVVPATEAVS DTE Ae  GKrrDDDss TEKK  EK R K       NSDDDA   
    72  120 L N  T 3  S-     0   0   92  694   44  DD DDDDDDDDDDDDDDDDDDDD DDD De  NDttNDDdd DDDD  DD N D       GDDDND   
    73  121 L G  S <  S+     0   0   16  713   66  RG EKHHHGRQHHGGGDGGHGGQ GGG GR  HKRRPHGRR KKQQ  HQ R E       GGPPPG   
    74  122 L K  S    S+     0   0   71  687   76  KV VKKKKKKVKKLLLKRRKRLV KQK MV  TKDDMLQTT KKKK  HK R K       QRCCMK   
    75  123 L A        -     0   0   22  685   66  QS SSQQQSQSQRSSSSQSQQSS SAS SK  SQKKEQSKK QSSS  TS S Q       KSKKES   
    76  124 L f  E     -V   69   0J  12  847    9  CC CCCCCCCCCCCCCCCCCCCC CCC CC  CCCCCCCCC CCCC  CC C C       CCCCCC   
    77  125 L I  E     -V   68   0J  78  846   80  VN KIVVVVVMVVKKKQVIVVKI RLK AI  EIEEKEVVV VIGG  QG M I       RIQQDV   
    78  126 L P  E     -V   67   0J  62  850   71  PP PPPPPPPPPPAAASASPAAA ETV PP  PpPPPPAPP PPPP  PP A a       sPPPPP   
    79  127 L T  S    S+     0   0  103  652   80  HV KLHHHNHTHHKKKNEKHEKE TQT AA  D.AA.VKTT QRSS  VS T .       eETT.N   
    80  128 L G  S    S-     0   0   32  788   69  DV VDDDDEDVDDEEEEVADVEV AEA VV  V.VVvVEGG VDDD  VD g .       VDVVid   
    81  129 L P  S    S+     0   0  116  601   75  QD EKQQQKQEQQSSSTEPQESD QTQ ET  EqPPnIPRR EQKK  EK a a       .PTTne   
    82  130 L Y  S    S+     0   0   59  794   86  CY YCCCCCCYCCVVVFFICFVY FFF YF  FCYYFFIFF YCCC  FC F C       FHFFFE   
    83  131 L P    >   -     0   0   17  799   62  AP PAAAAAAPAAAAARPAAPAP PPP PP  PAPPPPAPP PAAA  PA P A       PRPPPK   
    84  132 L g  T 3  S+     0   0   16  800    5  CC CCCCCCCCCCCCCCCCCCCC CCC CC  CCCCCCCCC CCCC  CC C C       CCCCCC   
    85  133 L G  T 3  S+     0   0    0  712   37  GG GGGGGGGGGGGGGGGGGGGG GGG GG  GGGGGGGGG GGGG  GG G G       GGGGGA   
    86  134 L K    <   -     0   0   69  588   68  VR RRVVV VKMVMMMGRTVRMK KKK KK  RRKKKRMKK KRAA  KA R R       KTRRK    
    87  135 L Q        -     0   0   37  477   65  LI ILLLL LILLVVVILVLLVI  V  IV  VLVVPIVVV V LL  SL   L       VISSP    
    88  136 L T        +     0   0    4  428   78  TP P TTT TPTT   IPPTP P  P  P   V   KQPTT   TT  KT           PSVVK    
    89  137 L L        +     0   0  105  372   61  SV V SSS SVSS   T VS  V  L  V   E   VMV     SS  IS           LLVVV    
    90  138 L E              0   0  104  274   69  E    EEE E EE   E  E            K   SQ      EE   E            KNNN    
    91  139 L R              0   0  231  199   47  K    KKK K KK   N  K            K           HH   H            K       
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2    I                    I      II         V    II    I II    I      III
    94   17 C V  B     -A  271   0A   7  590    9    V                    V      VV         V    VV    V VV    V      VVV
    95   18 C G  S    S+     0   0   25  591    6    G                    G      GG         G    GG    G GG    G      GGG
    96   19 C G  S    S-     0   0   26  592    0    G                    G      GG         G    GG    G GG    G      GGG
    97   20 C Q  E     -B  237   0B  98  593   95    Y                    R      YY         Y    SS    Q KT    S      YSS
    98   21 C E  E     -B  236   0B  80  594   67    E                    V      EE         L    AA    A VA    T      ETT
    99   22 C h        -     0   0    8  594   58    C                    C      CC         E    VV    A CA    T      CTT
   100   23 C K    >   -     0   0  123  593   78    Q                    P      QQ         E    AA    D PK    T      TTT
   101   24 C D  T 3  S+     0   0   60  594   85    P                    K      PP         Q    SS    K KH    I      PII
   102   25 C G  T 3  S+     0   0    0  595   74    N                    G      NN         G    GG    G GG    Q      HQQ
   103   26 C E  S <  S+     0   0   36  595   66    S                    E      SS         G    EE    E ED    N      SNN
   104   27 C h    >   +     0   0    4  595   92    Q                    C      QQ         S    AA    Y CW    Y      QYY
   105   28 C P  T 3   +     0   0    0  599    9    P                    P      PP         P    TT    P PP    P      PPP
   106   29 C W  T 3  S+     0   0    5  600   26    W                    W      WW         W    YY    W WW    Y      WYY
   107   30 C Q  E <   -J  122   0C   7  601   26    Q                    Q      QQ         q    QQ    q QQ    Q      QQQ
   108   31 C A  E     -JK 121 146C   1  593   49    A                    A      AA         v    VV    t VA    V      VVV
   109   32 C L  E     -JK 120 145C   3  598   68    S                    I      SS         L    SS    S LQ    S      SSS
   110   33 C L  E     -JK 119 144C   0  601    9    L                    L      LL         L    LL    W LL  MML      LLL
   111   34 C I  E     -JK 117 143C   0  601   81    N                    T      NN         R    QQ    S LR  FFQ      NQQ
   112   35 C N  E >   - K   0 142C  30  601   88    S                    V      SS         R    RR    G VT  RRY      SYY
   113   36 C E  T 3  S+     0   0   63  117   78    .                    .      ..         A    ..    . .T  ...      ...
   114   37 C E  T 3  S-     0   0  136  242   77    .                    D      ..         D    ..    . NS  ..G      .GG
   115   38 C N  S <  S+     0   0   84  565   53    G                    G      GG         G    SS    A GG  ..G      GGG
   116   39 C E        -     0   0  100  589   94    Y                    A      YY         S    SS    F AF  ..S      YSS
   117   40 C G  E     +J  111   0C  14  600   57    H                    L      HH         G    HH    H QP  ..H      HHH
   118   41 C F  E     +     0   0C  28  611   33    F                    L      FF         F    FF  L F LYffffI      FII
   119   42 C i  E     -J  110   0C   0  612    1    C                    C      CC         C    CC  C C CCccccC      CCC
   120   43 C G  E     -J  109   0C   1  612    1    G                    G      GG         G    GG  G G GGGGSSG      GGG
   121   44 C G  E     -J  108   0C   0  612    9    G                    G      GG         G    GG  A G GGGGGGG      GGG
   122   45 C T  E     -JL 107 130C   0  612   45    S                    T      SS         T    TT  S A TSSSSSS      SSS
   123   46 C I  E     + L   0 129C   0  612   23    L                    L      LL         L    II  L I LLLLLLI      LII
   124   47 C L        -     0   0    6  612   27    V                    L      VV         I    II  I I IILLLLI      VII
   125   48 C S  S    S-     0   0   22  612   56    S                    D      SS         S    DD  S D NATTNTS      SSS
   126   49 C E  S    S+     0   0   99  612   63    E                    A      EE         D    DD  D E TPKKSGA      EAA
   127   50 C F  S    S+     0   0   42  612   83    Y                    A      YY         Q    YY  R R IQDDRRN      YNN
   128   51 C Y  E     - M   0 185C   7  612   34    W                    W      WW         W    WW  W T WWYYWWY      WYY
   129   52 C I  E     -LM 123 184C   0  612   14    V                    V      VV         V    VV  I I VIVVVVV      VVV
   130   53 C L  E     +LM 122 183C   0  612   27    V                    V      VV         V    LL  L V VLLLIIL      VLL
   131   54 C T  E     - M   0 182C   0  612   43    S                    S      SS         S    TT  T T STTSTTT      STT
   132   55 C A    >>  -     0   0    0  613    2    A                    A      AA         A    AA  A A AAAAAAA      AAA
   133   56 C A  G >4 S+     0   0    0  613    9    A                    A      AA         A    AA  A A ATAAAAA      AAA
   134   57 C H  G >4 S+     0   0    7  613    0    H                    H      HH         H    HH  H H HHHHHHH      HHH
   135   58 C i  G X4 S+     0   0    0  613    1    C                    C      CC         C    CC  C C CCCCCCC      CCC
   136   59 C L  G << S+     0   0   31  613   66    Y                    F      YY         M    VV  I V FVVVIII      YII
   137   60 C Y  G <  S+     0   0  109  613   87    K                    K      KK         Q    SS  F E DEKKRRI      KII
   138   61 C Q  S <  S+     0   0   95  613   78    S                    t      SS         g    gg  y g krkkeeg      Sgg
   139   61AC A        -     0   0   16  373   75    .                    w      ..         v    aa  a a warrkka      .aa
   140   62 C K  S    S-     0   0  172  387   77    .                    R      ..         D    SS  D S RSSSDDS      .SS
   141   63 C R  S    S-     0   0  162  602   78    R                    N      RR         H    QQ  D S NSKKDDQ      RQQ
   142   64 C F  E     -K  112   0C  36  609   54    L                    L      LV         V    LL  L V LIIIFFH      VHH
   143   65 C K  E     -K  111   0C  67  609   79    E                    T      EE         T    KK  V K IVRRIIR      ERR
   144   66 C V  E     -KN 110 161C   0  609   16    V                    V      VV         V    VV  V V AIIIVVV      VVV
   145   67 C R  E     -KN 109 160C  40  609   55    R                    V      RR         G    RR  R V VRIIRRR      RRR
   146   68 C V  E     +KN 108 159C   1  610   43    L                    L      LL         R    YY  I A LLFFLLV      LVV
   147   69 C G  S    S+     0   0    9  610   15    G                    G      GG         D    NN  G G GGGGGGG      GGG
   148   70 C D        +     0   0   11  611   58    E                    E      EE         Y    TT  K E EADDRRS      ESS
   149   71 C R  S    S+     0   0   24  611   73    H                    H      HH         D    VL  H H HRHHHHT      HTT
   150   72 C N  B >   -P  234   0D  18  611   65    N                    D      NN         K    RR  N R DRDDTTN      NNN
   151   73 C T  T 3  S+     0   0   56  611   80    I                    L      II         L    HH  R L LRQQTTS      ISS
   152   74 C E  T 3  S-     0   0  119  611   84    V                    R      VV         R    NN  R N SVEENEN      VNN
   153   75 C Q  S <  S-     0   0  130  610   85    I                    E      II         A    SS  I Y EAIIRRS      LSS
   154   76 C E        +     0   0  165  610   85    N                    Q      NN         E    GG  H N HTttVgG      NGG
   155   77 C E        -     0   0   93  469   27    E                    E      EE         P    ..  E E DVeeEe.      E..
   156   78 C G  S    S+     0   0   46  578   34    G                    G      GG         G    GG  K G GGSSQQG      GGG
   157   79 C G  S    S+     0   0   47  585   75    T                    E      TT         E    SS  t T DTHQTTT      STT
   158   80 C E        -     0   0   37  472   30    E                    E      EE         .    ..  e E EEAAEE.      E..
   159   81 C A  E     -N  146   0C  27  487   57    Q                    Q      QQ         Q    ..  K Q QKIISR.      Q..
   160   82 C V  E     -N  145   0C  71  590   83    F                    E      FF         Q    LL  I T SDQQSSI      FII
   161   83 C H  E     -N  144   0C  14  599   76    I                    R      II         I    II  A V RYRRYYY      IYY
   162   84 C E        -     0   0   90  602   78    T                    R      TT         Q    SS  L S RIAAMMQ      SQQ
   163   85 C V  E     -O  186   0C  27  607   64    S                    V      SS         V    VV  L V VVVVVVV      SVV
   164   86 C E  E    S+     0   0C  70  608   73    E                    A      EE         Q    SS  D S ATTTEEA      EAA
   165   87 C V  E     -O  185   0C  13  609   72    K                    R      KK         K    EE  K R QKSAEEQ      KQQ
   166   88 C V  E     -O  184   0C  72  610   46    V                    V      VV         V    VV  I I VVVVIIT      VTT
   167   89 C I  E     +O  183   0C  27  610   43    I                    F      II         L    II  I I IIIIVII      III
   168   90 C K  E     -O  182   0C  68  610   82    R                    I      RR         V    AA  I S ITKKLVV      RVV
   169   91 C H    >   -     0   0   19  611   13    N                    P      NN         H    HH  H H PHHHHHH      HHH
   170   92 C N  T 3  S+     0   0  156  611   61    P                    D      PP         P    SS  P R SPKKPPA      PGG
   171   93 C R  T 3  S+     0   0  150  608   73    N                    K      NN         H    GG  K Y TSSSDDS      NSS
   172   94 C F    <   -     0   0   24  611    5    Y                    Y      YY         F    YY  Y F YYFFFFY      YYY
   173   95 C T     >  -     0   0   56  611   68    D                    V      DD         H    SS  n D VhDDNNS      NSS
   174   96 C K  T  4 S+     0   0  145  561   78    S                    P      SS         A    SS  k S PpPPGGS      SSS
   175   97 C E  T  4 S+     0   0  174  569   91    W                    G      WW         F    WW  E Q GKDDDNR      WRR
   176   98 C T  T  4 S-     0   0   44  598   57    T                    K      TD         T    TT  N A TTTTTTT      TTT
   177   99 C Y    ><  +     0   0   60  604   65    I                    T      IL         F    LL  L L TYYYYYM      IMM
   178  100 C D  T 3   +     0   0   25  609   37    D                    N      DD         D    DD  D I NSNNEED      DDD
   179  101 C F  T 3  S+     0   0   21  595   66    S                    H      SS         S    NN  R N HHNNSSY      SYY
   180  102 C D    <   +     0   0    1  609    0    D                    D      DD         D    DD  D D DDDDDDD      DDD
   181  103 C I        +     0   0    0  611   13    I                    I      II         V    II  I I IIVIIIV      IVV
   182  104 C A  E     -MO 131 168C   0  611   60    M                    A      MM         A    AA  A A AAAAAAA      MAA
   183  105 C V  E     -MO 130 167C   0  612   16    L                    L      LL         L    LL  L I LLLLLLL      LLL
   184  106 C L  E     -MO 129 166C   0  613   30    I                    L      II         L    LL  L L LLLLLLL      ILL
   185  107 C R  E     -MO 128 165C  40  613   43    K                    Q      KK         R    KK  R K RKRRKKR      KRR
   186  108 C L  E     - O   0 163C   0  613   16    L                    L      LL         L    TT  L L LLLLLLT      LTT
   187  109 C K  S    S+     0   0  101  613   69    S                    N      SS         A    SS  R S HDRRSSS      SSS
   188  110 C T  S    S-     0   0   82  614   74    K                    R      KK         R    SS  K T QKKKGGT      KTT
   189  111 C P        -     0   0   48  614   39    P                    P      PP         P    PP  P P PPPPppA      PAA
   190  112 C I        -     0   0    4  562   63    A                    V      AA         V    ..  V L VVIIvvI      A..
   191  113 C T        -     0   0   95  566   73    T                    T      TT         L    ..  P K VLAATTS      T..
   192  114 C F        +     0   0   56  612   34    L                    F      LL         R    MM  F F LYFFFFG      LII
   193  115 C R  B >   -Q  196   0E  52  613   63    N                    T      NN         G    TT  S d TTSSTTS      Nss
   194  116 C M  T 3  S+     0   0   29  594   77    K                    D      KK         P    ..  D k DKKKEES      Qss
   195  117 C N  T 3  S+     0   0   13  602   90    Y                    H      YY         T    GG  Y N HNIIHYS      YSS
   196  118 C V  B <   +Q  193   0E   0  604   27    V                    V      VV         A    II  I V VIIIIIV      VVV
   197  119 C A        -     0   0    1  606   80    Q                    V      QQ         A    KK  Q A VHKKLLA      QAA
   198  120 C P        -     0   0    8  608   54    P                    P      PP         P    KK  P P PPPPPPT      PTT
   199  121 C A        -     0   0    2  609   39    V                    L      VV         A    AA  V V LVIVIII      VIN
   200  122 C g  B     -c  290   0B   1  610   66    A                    C      AA         C    DD  C C CCCCCCG      AGG
   201  123 C L        -     0   0   27  612    5    L                    L      LL         L    LL  L L LLLLLLL      LLL
   202  124 C P        -     0   0    7  613   30    P                    P      PP         P    PP  P P PPPPPPE      PEE
   203  124AC E     >  -     0   0   92  612   75    N                    E      .N         D    VV  T T EERREES      SSS
   204  125 C R  H  > S+     0   0  109  612   78    G                    K      .G         P    SS  K K RLYYVVG      GGG
   205  126 C D  H  > S+     0   0  124  612   85    C                    S      .C         H    GG  E K TDNNLLV      CVV
   206  127 C W  H  >>S+     0   0    4  612   88    A                    F      .A         L    SS  T Q FPYYDDV      AVV
   207  128 C A  I  X>S+     0   0    0  612   75    A                    S      .A         S    DD  V E SEDDAAS      ASS
   208  129 C E  I  <5S+     0   0   75  613   82    D                    E      ND         K    VV  Q H EPPPRRV      DVV
   209  130 C S  I  <5S+     0   0   70  614   66    G                    R      GG         Y    SS  S T RVAARRG      GGG
   210  131 C T  I  <5S+     0   0   18  108   73    .                    T      C.         L    ..  L . T...LL.      T..
   211  131AC L  I ><  S-     0   0  119  503   80    M                    L      MM         R    TT  S R LSSSGQS      .ss
   227  146 C E  T 3  S+     0   0   47  527   75    S                    H      SS         H    EE  S E DSEEDEE      .EE
   228  147 C K  T 3  S+     0   0  169  548   68    S                    R      SS         L    GG  T G RGGGGGG      .GG
   229  149 C G  S <  S-     0   0   29  559   66    T                    G      TT         G    GG  P G GGGGEGG      TGG
   230  150 C R        -     0   0  213  584   86    A                    A      AA         R    SS  A S ASEEPPS      ASS
   231  151 C Q  B     -R  224   0F  79  599   93    D                    T      DD         S    LL  L M TTLLHYA      DAA
   232  152 C S        -     0   0   14  607   51    S                    A      SS         S    AA  P P APPPSSS      SSS
   233  153 C T  S    S+     0   0   48  608   73    N                    V      NN         R    SS  T S LDSSTTT      NTT
   234  154 C R  B    S-P  150   0D 102  608   85    K                    Q      KK         F    SS  Y I EYIITTT      KTT
   235  155 C L        -     0   0    3  610    3    L                    L      LL         L    LL  L L LLVVLLL      LLL
   236  156 C K  E     -BD  98 221B  31  610   51    Q                    M      QQ         R    QQ  Q Q MQNNMMR      QRR
   237  157 C M  E     -BD  97 220B  18  611   94    C                    A      CC         R    KK  L E VQQQQKQ      CQQ
   238  158 C L  E     - D   0 219B   4  612   44    L                    I      LL         V    VV  V V LVVVVVV      VVV
   239  159 C E  E     - D   0 218B 107  612   72    E                    D      EE         T    SS  N A NSKKNSI      EII
   240  160 C V  E     - D   0 217B   0  612   46    I                    V      II         L    VV  L V VVVVLLV      VVV
   241  161 C P  E     - D   0 216B  34  612   28    P                    P      PP         P    PP  P P PPPPPPP      PPP
   242  162 C Y  E     -F  263   0B  36  613   46    I                    R      II         V    VV  I V RIIIVLI      III
   243  163 C V  E     -F  262   0B  24  614   37    L                    V      LL         V    VV  V V LRMMVVV      LVV
   244  164 C D     >  -     0   0   88  613   57    S                    M      SS         S    DD  D T MSSSSSS      SSS
   245  165 C R  H  > S+     0   0   51  613   78    D                    T      DD         F    RR  R D TRIILLD      EDD
   246  166 C N  H  > S+     0   0  105  614   74    R                    Q      RR         E    AA  D S QATTRGA      RAA
   247  167 C S  H  > S+     0   0   48  614   78    D                    D      DD         D    QQ  T K DREERRS      DSS
   248  168 C j  H  X S+     0   0    1  614    2    C                    C      CC         C    CC  C C CCCCCCC      CCC
   249  169 C K  H >< S+     0   0   88  614   73    K                    q      KN         r    NN  K r lDrrrrn      Nnn
   250  170 C L  H 3< S+     0   0  150  574   89    N                    w      NN         v    SS  A v vSkkppy      Nyy
   251  171 C S  H 3< S+     0   0   23  604   76    S                    E      SS         P    SS  S Y GSYYQQA      SAA
   252  172 C S    <<  -     0   0   20  607   83    Y                    G      YY         P    YY  T G DYKKYYS      YSS
   253  173 C S  S    S+     0   0   79  607   83    P                    S      PP         H    SS  K Y SPSSAAY      PYY
   254  174 C F  S    S-     0   0  124  607   79    G                    P      GG         A    GG  I S PNTTKGG      GGG
   255  175 C I        -     0   0  100  608   87    M                    T      MM         V    DD  K A NKRRDDG      MGG
   256  176 C I        -     0   0   13  609   18    I                    V      II         I    II  I I IIIIIII      III
   257  177 C T    >   -     0   0   16  614   35    T                    T      TT         T    TT  T P THTTSST      TTT
   258  178 C Q  T 3  S+     0   0  133  614   68    D                    E      DD         D    PP  D A EDSTKKA      NAA
   259  179 C N  T 3  S+     0   0   24  614   60    T                    N      TT         N    NN  N N YSSTNNR      TRR
   260  180 C M  E <   - G   0 311B   2  614   13    M                    M      MM         M    MM  M V MMMMMMM      MMM
   261  181 C F  E     - G   0 310B   8  613   35    F                    F      FF         F    FF  F M FILLFFI      FII
   262  182 C j  E     +FG 243 309B   1  614    1    C                    C      CC         C    CC  C C CCCCCCC      CCC
   263  183 C A  E     +FG 242 308B   0  614   26    A                    A      AA         A    AA  A A AAAAAAA      AAA
   264  184 C G  S    S-     0   0    3  614   10    G                    G      GG         G    GG  G G GGGGGGG      GGG
   265  185 C Y        -     0   0   56  591   57    Y                    Y      YY         Y    VV  Y Y YIRRRRY      YYY
   266  185AC D  S    S-     0   0   81  594   83    L                    L      LL         L    SS  S A SDPPRTT      LTT
   267  185BC T  S    S+     0   0   76  614   61    E                    D      EE         D    AA  p Q DKASTSS      ESS
   268  186 C K  S    S-     0   0  107  563   32    G                    G      GG         A    GG  k G GG..GGG      GGG
   269  187 C Q  S    S+     0   0  102  569   37    G                    S      GG         S    GG  R A SG..GGG      GGG
   270  188 C E        +     0   0   33  613   55    K                    K      KK         V    KK  G R KIMMRRR      KRR
   271  189 C D  B     -A   94   0A   7  614    4    D                    D      DD         D    DD  D D DDDDDDD      DDD
   272  190 C A        -     0   0    7  614   42    S                    A      SS         A    SS  A A SASSAAA      SAA
   273  191 C k    >   -     0   0    7  614    3    C                    C      CC         C    CC  C C CCCCCCC      CCC
   274  192 C Q  T 3  S+     0   0   90  614   25    Q                    Q      QQ         R    QQ  E Q KQQQEEQ      QQQ
   275  193 C G  T 3  S+     0   0    6  614    8    G                    G      GG         G    GG  G G GGGGGGG      GGG
   276  194 C D    X   +     0   0    0  614    0    D                    D      DD         D    DD  D D DDDDDDD      DDD
   277  195 C S  T 3  S+     0   0   14  614    1    S                    S      SS         S    SS  S S SSSSSSS      SSS
   278  196 C G  T 3  S+     0   0    0  614    0    G                    G      GG         G    GG  G G GGGGGGG      GGG
   279  197 C G    <   -     0   0    0  614    1    G                    G      GG         G    GG  G G GGGGGGG      GGG
   280  198 C P  E     - H   0 294B   1  614    2    P                    P      PP         P    PP  P P PPPPPPP      PPP
   281  199 C H  E     -EH 219 293B   0  614   49    V                    H      VV         F    VV  F L HMLLFFL      VLL
   282  200 C V  E     -EH 218 291B   3  614   26    V                    A      VV         V    VV  V V AVLLAAV      VVV
   283  201 C T  E     - H   0 290B   0  614   66    C                    T      CC         V    SS  M C TCLLAAA      CAA
   284  202 C R  E     + H   0 289B  99  614   70    N                    K      NN         N    GG  K E HESSDYN      NNN
   285  203 C F  E >  S- H   0 288B  22  614   71    G                    F      GG         Y    NN  n e YNNNNDG      GGG
   286  204 C K  T 3  S-     0   0   85  222   71    .                    Q      ..         R    ..  d n RGGGDN.      ...
   287  205 C D  T 3  S+     0   0  108  223   55    .                    G      ..         G    ..  N G GGVVGG.      ...
   288  206 C T  E <   - H   0 285B   3  233   75    .                    T      ..         T    ..  R Q TRKKRR.      ...
   289  207 C Y  E     - H   0 284B  21  242   51    .                    W      ..         W    ..  W F WFYYWW.      ...
   290  208 C F  E     -cH 200 283B   0  613   91    E                    Y      EE         F    TT  Y V YYFFVMR      QRR
   291  209 C V  E     + H   0 282B   1  613   38    L                    L      LL         L    VV  Q L LIIILLL      LLL
   292  210 C T  E     +     0   0B   1  613   84    Q                    T      QH         T    VV  V A THVVLLV      QVV
   293  211 C G  E     -IH 312 281B   0  613    0    G                    G      GG         G    GG  G G GGGGGGG      GGG
   294  212 C I  E     -IH 311 280B   0  613   19    I                    I      II         V    AA  I V IAIIIIV      IVV
   295  213 C V  E     +I  310   0B   7  613   14    V                    V      VV         V    VV  V V VTVVVVV      VVV
   296  214 C S  E     -     0   0B   1  612    0    S                    S      SS         S    SS  S S SSSSSSS      SSS
   297  215 C W  E     -I  309   0B  45  613    7    W                    W      WW         W    WW  W W WWWWWWW      WWW
   298  216 C G        -     0   0   26  613    0    G                    G      GG         G    GG  G G GGGGGGG      GGG
   299  217 C E  S    S-     0   0   25  609   90    Y                    E      YY         E    MM  E N QYVVDDV      YVV
   300  218 C G  S    S-     0   0   19  612   13    G                    G      GG         G    GG  G G GGGGGGG      GGG
   301  220 C k  S    S-     0   0    7  613    2    C                    C      CC         C    CC  C C CCCCCCC      CCC
   302  221 C A  S    S+     0   0    4  612   16    A                    A      AA         A    AA  D A AAGGAAA      AAA
   303  222 C R    >   -     0   0  105  611   73    Q                    A      QE         A    RR  R R TARRQLR      ERR
   304  223 C K  T 3  S+     0   0  152  611   64    K                    E      KK         E    PP  D P VPEEPQP      KPP
   305  223AC G  T 3  S+     0   0   26  613   58    D                    D      DN         G    NN  G G GGGGGGN      NNI
   306  224 C K    <   -     0   0   43  613   85    N                    H      NH         K    YY  K Y HLYYKKF      HFF
   307  225 C Y        -     0   0   33  613   50    P                    F      PP         F    PP  Y Y FYPPYYP      PPP
   308  226 C G  E     -G  263   0B   4  611    2    G                    G      GG         G    GG  G G GGGGGGG      GGG
   309  227 C I  E     -GI 262 297B   6  612   11    V                    V      VV         V    VV  F I VVVVVVV      VVV
   310  228 C Y  E     -GI 261 295B   1  612    1    Y                    Y      YY         Y    YY  Y Y YYYYYYY      YYY
   311  229 C T  E     -GI 260 294B   2  612   39    G                    T      GG         T    TT  T T TATTTTA      GAA
   312  230 C K  E >   - I   0 293B  21  612   42    K                    R      KK         R    RR  H Q RKRRRRK      KKK
   313  231 C V  G >  S+     0   0    1  611    8    V                    V      VV         L    VV  V V VVVVVVV      VVV
   314  232 C T  G 3  S+     0   0    2  609   71    C                    S      CC         G    GG  F S SKSSHHS      CSS
   315  233 C A  G <  S+     0   0   29  609   79    M                    R      MM         N    NN  R H QYKKYRA      MAA
   316  234 C F  S <> S+     0   0    7  605   35    F                    Y      FF         F    FF  L F YLFFFFV      FVV
   317  235 C L  H  > S+     0   0   23  603   80    S                    I      SS         L    RR  K L ILIIRRR      SRR
   318  236 C K  H  > S+     0   0  116  602   68    Q                    E      QQ         N    EE  K S EPPPDES      QSS
   319  237 C W  H  > S+     0   0   26  602    1    W                    W      WW         W    WW  W W WWWWWWW      WWW
   320  238 C I  H  X S+     0   0    1  599   12    I                    L      II         I    II  L I LIIIIII      III
   321  239 C D  H  < S+     0   0   66  570   71    A                    R      AA         T    KK  K Q QKKKV Q      AQQ
   322  240 C R  H >< S+     0   0  136  556   71    D                    R      DD         S    TT  K Q KDSST S      DSS
   323  241 C S  H >< S+     0   0    6  523   72    T                    L      TT         T    NN  T N LENNN N      TNN
   324  242 C M  T 3< S+     0   0   25  479   41    M                    M      MM         V        V   MMLLI        M  
   325  243 C K  T <  S+     0   0  153  444   70    R                    N      RR         S        E   RAED         K  
   326  244 C T    <         0   0   51  390   65    N                    T      NN                  K   SKNN         N  
   327  245 C R              0   0  197  273   47    N                    N      NN                  H   EN           N  
## ALIGNMENTS  421 -  490
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1   49 L Q              0   0  101  671   35           QHQQQ QQQQQQQQQQ QH QHH QK          Q   KKQ Q           R    
     2   50 L a    >   +     0   0   22  858    0           CCCCCCCCCCCCCCCCCCC CCCCCCCC      C C   CCC CC          C    
     3   51 L E  T 3  S+     0   0  187  858   80           ELKKKKAAAAAALEDSLAA KAANASIL      I A   SSA HI          S    
     4   52 L T  T 3  S-     0   0  105  864   61           QSLLLSEEEEEESSSSSSS LSSPSLSS      S Q   LLQ SS          S    
     5   53 L S    <   +     0   0   89  868   72           HFSSSNKKKKKKSNANSSS SSSNNNQN      Q K   NNK NQ          N    
     6   54 L P        +     0   0   10  878   31           LPPPPPPPPPPPPMPPPPP PPPPPPPP      P P   PPP MP          P    
     7   55 L b        -     0   0   18  893   21           CCCCCCCCCCCCCCCCCCC CCCCCCCC      C C   CCC CC          C    
     8   56 L Q  S    S+     0   0   92  892   83           SKKKKLKKKKKKKRQLQQE KEEQRKLQ      L S   KKS VL          Q    
     9   57 L N  S    S-     0   0   63  893   51           NNNNNNNNNNNNNHNYNNH NHHNNNNN      N N   NNN HN          H    
    10   58 L Q  S    S-     0   0  152  893   57           GGGGGGGGGGGGGGGNGGD GDDNGQNG      N G   QQG GN          N    
    11   59 L G        -     0   0   16  893   40           IGAAAGAAAAAAADGGAGG AGGGGGGG      G A   GGA AG          G    
    12   60 L K  E     -S   23   0G 117  852   79           CTTTTSMMMMMMTCTKTSL TLLDSSTT      T C   SSC CT          V    
    13   61 L a  E     -S   22   0G  45  882   10           KCCCCCCCCCCCCVCCCCC CCCCCCCC      C K   CCK VC          C    
    14   62 L K  E     -S   21   0G 155  890   81           DTTTTsSSSSSSTDVTTKt TttVEKKQ      K D   KKD DK          E    
    15   63 L X  E     +S   20   0G 120  768   39           .RRRReDDDDDDR.DDRDq RqqDDDDH      D .   DD. .D          D    
    16   64 L G        -     0   0   44  862   73           SHRRRGSSSSSSHMETHQN RNNGQTHT      H N   TTN .H          S    
    17   65 L L  S    S-     0   0  152  871   64           IFFFFSVVVVVVFFFILLA FAALLIIH      I I   III LI          I    
    18   66 L G  S    S+     0   0   67  883   63           GSEEESGGGGGGEQQRNQD EDDHGRRT      R G   RRG yR          R    
    19   67 L E        -     0   0  119  837   61           KNTTT.GGGGGGTEASTSS TSSDSSSV      S S   SSS dS          G    
    20   68 L Y  E     -S   15   0G  37  883   11           FYYYYYYYYYYYYYYYFYY YYYYYYFY      F Y   YYY YF          Y    
    21   69 L T  E     -S   14   0G  71  886   82           SVAAATDDDDDDAAVRTIM AMMTIISM      S S   IIS AS          T    
    22   70 L b  E     -S   13   0G  20  889    0           CCCCCCCCCCCCCCCCCCC CCCCCCCC      C C   CCC CC          C    
    23   71 L T  E     -S   12   0G  85  890   86           IKKKKFVVVVVVKRLDKFL KLLIFSTV      T I   SSI RT          T    
    24   72 L c        -     0   0   44  890    0           CCCCCCCCCCCCCCCCCCC CCCCCCCC      C C   CCC CC          C    
    25   73 L L    >   -     0   0   62  890   88           NAAAALKKKKKKAHPPALA AAASPPAP      A D   PPD NA          A    
    26   74 L E  T 3  S+     0   0  177  890   75           KPNNNPSSSSSSHSEEAPP NPPKDEPR      P K   EEK HP          E    
    27   75 L G  T 3  S+     0   0   29  893   20           GGGGGEGGGGGGGGEGGAG GGGGSGGG      G G   GGG GG          G    
    28   76 L F  E <   +T   36   0H  40  893    9           WFFFFFFFFFFFFYYYFFF FFFHFYYW      Y W   YYW YY          Y    
    29   77 L E  E     +T   35   0H  74  893   73           EHHHHSTTTTTTHEKEHKS HSSGQTEE      E E   TTE EE          E    
    30   78 L G  S >  S-     0   0   32  889    5           GGGGGGGGGGGGGGGGGGG GGGGGGGG      G G   GGG GG          G    
    31   79 L K  T 3  S+     0   0  156  891   73           VTHHHRVVVVVVHKKKSRR HRRKRRKR      K A   RRA KK          E    
    32   80 L N  T 3  S-     0   0   33  892   62           LHNNNEHHHHHHNYNNKNH NHHNNDTV      T Q   DDQ YT          N    
    33   81 L c  S <  S+     0   0    1  892    3           CCCCCYCCCCCCCCCCCCC CCCCCCCC      C C   CCC CC          C    
    34   82 L E        +     0   0   87  891   44           SEDDDQEEEEEEDEEEDEE DEEQEQAS      A N   QQN DA          A    
    35   83 L L  E    S-T   29   0H  96  889   88           YKKKKTKKKKKKKYRFKTQ KQQHTFMQ      M Y   FFY QM          F    
    36   84 L F  E     -T   28   0H 139  889   83           EavveVaaaaaavPGAvYs vssENaAE      A E   aaE PA          A    
    37   85 L T        -     0   0   44  677   75           vlllqPpppppplilSt.g lgg...Kv      K v   ..v qK          K    
    38   86 L R        +     0   0   57  408   92           ysssp.ttttttsatNs.p spl..nNg      N y   nny aN          N    
    39   87 L K        +     0   0   96  535   81           SNNNDDLLLLLLNTLET.D NDDK.EEQ      E N   EEN TE          E    
    40   88 L L        -     0   0   91  608   90           NGGGTTCCCCCCGNKCR.S GSSR.CCS      C N   CCN NC          C    
    41   89 L d  S  > S+     0   0   15  617   29           CCCCCCVVVVVVCCCHC.C CCCQ.HHC      H C   HHC CH          H    
    42   90 L S  T  4 S+     0   0   98  624   84           SRRRLLVVVVVVRSIPRKL RLLCKPLK      L S   PPS SL          H    
    43   91 L L  T >4 S-     0   0  120  627   87           MYYYLLDDDDDDYVNQYDH YHHIKDEV      E V   DDV LE          Q    
    44   92 L D  G >4 S-     0   0  107  638   73           DRRREESSSSSSRDEMRDD RDDGDMRN      R D   MMD DR          A    
    45   93 L N  G >< S-     0   0    8  700   56           NNNNNNDDDDDDNNNTNQN NNNFLETN      T N   EEN NT          K    
    46   94 L G  G <  S-     0   0    0  882   52           GGGGGGKKKKKKGGGDGLG GGGDLDDG      D G   DDG GD          V    
    47   95 L D  G <  S+     0   0   44  887   62           GGGGGGGGGGGGGGHGGIG GGGRVGGR      G G   GGG GG          G    
    48   96 L e    <   -     0   0    0  892    0           CCCCCCCCCCCCCCCCCCC CCCCCCCC      C C   CCC CC          C    
    49   97 L D  S    S-     0   0   59  892   74           EEEEEESSSSSSEDEQEVE EEEKVQQD      Q Q   QQQ DQ          D    
    50   98 L Q  S    S+     0   0    2  892   63           HHHHHHQQQQQQHHHHHnH HHHnnHHH      H H   HHH HH          H    
    51   99 L F  E     -U   62   0I   4  892   80           FFFFFFFFFFFFFDYYFyF FFFryFFY      F F   FFF DF          F    
    52  100 L d  E     +U   61   0I  10  893    1           CCCCCCCCCCCCCCCCCCC CCCCCCCC      C C   CCC CC          C    
    53  101 L H  E     -U   60   0I  68  893   87           RTRRHHKKKKKKRTRTRST RTTMSHHE      H K   HHK WH          Y    
    54  102 L E  E     -U   59   0I  92  893   68           EEEEEEPPPPPPEKDPEDE EEEEDPPE      P E   PPE EP          P    
    55  103 L E  S    S-     0   0  100  893   82           elffnnggggggfsSgnHQ fQQEhsGe      G d   ssd gG          g    
    56  104 L Q  S    S-     0   0  175  693   73           edddaa......ddpqdtD dNDIeeQa      Q a   eea dQ          .    
    57  105 L N  S    S+     0   0  154  838   66           QRRRrrttttttRlt.RaG RGGNGdSg      S q   ddq lS          d    
    58  106 L S  S    S-     0   0   58  853   65           HSSSRRSSSSSSSSINSKR SRRDGSSg      S C   SSC TS          S    
    59  107 L V  E     -U   54   0I   7  890   79           RPYYGGFFFFFFYRRYRRR YRRFRYYA      Y R   YYR RY          Y    
    60  108 L V  E     -U   53   0I  45  891   88           LSVVNNVVVVVVVIQKFSN VNNSSSMV      M Y   SSY SM          R    
    61  109 L e  E     +U   52   0I   5  893    1           CCCCCCCCCCCCCCCCCCC CCCCCCCC      C C   CCC CC          C    
    62  110 L S  E     -U   51   0I  24  893   75           SSFFSSSSSSSSFSFSFQS FSSKRSSS      S S   SSS SS          S    
    63  111 L f        -     0   0   23  893    0           CCCCCCCCCCCCCCCCCCC CCCCCCCC      C C   CCC CC          C    
    64  112 L A    >   -     0   0    8  893   75           AAAAAAAAAAAAAVAAAHA AAALHAAA      A A   AAA VA          A    
    65  113 L R  T 3  S+     0   0  149  893   80           SPPPDDQQQQQQPNEQPED PDDSENKP      K S   NNS AK          D    
    66  114 L G  T 3  S+     0   0   24  893    8           GGGGGGGGGGGGGGGGGGG GGGGGGGG      G G   GGG GG          G    
    67  115 L Y  E <   -V   78   0J  20  893   11           YYYYYYWWWWWWYYYYYYY YYYFYYYY      Y Y   YYY FY          Y    
    68  116 L T  E     -V   77   0J  72  891   85           QGRRDDKKKKKKGKMKGSY RYYCTKKH      K Q   KKQ KK          K    
    69  117 L L  E     -V   76   0J  67  888   64           LLLLLLIIIIIILLLLLLL LLLGLLLL      L L   LLL LL          L    
    70  118 L A    >   -     0   0   23  889   78           KDDDDDSSSSSSDAAGDLD DDDKQGGA      G T   GGT HG          G    
    71  119 L D  T 3  S+     0   0  175  889   77           DQKKVVssssssQNSKQAN KNNDDAER      E N   AAN TE          K    
    72  120 L N  T 3  S-     0   0   92  694   44           DDDDDDddddddDDDDDDG DGSCDDDN      D D   DDD DD          D    
    73  121 L G  S <  S+     0   0   16  713   66           HNNNGGRRRRRRNSEENGG NGGSGEHR      H H   EEH SH          K    
    74  122 L K  S    S+     0   0   71  687   76           TSSSLLTTTTTTSRVKSVQ SQQKVKRR      R N   KKN RR          R    
    75  123 L A        -     0   0   22  685   66           TTTTSSKKKKKKTKSSTSK TKKNSSSS      S M   SSM KS          R    
    76  124 L f  E     -V   69   0J  12  847    9           CCCCCCCCCCCCCCCCCCC CCCGCCCC      C C   CCC CC          C    
    77  125 L I  E     -V   68   0J  78  846   80           ELLLKKVVVVVVLVTFLTR LWRNAHSM      S T   HHA VS          I    
    78  126 L P  E     -V   67   0J  62  850   71           PPPPAAPPPPPPPPPPPPs PssSPPPA      P P   PPP PP          a    
    79  127 L T  S    S+     0   0  103  652   80           .KQQKKTTTTTTQKQ.KTe QeeCTESM      S V   EEV TS          .    
    80  128 L G  S    S-     0   0   32  788   69           VDEVEEGGGGGGVSViDVV VVVDVDDE      D V   gDV GD          .    
    81  129 L P  S    S+     0   0  116  601   75           .PSKSSRRRRRRRRDhPE. K..PEPKA      K E   pPE PK          a    
    82  130 L Y  S    S+     0   0   59  794   86           .VVVVVFFFFFFVSYYVYF VFFNYFCF      C F   FFF SC          C    
    83  131 L P    >   -     0   0   17  799   62           DVAPAAPPPPPPPSPTVPP PPPPPAAP      A P   AAP SA          A    
    84  132 L g  T 3  S+     0   0   16  800    5           CCCCCCCCCCCCCCCCCCC CCCCCCCC      C C   CCC CC          C    
    85  133 L G  T 3  S+     0   0    0  712   37            GGGGGGGGGGGGGGGGGG GGG GGGG      G G   GGG GG          G    
    86  134 L K    <   -     0   0   69  588   68            RMRMMKKKKKKRQRRRKK RKK  QAR      A R   QQR QA          R    
    87  135 L Q        -     0   0   37  477   65             VLVVVVVVVVPLILPIV LVV  ILV      L V   IIV LL          L    
    88  136 L T        +     0   0    4  428   78              Q  TTTTTTQ P LPP QPP   TA      T K     K LT               
    89  137 L L        +     0   0  105  372   61              I        I V VIL ILL   SS      S M     M IS               
    90  138 L E              0   0  104  274   69                           N         QP      Q D     D AQ               
    91  139 L R              0   0  231  199   47                                     HK      H         RH               
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2  IIIIIIIII                   I        III II I III   I  IIIIIIIIII IIII
    94   17 C V  B     -A  271   0A   7  590    9  VVVVVVVVV                   V        VVV IV V VVV   I  VVVVVVVVVV VVVV
    95   18 C G  S    S+     0   0   25  591    6  GGGGGGGGG                   G        GGG GG G GGG   G  GGGGGGGGGG GGGG
    96   19 C G  S    S-     0   0   26  592    0  GGGGGGGGG                   G        GGG GG G GGG   G  GGGGGGGGGG GGGG
    97   20 C Q  E     -B  237   0B  98  593   95  SSSSSSSSS                   Y        YYY SY R YQY   Y  YYSSSSSSSS FYYY
    98   21 C E  E     -B  236   0B  80  594   67  TTTTTTTTT                   E        EEE AE P ETT   N  TETTTTTTTT EEEE
    99   22 C h        -     0   0    8  594   58  TTTTTTTTT                   C        CCC AC T CTC   C  CCTTTTTTTT CCCC
   100   23 C K    >   -     0   0  123  593   78  TTTTTTTTT                   Q        TKK ST G QSP   P  ETTTTTTTTT QLLL
   101   24 C D  T 3  S+     0   0   60  594   85  IIIIIIIII                   P        PAP LP V PMK   R  KPIIIIIIII KKKK
   102   25 C G  T 3  S+     0   0    0  595   74  QQQQQQRQQ                   N        YYY GY N NNH   N  NHQQQQQQQQ NNNN
   103   26 C E  S <  S+     0   0   36  595   66  NNNNNNNNN                   S        SSS NS R SES   S  SSNNNNNNNN SSSS
   104   27 C h    >   +     0   0    4  595   92  YYYYYYYYY                   Q        QQQ FQ Y QFV   L  LQYYYYYYYY VVVV
   105   28 C P  T 3   +     0   0    0  599    9  PPPPPPPPP                   P        PPP PP P PPP   P  PPPPPPPPPP PPPP
   106   29 C W  T 3  S+     0   0    5  600   26  YYYYYYYYY                   W        WHHWWW W WWY   Y  YWYYYYYYYY YYYY
   107   30 C Q  E <   -J  122   0C   7  601   26  QQQQQQQQQ                   Q        TQQDQT L QmQ   Q  QQQQQQQQQQ QQQQ
   108   31 C A  E     -JK 121 146C   1  593   49  VVAVVVVVV                   A        VVV.AV A AsV   V  VVVVVVVVVV VAAA
   109   32 C L  E     -JK 120 145C   3  598   68  SSSSSSSSS                   S        SSS.RS R SYS   S  SSSSSSSSSS SSSS
   110   33 C L  E     -JK 119 144C   0  601    9  LLLLLLLLL                   L        LLLILL L LLL   L  LLLLLLLLLL LLLL
   111   34 C I  E     -JK 117 143C   0  601   81  QQQQQQQQQ                   N        NNNRDN V NNN   N  NNQQQQQQQQ FFFF
   112   35 C N  E >   - K   0 142C  30  601   88  YYYYYYYYY                   S        SSSPGS Y SKD   D  VSYYYYYYYY TTTT
   113   36 C E  T 3  S+     0   0   63  117   78  .........                   .        ...... . ...   .  .......... ....
   114   37 C E  T 3  S-     0   0  136  242   77  GGGGGGGGG                   .        ...G.. . ...   .  ..G.GGGGGG ....
   115   38 C N  S <  S+     0   0   84  565   53  GGGGGGGGG                   G        GGGR.G D G.G   G  GGGGGGGGGG GGGG
   116   39 C E        -     0   0  100  589   94  SSSSSSSSS                   Y        YYYN.Y G Y.I   T  YYSGSSSSSS YYYY
   117   40 C G  E     +J  111   0C  14  600   57  HHHHHHHHH                   H        HHHRPH Q H.S   G  HHHSHHHHHH NNNN
   118   41 C F  E     +     0   0C  28  611   33  IIIIIIIII                   F        FFFflF f Ffh   h  IFIlIIIIII YFFF
   119   42 C i  E     -J  110   0C   0  612    1  CCCCCCCCC                   C        CCCccC c Ccc   c  CCCcCCCCCC CCCC
   120   43 C G  E     -J  109   0C   1  612    1  GGGGGGGGG                   G        GGGGGG G GGG   G  GGGGGGGGGG GGGG
   121   44 C G  E     -J  108   0C   0  612    9  GGGGGGGGG                   G        GGGGGG A GGG   G  GGGGGGGGGG GGGG
   122   45 C T  E     -JL 107 130C   0  612   45  SSSSSSSSS                   S        SSSSTS S STS   S  SSSSSSSSSS TIII
   123   46 C I  E     + L   0 129C   0  612   23  IIIIIIIII                   L        LLLLLL L LLL   L  LLIIIIIIII LLLL
   124   47 C L        -     0   0    6  612   27  IIIIIIIII                   V        VVVLVV I VII   I  IVIIIIIIII LLLL
   125   48 C S  S    S-     0   0   22  612   56  SSSSSSSSS                   S        SNNTHS S SNN   S  NSSSSSSSSS SSSS
   126   49 C E  S    S+     0   0   99  612   63  AAAAAAAAA                   E        KEEAPE E EDD   D  KEAAAAAAAA EEEE
   127   50 C F  S    S+     0   0   42  612   83  NNNNDNNNN                   Y        DNNESY N YRQ   Q  EYNNNNNNNN QEEE
   128   51 C Y  E     - M   0 185C   7  612   34  YYYYYYYYY                   W        WWWWYW F WYW   W  WWYYYYYYYY WWWW
   129   52 C I  E     -LM 123 184C   0  612   14  VVVVVVVVV                   V        VVVVVV V VVV   V  VVVVVVVVVV VVVV
   130   53 C L  E     +LM 122 183C   0  612   27  LLLLLLLLL                   V        VVVVVV L VLL   L  LVLLLLLLLL LLLL
   131   54 C T  E     - M   0 182C   0  612   43  TTTTTTTTT                   S        SSSTTS T STS   S  SSTTTTTTTT SSSS
   132   55 C A    >>  -     0   0    0  613    2  AAAAAAAAA                   A        AAAAAA A AAA   A  AAAAAAAAAA AAAA
   133   56 C A  G >4 S+     0   0    0  613    9  AAAAAAAAA                   A        AAAAAA A AAA   A  AAAAAAAATA AAAA
   134   57 C H  G >4 S+     0   0    7  613    0  HHHHHHHHH                   H        HHHHHH H HHH   H  HHHHHHHHHH HHHH
   135   58 C i  G X4 S+     0   0    0  613    1  CCCCCCCCC                   C        CCCCCC C CCC   C  CCCCCCCCCC CCCC
   136   59 C L  G << S+     0   0   31  613   66  IIIVIIIII                   Y        YYYIFY V YMY   Y  YYIIIIIIII EKKK
   137   60 C Y  G <  S+     0   0  109  613   87  IIIIIIIII                   K        KKKLFK R KKK   K  HKIIIIIIII PAAA
   138   61 C Q  S <  S+     0   0   95  613   78  ggggggggg                   S        SSSeyS r SgR   G  YSgggggggg KDDD
   139   61AC A        -     0   0   16  373   75  aaaaaaaaa                   .        ...kp. r .w.   .  ..aaaaaaaa ....
   140   62 C K  S    S-     0   0  172  387   77  SSSSSSSSS                   .        ...DG. S .F.   R  Q.SSSSSSSS S...
   141   63 C R  S    S-     0   0  162  602   78  QQQQQQQQQ                   R        RRRDHR K RMR   K  RRQQQQQQQQ N...
   142   64 C F  E     -K  112   0C  36  609   54  HHHHHHHHH                   V        VVVFWV I VIL   L  FVHHHHHHHH LLLL
   143   65 C K  E     -K  111   0C  67  609   79  RRRRRRRRR                   E        EEEITE R ERQ   Q  QERRRRRRRR EEEE
   144   66 C V  E     -KN 110 161C   0  609   16  VVVVVVVVV                   V        VVVIIV I VVV   V  VVVVVVVVVV VVVV
   145   67 C R  E     -KN 109 160C  40  609   55  RRRRRRRRR                   R        RRRRRR I RTR   R  RRRRRRRRRR RRRR
   146   68 C V  E     +KN 108 159C   1  610   43  VVVVVVVVV                   L        LLLLLL L LFL   L  LLVVVVVVVV LLLL
   147   69 C G  S    S+     0   0    9  610   15  GGGGGGGGG                   G        GGGGGG G GGG   G  GGGGGGGGGG GGGG
   148   70 C D        +     0   0   11  611   58  SSSSSSSSS                   E        EEEKEE D EEE   E  EESSSSSSSS EEEE
   149   71 C R  S    S+     0   0   24  611   73  TTTTTTTTT                   H        HHHLIH H HHH   H  NHTTTTTTTT HHHH
   150   72 C N  B >   -P  234   0D  18  611   65  NNNNNNNNN                   N        NNNSYN D NDN   N  NNNNNNNNNN DNNN
   151   73 C T  T 3  S+     0   0   56  611   80  SSSSSSSSS                   I        IIISPI Q IRI   I  LISSSSSSSS IIII
   152   74 C E  T 3  S-     0   0  119  611   84  NNNNNNNNN                   V        AKQENA F VCD   K  QVNNNNNNNN WWWW
   153   75 C Q  S <  S-     0   0  130  610   85  SSSSSSSSS                   I        VVVRSV I IVV   V  VLPSSSSSSS EEEE
   154   76 C E        +     0   0  165  610   85  GGGGGGGGG                   N        TTTgQN t NEL   L  INGGGGGGGG PPPP
   155   77 C E        -     0   0   93  469   27  .........                   E        EEEeEE d EKE   E  EE........ EDDD
   156   78 C G  S    S+     0   0   46  578   34  GGGGGGGGG                   G        GGGENG S GSG   G  GGGGGGGGGG GGGG
   157   79 C G  S    S+     0   0   47  585   75  TTTTTTTTT                   T        SSSNTS P TPG   G  SSTTTTTTTT TTTT
   158   80 C E        -     0   0   37  472   30  .........                   E        EEEEEE A EEE   E  EE........ EEEE
   159   81 C A  E     -N  146   0C  27  487   57  .........                   Q        QQQRQQ I QTQ   Q  QQ........ QQQQ
   160   82 C V  E     -N  145   0C  71  590   83  IIIIIIIII                   F        FFFSAY M FRF   F  LFIIIIIIII HHHH
   161   83 C H  E     -N  144   0C  14  599   76  YYCYYYYYY                   I        IIITII R IYI   I  IIYYYYYYYY IIII
   162   84 C E        -     0   0   90  602   78  QQQQQQQQQ                   T        SSSTNT A TVD   D  LSQQQQQQQQ MMMM
   163   85 C V  E     -O  186   0C  27  607   64  VVVVVVVVV                   S        SSSVAS V SVA   A  ASVVVVVVVV SSSS
   164   86 C E  E    S+     0   0C  70  608   73  AAAAAAAAA                   E        QSSQAE S ERE   E  AEAAAAAAAA ASSS
   165   87 C V  E     -O  185   0C  13  609   72  QQQQQQQQQ                   K        QRRESK T KVK   K  KKQQQQQQQQ KKKK
   166   88 C V  E     -O  184   0C  72  610   46  TTTTTTTTT                   V        VVVVVV I VMI   I  VVTTTTTTTT FFFF
   167   89 C I  E     +O  183   0C  27  610   43  IIIIIIIII                   I        IIIITI I ITI   I  IIIIIIIIII IVVV
   168   90 C K  E     -O  182   0C  68  610   82  VVVVVVVVV                   R        RRRIVR R RGR   R  LRVVVVVVVV RRRR
   169   91 C H    >   -     0   0   19  611   13  HHHHHHHHH                   N        HHHHHH H NDH   H  HHHHHHHHHH HHHH
   170   92 C N  T 3  S+     0   0  156  611   61  GGGGGGGGG                   P        PPPPSP R PFP   P  PPGGGAGAGG PPPP
   171   93 C R  T 3  S+     0   0  150  608   73  SSSSSSSSS                   N        SNNNGS N NSD   K  GNSSSSSSSS NQQQ
   172   94 C F    <   -     0   0   24  611    5  YYYYYYYYY                   Y        YYYHYY F YFY   Y  FYYYYYYYYY YYYY
   173   95 C T     >  -     0   0   56  611   68  SSSSSSSSS                   D        NSSDnN D DLN   N  NNSSSSSSSS DNNN
   174   96 C K  T  4 S+     0   0  145  561   78  SSSSSSSFS                   S        SSSPwS I S.K   D  RSSSSSSSSS PPPP
   175   97 C E  T  4 S+     0   0  174  569   91  RRRRRRRRR                   W        WYYNAW N W.D   K  EWRRRRRRRR RRRR
   176   98 C T  T  4 S-     0   0   44  598   57  TTTTTTTTT                   D        TNNNTT S DNT   T  TTTTTTTTTT TTTT
   177   99 C Y    ><  +     0   0   60  604   65  MMMMMMMMM                   L        IIIYPI Y LFV   A  NIMMMMMMMM QQQQ
   178  100 C D  T 3   +     0   0   25  609   37  DDDDDDDDD                   D        DDDDDD N DED   D  DDDDDDDDDD DDDD
   179  101 C F  T 3  S+     0   0   21  595   66  YYYYYYYYY                   S        SNNIYS H SNN   N  NSYYYYYYYY NSSS
   180  102 C D    <   +     0   0    1  609    0  DDDDDDDDD                   D        DDDDDD D DDD   D  DDDDDDDDDD DDDD
   181  103 C I        +     0   0    0  611   13  VVVVVVVVV                   I        IIIIII I III   I  IIVVVVVVVV IIII
   182  104 C A  E     -MO 131 168C   0  611   60  AAAAAAAAA                   M        MMMAAM A MAM   M  MMAAAAAAAA MMMM
   183  105 C V  E     -MO 130 167C   0  612   16  LLLLLLLLL                   L        LLLLVL L LLL   L  LLLLLLLLLL LLLL
   184  106 C L  E     -MO 129 166C   0  613   30  LLLLLLLLL                   I        IIIVII L ILI   I  IILLLLLLLL IIII
   185  107 C R  E     -MO 128 165C  40  613   43  RRRRRRRRR                   K        KKKRRK K KRK   K  KKRRRRRRRR KKKK
   186  108 C L  E     - O   0 163C   0  613   16  TTTTTTTTT                   L        LLLLLL L LLL   L  LLTTTTTTTT LLLL
   187  109 C K  S    S+     0   0  101  613   69  SSSSSSSSS                   S        SSSARS R SNK   K  KSSSSSSSSS SSSS
   188  110 C T  S    S-     0   0   82  614   74  TTTTTTTTT                   K        KKKEHK K KES   S  TKTTTTTTTT ERRR
   189  111 C P        -     0   0   48  614   39  AAAAAAAAA                   P        SPPRAA P PRP   P  PPAAAAAAAA PPPP
   190  112 C I        -     0   0    4  562   63  .........                   A        AAAIAA V AVA   .  AA........ AAAA
   191  113 C T        -     0   0   95  566   73  .........                   T        TTTAST S TPI   A  IT........ TTTT
   192  114 C F        +     0   0   56  612   34  IIIIIIIII                   L        LLLFIL F LLL   A  LLIIIIIIII LLLL
   193  115 C R  B >   -Q  196   0E  52  613   63  sssssssss                   N        NNNTNN S NSN   r  NNssssssss NNNN
   194  116 C M  T 3  S+     0   0   29  594   77  sssssssss                   K        QTTDNQ K KDS   s  RQssssssss SSSS
   195  117 C N  T 3  S+     0   0   13  602   90  SSSSSSSSS                   Y        YYYYYY H YTQ   Q  KYSSSSSSSS FFFF
   196  118 C V  B <   +Q  193   0E   0  604   27  VVVVVVVVV                   V        VVVIVV V VIV   V  VVVVVVVVVV VVVV
   197  119 C A        -     0   0    1  606   80  AAAAAAAAA                   Q        QQQLSQ R QRS   S  AQAAAAAAAA RRRR
   198  120 C P        -     0   0    8  608   54  TTTTTTTTT                   P        PPPPPP P PPT   T  PPTTTTTTTT PPPP
   199  121 C A        -     0   0    2  609   39  IIIIIIIII                   V        VVVVLV V VIV   I  IVIIIIIIII AAAA
   200  122 C g  B     -c  290   0B   1  610   66  GGGGGGGGG                   A        AAACSA C ACS   S  SAGGGGGGGG VVVV
   201  123 C L        -     0   0   27  612    5  LLLLLLLLL                   L        LLLLLL L LLL   L  LLLLLLLLLL LLLL
   202  124 C P        -     0   0    7  613   30  EEEEEEEEE                   P        PPPPPP P PPP   P  PPEEEEEEEE PPPP
   203  124AC E     >  -     0   0   92  612   75  SSSSSSSSS                   N        SSTTTS T NTR   T  RSSSSSSSSS SSSS
   204  125 C R  H  > S+     0   0  109  612   78  GGGGGGGGG                   G        GSSVYG D GMS   S  SGGGGGGGGG KKKK
   205  126 C D  H  > S+     0   0  124  612   85  VVVVVVVVV                   C        CCCEDC N CLC   C  CCVVVVVVVV CCCC
   206  127 C W  H  >>S+     0   0    4  612   88  VVVVVVVVV                   A        AAADAA F ADA   P  AAVVVVVVVV EAAA
   207  128 C A  I  X>S+     0   0    0  612   75  SSSSSSSSS                   A        APPAPA G ANS   V  SASSSSSSSS NAAA
   208  129 C E  I  <5S+     0   0   75  613   82  VVVVVVVVV                   D        AAARDA N DET   T  TDVVVVVVVV DDDD
   209  130 C S  I  <5S+     0   0   70  614   66  GGGGGGGGG                   G        GGGRGG L GYN   G  GGGGGGGGGG GGGG
   210  131 C T  I  <5S+     0   0   18  108   73  .........                   .        ...L.. . T..   .  .T........ ....
   211  131AC L  I ><  S-     0   0  119  503   80  sssssssss                   M        MMMMTM S .KS   N  s.stssssss dDPP
   227  146 C E  T 3  S+     0   0   47  527   75  EEEEEEEEE                   S        SSSQGS E .EI   F  H.EEEEEEEE EESS
   228  147 C K  T 3  S+     0   0  169  548   68  GGGGGGGGG                   S        SSSDNS G .DG   G  Y.GGGGGGGG GGDD
   229  149 C G  S <  S-     0   0   29  559   66  GGGGGGGGG                   T        TTTGGT G TGG   G  VTGGGGGGGG SSAA
   230  150 C R        -     0   0  213  584   86  SSSSSSSSS                   A        AAATNA M AKK   K  DASSSSSFSS RRRR
   231  151 C Q  B     -R  224   0F  79  599   93  AAAAAAAAA                   D        DDDFLD L DPY   Y  YDAAAAAAAA YYYY
   232  152 C S        -     0   0   14  607   51  SSSSSSSSS                   S        SSSSAS P SSP   P  PSSSSSSSSS PPPP
   233  153 C T  S    S+     0   0   48  608   73  TTTTTTTTT                   N        NNNSSN G NCA   A  KNTTTTTTTT DDDD
   234  154 C R  B    S-P  150   0D 102  608   85  TTTTTTTTT                   K        KKKSRK V KLL   I  LKTTTTPPTT KKKK
   235  155 C L        -     0   0    3  610    3  LLLLLLLLL                   L        LLLLLL L LLL   L  LLLLLLLLLL LLLL
   236  156 C K  E     -BD  98 221B  31  610   51  RRRRRRRRR                   Q        QQQKMQ Q QQQ   Q  RQRRRRRRRR QQQQ
   237  157 C M  E     -BD  97 220B  18  611   94  QQQQQQQQQ                   C        CCCEYC E CEC   C  CCQQQQQQQQ CCCC
   238  158 C L  E     - D   0 219B   4  612   44  VVVVVVVVV                   L        LLLVVL V LVL   L  LVVVVVVVVV LLLL
   239  159 C E  E     - D   0 218B 107  612   72  IIITTIIII                   E        ENNNYE Q EEE   E  HEIIIITITV DEEE
   240  160 C V  E     - D   0 217B   0  612   46  VVVVVVVVV                   I        IIIVVI V IVA   A  VVVVVVVVVV AAAA
   241  161 C P  E     - D   0 216B  34  612   28  PPPPPPPPP                   P        PPPPPP P PPP   P  PPPPPPPPPP PPPP
   242  162 C Y  E     -F  263   0B  36  613   46  IIIIIIIII                   I        IIIIVI I IVV   V  LIIIIIIIII LLLL
   243  163 C V  E     -F  262   0B  24  614   37  VVVVVVVVV                   L        LLLIML L LML   L  LLVVVVVVVV LLLL
   244  164 C D     >  -     0   0   88  613   57  SSSSSSSSS                   S        SSSRNS S SSS   S  SSSSSARASS SSSS
   245  165 C R  H  > S+     0   0   51  613   78  DDDDDDDDD                   D        SYYQRD L DLA   D  DEDDDDDDDD DDDD
   246  166 C N  H  > S+     0   0  105  614   74  AAAAAAAAA                   R        SSSGNS S RQS   T  ARAAAAAAAA ENNN
   247  167 C S  H  > S+     0   0   48  614   78  SSSSSSSSS                   D        DDDKTD Q DAS   S  EDSSSASASS TTTT
   248  168 C j  H  X S+     0   0    1  614    2  CCCCCCCCC                   C        CCCCCC C CCC   C  CCCCCCCCCC CCCC
   249  169 C K  H >< S+     0   0   88  614   73  nnnnnnnnn                   N        DNNrNN r NrK   K  QNnnnnnnnn FFFF
   250  170 C L  H 3< S+     0   0  150  574   89  yyyyyyyyy                   N        KNNaYN k NsK   S  ANyyyyyyyy NNNN
   251  171 C S  H 3< S+     0   0   23  604   76  AAAAAAAAA                   S        SSSHYS Y SYS   S  SSAAAAAAAA AAAA
   252  172 C S    <<  -     0   0   20  607   83  SSSSSSSSS                   Y        YYYAMY K YSY   Y  YYSSSSSSSS YYYY
   253  173 C S  S    S+     0   0   79  607   83  YYYYYYYYC                   P        PPPRNP A PAP   P  PPYYYYYYYY PPPP
   254  174 C F  S    S-     0   0  124  607   79  GGGGGGGGG                   G        GGGYGG S GRG   G  SGGGGGGGGG FFFF
   255  175 C I        -     0   0  100  608   87  GGGGGGGGG                   M        MMMDAM R MMQ   Q  RMGGGGGGGG QQQQ
   256  176 C I        -     0   0   13  609   18  IIIIIIIII                   V        IIIVII I III   I  IIIIIIIIII IIII
   257  177 C T    >   -     0   0   16  614   35  TTTTTTTTT                   T        TTTTTT T TST   T  TTTTTTTTTT TTTT
   258  178 C Q  T 3  S+     0   0  133  614   68  AAAAAAAAA                   D        NNNKSS V DES   S  ENAAAAAAAA EEEE
   259  179 C N  T 3  S+     0   0   24  614   60  RRRRRRRRR                   T        TAANRT N TNN   S  NTRRRRRRRR NNNN
   260  180 C M  E <   - G   0 311B   2  614   13  MMMMMMMMM                   M        MMMMMM M MMM   M  MMMMMMMMMM MMMM
   261  181 C F  E     - G   0 310B   8  613   35  IIIIIIIII                   F        FFFFFF M FLF   F  VFIIIIIIII IIII
   262  182 C j  E     +FG 243 309B   1  614    1  CCCCCCCCC                   C        CCCCCC C CCC   C  CCCCCCCCCC CCCC
   263  183 C A  E     +FG 242 308B   0  614   26  AAAAAAAAA                   A        AAAAAA A AAL   L  AAAAAAAAAA AAAA
   264  184 C G  S    S-     0   0    3  614   10  GGGGGGGGG                   G        GGGGGG G GGG   G  GGGGGGGGGG GGGG
   265  185 C Y        -     0   0   56  591   57  YYYYYYYYY                   Y        YYYSYY K YYF   F  FYYYYYYYYC YYYY
   266  185AC D  S    S-     0   0   81  594   83  TTTTTTTTT                   L        LLLEDL G LLL   L  LLTTTTTTTT LLLL
   267  185BC T  S    S+     0   0   76  614   61  SSSSSSSSS                   E        EEETSE F EEE   E  GESSSSSSSS EEEE
   268  186 C K  S    S-     0   0  107  563   32  GGGGGGGGG                   G        GGGGGG . GGG   G  GGGGGGGGGG GGGG
   269  187 C Q  S    S+     0   0  102  569   37  GGGGGGGGG                   G        GGGGGG . GQG   G  GGGGGGGGGG GGGG
   270  188 C E        +     0   0   33  613   55  RRRRRRRRR                   K        KKKRRK E KKK   K  KKRRRRRRRR KKKK
   271  189 C D  B     -A   94   0A   7  614    4  DDDDDDDDD                   D        DDDDDD D DDD   D  DDDDDDDDDD DDDD
   272  190 C A        -     0   0    7  614   42  AAAAAAAAA                   S        SSSSSS S SSS   S  SSAAAAAAAA SSSS
   273  191 C k    >   -     0   0    7  614    3  CCCCCCCCC                   C        CCCCCC C CCC   C  CCCCCCCCCC CCCC
   274  192 C Q  T 3  S+     0   0   90  614   25  QQQQQQQQQ                   Q        QQQDQQ Q QQD   D  QQQQQQQQQQ QQQQ
   275  193 C G  T 3  S+     0   0    6  614    8  GGGGGGGGG                   G        GGGGGG G GGG   G  GGGGGGGGGG GGGG
   276  194 C D    X   +     0   0    0  614    0  DDDDDDDDD                   D        DDDDDD D DDD   D  DDDDDDDDDD DDDD
   277  195 C S  T 3  S+     0   0   14  614    1  SSSSSSSSS                   S        SSSSSS S SSS   S  SSSSSSSSSS SSSS
   278  196 C G  T 3  S+     0   0    0  614    0  GGGGGGGGG                   G        GGGGGG G GGG   G  GGGGGGGGGG GGGG
   279  197 C G    <   -     0   0    0  614    1  GGGGGGGGG                   G        GGGGGG G GGG   G  GGGGGGGGGG GGGG
   280  198 C P  E     - H   0 294B   1  614    2  PPPPPPPPP                   P        PPPPPP P PPP   P  PPPPPPPPPP PPPP
   281  199 C H  E     -EH 219 293B   0  614   49  LLLLLLLLL                   V        VVVFLV L VLV   V  LVLLLLLLLP MMMM
   282  200 C V  E     -EH 218 291B   3  614   26  VVVVVVVVV                   V        VVVVAV L VIV   A  VVVVVVVVVV TMMM
   283  201 C T  E     - H   0 290B   0  614   66  AAAAAAAAA                   C        CCCVCC L CTC   C  CCAAAAAAAA CCCC
   284  202 C R  E     + H   0 289B  99  614   70  NNNNNNNNN                   N        NNNYQN N NEN   N  NNNNNNNNNN DDDD
   285  203 C F  E >  S- H   0 288B  22  614   71  GGGGGGGGG                   G        GGGDLN t GrG   G  GGGGGGGGGG GGGG
   286  204 C K  T 3  S-     0   0   85  222   71  .........                   .        ...NG. g .d.   .  .......... ....
   287  205 C D  T 3  S+     0   0  108  223   55  .........                   .        ...GG. D .K.   .  .......... ....
   288  206 C T  E <   - H   0 285B   3  233   75  .........                   .        ...KT. K .K.   .  .......... ....
   289  207 C Y  E     - H   0 284B  21  242   51  .........                   .        ...WW. H .Y.   .  .......... ....
   290  208 C F  E     -cH 200 283B   0  613   91  RRRRRRRRR                   E        AEENTQ T EEE   E  EQRRRRRRRR EEEE
   291  209 C V  E     + H   0 282B   1  613   38  LLLLLLLLL                   L        LLLLLL I LLI   L  LLLLLLLLLL LLLL
   292  210 C T  E     +     0   0B   1  613   84  VVVVVVVVV                   H        HQQISH V HIQ   Q  QQVVVVVVVV QQQQ
   293  211 C G  E     -IH 312 281B   0  613    0  GGGGGGGGG                   G        GGGGGG G GGG   G  GGGGGGGGGG GGGG
   294  212 C I  E     -IH 311 280B   0  613   19  VVVVVVVVV                   I        IVVIVI I IVI   I  IIVVVVVVVV VVVV
   295  213 C V  E     +I  310   0B   7  613   14  VVVVVVVVV                   V        VVVVVV V VVV   V  IVVVVVVVVV VVVV
   296  214 C S  E     -     0   0B   1  612    0  SSSSSSSSS                   S        SSSSSS S SSS   S  SSSSSSSSSS SSSS
   297  215 C W  E     -I  309   0B  45  613    7  WWWWWWWWW                   W        WWWWWW W WWW   W  WWWWWWWWWW WWWW
   298  216 C G        -     0   0   26  613    0  GGGGGGGGG                   G        GGGGGG G GGG   G  GGGGGGGGGG GGGG
   299  217 C E  S    S-     0   0   25  609   90  VVVVVVVVV                   Y        YYYDNY V YNS   Y  FYVVVVVVVV HHHH
   300  218 C G  S    S-     0   0   19  612   13  GGGGGGGGG                   G        GGGGGG G GGV   G  GGGGGGGGGG GGGG
   301  220 C k  S    S-     0   0    7  613    2  CCCCCCCCC                   C        CCCCCC C CCC   C  CCCCCCCCCC CCCC
   302  221 C A  S    S+     0   0    4  612   16  AAAAAAAAA                   A        AAAAAA G AAA   A  AAAAAAAAAA AAAA
   303  222 C R    >   -     0   0  105  611   73  RRRRRRRRR                   E        EEELLE R ERM   L  IERRRRRRRR MQQQ
   304  223 C K  T 3  S+     0   0  152  611   64  PPPPPPPPP                   K        KPPRAK P KPR   R  KKPPPPPPPP KRRR
   305  223AC G  T 3  S+     0   0   26  613   58  NNNNNNNNN                   N        NGGDGN G NGG   G  NNNNNNNNNN NNNN
   306  224 C K    <   -     0   0   43  613   85  FFFFFFFFF                   H        HNNKNH Y HYK   K  YHFFFFFFFF KKKK
   307  225 C Y        -     0   0   33  613   50  PPPPPPPPP                   P        PPPYPP P PPP   P  PPPPPPPPPP PPPP
   308  226 C G  E     -G  263   0B   4  611    2  GGGGGGGGG                   G        GGGGGG G GGG   G  GGGGGGGGGG GGGG
   309  227 C I  E     -GI 262 297B   6  612   11  VVVVVVVVV                   V        VVVVIV V VVV   V  VVVVVVVVVV VVVV
   310  228 C Y  E     -GI 261 295B   1  612    1  YYYYYYYYY                   Y        YYYYYY Y YYY   Y  YYYYYYYYYY YYYY
   311  229 C T  E     -GI 260 294B   2  612   39  AAAAAAAAA                   G        GAATTG T GTT   T  TGAAAAAAAA TTTT
   312  230 C K  E >   - I   0 293B  21  612   42  KKKKKKKKK                   K        KKKRRK R KRK   K  KKKKKKKKKK KKKK
   313  231 C V  G >  S+     0   0    1  611    8  VVVVVVVVV                   V        VVVVVV V VVV   V  VVVVVVVVVV VVVV
   314  232 C T  G 3  S+     0   0    2  609   71  SSSSSSSSS                   C        CCCHTC T CTC   C  CCSSSSSSSS CCCC
   315  233 C A  G <  S+     0   0   29  609   79  AAAAAAAAA                   M        SIIRQS R MRN   N  NMAAAAAAAA NNNN
   316  234 C F  S <> S+     0   0    7  605   35  VVVVVVVVV                   F        FFFFFF Y FYY   F  YFVVVVVVVV YYYY
   317  235 C L  H  > S+     0   0   23  603   80  RRRRRRRRR                   S        SNNRRS L SML   L  VSRRRRRRRR VIII
   318  236 C K  H  > S+     0   0  116  602   68  SSSSSSSSS                   Q        QNDDSQ E QDS   S  DQSSSSSSSS SSSS
   319  237 C W  H  > S+     0   0   26  602    1  WWWWWWWWW                   W        WWWWWW W WWW   W  WWWWWWWWWW WWWW
   320  238 C I  H  X S+     0   0    1  599   12  IIIIIIIII                   I        ILLLLI L III   I  IIIIIIIIII IIII
   321  239 C D  H  < S+     0   0   66  570   71  QQQQQQQQQ                   A        ATTQSA H ALQ   R  EAQQQQQQQQ KKKK
   322  240 C R  H >< S+     0   0  136  556   71  SSSSSSSSS                   D        DSSEQD R DKE   E  EDSSSSSSSS EDDD
   323  241 C S  H >< S+     0   0    6  523   72  NNNNNNNNN                   T        TTTYNT N THT   T  MTNNNNNNNN TTTT
   324  242 C M  T 3< S+     0   0   25  479   41                              M        MMMI I M MSM   M  IMFFF FF   MMMM
   325  243 C K  T <  S+     0   0  153  444   70                              R        SAA  S Q RKA   A  VQ     G   A AA
   326  244 C T    <         0   0   51  390   65                              N        NTT  S N NDN   A  AN         S SS
   327  245 C R              0   0  197  273   47                              N        N    N   N N   N  NN         D   
## ALIGNMENTS  491 -  560
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....0....:....1....:....2....:....3....:....4....:....5....:....6
     1   49 L Q              0   0  101  671   35  E      K  Q  R N  QQQE                       Q                Q     QQ
     2   50 L a    >   +     0   0   22  858    0  C C  C C  C  C C  CCCC                       CC      C C C  C C    CCC
     3   51 L E  T 3  S+     0   0  187  858   80  D R  R S  A  S A  KAAN                       AG      I I A  R N    IQQ
     4   52 L T  T 3  S-     0   0  105  864   61  N T  T L  Q  S P  PNNS                       DT      S S S  T P    SSS
     5   53 L S    <   +     0   0   89  868   72  S N  N N  K  N N  HKKT                       QL      Q Q Q  N L    QNN
     6   54 L P        +     0   0   10  878   31  P P  P P  P  P P  PPPP                       PP      P P P  P P    PLL
     7   55 L b        -     0   0   18  893   21  C C  C C  C  C C  CCCC                       CC      C C C  C C    CCC
     8   56 L Q  S    S+     0   0   92  892   83  D L  L K  S  Q Q  EKKQ                       KL      L L L  L N    LVV
     9   57 L N  S    S-     0   0   63  893   51  S N  N N  N  N N  HNNN                       NN      H H N  N K    NHH
    10   58 L Q  S    S-     0   0  152  893   57  N G  G Q  G  D G  GGGG                       GG      N N N  G D    NGG
    11   59 L G        -     0   0   16  893   40  G G  G G  A  G G  GAAA                       AG      G G G  G g    GEE
    12   60 L K  E     -S   23   0G 117  852   79  E M  I S  C  V T  TMMT                       MI      S S S  M s    SCC
    13   61 L a  E     -S   22   0G  45  882   10  C C  C C  K  C C  CCCC                       CC      C C C  C C    CVV
    14   62 L K  E     -S   21   0G 155  890   81  T T  S K  D  E Y  KAAV                       SV      Q Q Q  T K    QDD
    15   63 L X  E     +S   20   0G 120  768   39  N L  Q D  .  D N  DDDD                       DV      D D D  L D    D..
    16   64 L G        -     0   0   44  862   73  T D  D T  N  S S  KSSH                       SP      S S S  D G    TLL
    17   65 L L  S    S-     0   0  152  871   64  A R  R I  I  I T  IIIV                       VN      T T I  R Q    IFF
    18   66 L G  S    S+     0   0   67  883   63  G G  Q R  G  R E  GGGK                       GG      R R R  G A    RQQ
    19   67 L E        -     0   0  119  837   61  S D  E S  S  G A  GGGS                       GQ      G G G  D T    SDD
    20   68 L Y  E     -S   15   0G  37  883   11  Y F  F Y  Y  Y Y  YYYY                       YY      Y Y Y  F F    FYY
    21   69 L T  E     -S   14   0G  71  886   82  T A  L I  S  T S  SDDV                       DH      T T A  L T    TAA
    22   70 L b  E     -S   13   0G  20  889    0  C C  C C  C  C C  CCCC                       CC      C C C  C C    CCC
    23   71 L T  E     -S   12   0G  85  890   86  A L  L S  I  T I  IIIL                       IR      S S T  L I    TRR
    24   72 L c        -     0   0   44  890    0  C C  C C  C  C C  CCCC                       CC      C C C  C C    CCC
    25   73 L L    >   -     0   0   62  890   88  S P  P P  D  T R  TKKP                       KR      P P A  S K    SNN
    26   74 L E  T 3  S+     0   0  177  890   75  A P  P E  K  E N  DSSS                       SQ      P P P  P P    PPP
    27   75 L G  T 3  S+     0   0   29  893   20  N Q  R G  G  G G  TGGG                       GG      G G G  Q G    GGG
    28   76 L F  E <   +T   36   0H  40  893    9  Y Y  F Y  W  Y Y  YFFY                       FF      Y Y Y  Y W    FYY
    29   77 L E  E     +T   35   0H  74  893   73  m Q  R T  E  E H  SSSE                       TS      E E E  H E    EEE
    30   78 L G  S >  S-     0   0   32  889    5  g G  G G  G  G G  GGGG                       GG      G G G  G G    GGG
    31   79 L K  T 3  S+     0   0  156  891   73  F K  K R  A  E T  IVVR                       TK      I I P  K R    RKK
    32   80 L N  T 3  S-     0   0   33  892   62  N I  T D  Q  D N  NHHD                       HN      N N N  T M    TYY
    33   81 L c  S <  S+     0   0    1  892    3  C C  C C  C  C C  CCCC                       CC      C C C  C C    CCC
    34   82 L E        +     0   0   87  891   44  E D  D Q  N  A E  EEEE                       EE      E E A  D E    AEE
    35   83 L L  E    S-T   29   0H  96  889   88  H T  S F  Y  F H  KTTI                       TE      I I F  S F    LYY
    36   84 L F  E     -T   28   0H 139  889   83  V V  E a  E  A G  DDDe                       DI      A A A  V D    ANN
    37   85 L T        -     0   0   44  677   75  D V  V .  v  K V  VQQr                       Q.      K K E  V i    Kvv
    38   86 L R        +     0   0   57  408   92  . .  . n  y  N .  STTd                       TI      N N S  . c    Naa
    39   87 L K        +     0   0   96  535   81  . F  L E  N  E .  ELLL                       VD      E E E  L K    RTT
    40   88 L L        -     0   0   91  608   90  E E  E C  K  C .  CCCG                       CF      C C C  E D    CNN
    41   89 L d  S  > S+     0   0   15  617   29  C C  C H  C  R .  PTTC                       LC      H H H  C P    HCC
    42   90 L S  T  4 S+     0   0   98  624   84  T H  R P  S  H .  SGGI                       IK      P P P  R L    ASS
    43   91 L L  T >4 S-     0   0  120  627   87  L Y  Y D  V  Q .  GNNY                       DL      E E L  Y N    EVV
    44   92 L D  G >4 S-     0   0  107  638   73  A R  G M  D  G .  GEEM                       KL      R R R  R V    RNN
    45   93 L N  G >< S-     0   0    8  700   56  T N  N E  N  K .  PDDN                       SN      I I L  N N    PNN
    46   94 L G  G <  S-     0   0    0  882   52  H G  G D  G  E K  LKKG                       KI      D D D  G G    DGG
    47   95 L D  G <  S+     0   0   44  887   62  D G  G G  G  G D  AGGG                       GN      G G G  G G    GDD
    48   96 L e    <   -     0   0    0  892    0  C C  C C  C  C C  CCCC                       CC      C C C  C C    CCC
    49   97 L D  S    S-     0   0   59  892   74  D M  L Q  Q  H T  ESSE                       SL      Q Q Q  M S    QDD
    50   98 L Q  S    S+     0   0    2  892   63  Q Q  Q H  H  H l  HQQH                       Qn      H H H  Q Q    HHH
    51   99 L F  E     -U   62   0I   4  892   80  G Y  Y F  F  F f  YFFF                       Fl      F F F  Y I    FDD
    52  100 L d  E     +U   61   0I  10  893    1  C C  C C  C  C C  CCCC                       CC      C C C  C C    CCC
    53  101 L H  E     -U   60   0I  68  893   87  D R  Q H  K  Y K  KQQV                       KL      L L Y  R G    HII
    54  102 L E  E     -U   59   0I  92  893   68  N D  D P  E  P P  PPPE                       PN      P P P  D N    PEE
    55  103 L E  S    S-     0   0  100  893   82  T L  l s  d  g t  MggV                       gR      G G g  L T    Ggg
    56  104 L Q  S    S-     0   0  175  693   73  E a  e e  a  . .  Hqqp                       hV      Q Q e  l P    Edd
    57  105 L N  S    S+     0   0  154  838   66  G g  g d  q  d d  G..s                       .G      E E .  d G    Aqq
    58  106 L S  S    S-     0   0   58  853   65  S g  g S  C  S T  SSSP                       SG      S S S  G S    SWW
    59  107 L V  E     -U   54   0I   7  890   79  F V  V Y  R  Y Y  FYYH                       YY      Y Y Y  V Y    FRR
    60  108 L V  E     -U   53   0I  45  891   88  I Q  Q S  Y  R I  RQQH                       EN      M M T  R H    TKK
    61  109 L e  E     +U   52   0I   5  893    1  C C  C C  C  C C  CCCC                       CC      C C C  C C    CCC
    62  110 L S  E     -U   51   0I  24  893   75  F G  G S  S  S Y  FSSE                       SL      S S S  G S    SSS
    63  111 L f        -     0   0   23  893    0  C C  C C  C  C C  CCCC                       CC      C C C  C C    CCC
    64  112 L A    >   -     0   0    8  893   75  N A  A A  A  A A  AAAA                       AA      A A A  A R    ALL
    65  113 L R  T 3  S+     0   0  149  893   80  T D  D N  S  D K  KSSP                       YP      Q Q R  D S    QNN
    66  114 L G  T 3  S+     0   0   24  893    8  G G  G G  G  G G  GGGG                       GG      G G G  G G    GGG
    67  115 L Y  E <   -V   78   0J  20  893   11  Y Y  F Y  Y  Y Y  YYYY                       WW      Y Y H  F F    HYY
    68  116 L T  E     -V   77   0J  72  891   85  I F  K K  Q  E I  TEES                       KT      R R K  R D    KNN
    69  117 L L  E     -V   76   0J  67  888   64  L L  L L  L  L L  LLLL                       LG      L L L  L L    LLL
    70  118 L A    >   -     0   0   23  889   78  G E  E G  T  G G  HRRD                       QE      G G G  E V    GDD
    71  119 L D  T 3  S+     0   0  175  889   77  E S  A A  N  K K  SEEK                       QF      E E Q  E S    KKK
    72  120 L N  T 3  S-     0   0   92  694   44  D D  D D  D  D D  D..D                       .C      D D D  D N    DNN
    73  121 L G  S <  S+     0   0   16  713   66  G G  E E  H  K A  GKKN                       KQ      H H R  G K    QNN
    74  122 L K  S    S+     0   0   71  687   76  K Q  K K  N  K K  RGGT                       EY      K K R  R K    RRR
    75  123 L A        -     0   0   22  685   66  S S  S S  M  Q S  SKKS                       KL      R R S  S D    SKK
    76  124 L f  E     -V   69   0J  12  847    9  C C  C C  C  C C  CCCC                       CE      C C C  C C    CCC
    77  125 L I  E     -V   68   0J  78  846   80  L S  T H  T  I I  VVVI                       VN      V V L  S R    VLL
    78  126 L P  E     -V   67   0J  62  850   71  D K  P P  P  a P  PSSP                       PA      P P P  K D    PPP
    79  127 L T  S    S+     0   0  103  652   80  V T  T E  V  . A  QLLQ                       AC      H H H  S .    HQQ
    80  128 L G  S    S-     0   0   32  788   69  D V  V D  V  . E  VGGV                       VL      D D D  V V    EGG
    81  129 L P  S    S+     0   0  116  601   75  . V  E P  E  k P  QEEK                       TA      Q Q R  S .    QTT
    82  130 L Y  S    S+     0   0   59  794   86  . F  F F  F  C Y  NFFF                       FY      C C C  F D    CTT
    83  131 L P    >   -     0   0   17  799   62  E P  P A  P  A P  PSSP                       PP      A A A  P E    ASS
    84  132 L g  T 3  S+     0   0   16  800    5  C C  C C  C  C C  CCCC                       C       C C C  C C    CCC
    85  133 L G  T 3  S+     0   0    0  712   37  T G  G G  G  G G  GGGG                       G       G G G  G S    GGG
    86  134 L K    <   -     0   0   69  588   68    R  R Q  R  R N  KKKR                       K       V V T  R R    IQQ
    87  135 L Q        -     0   0   37  477   65    Q  Q I  V  L I  MVVV                       V       L L L  Q      LLL
    88  136 L T        +     0   0    4  428   78    Q  Q    K       QSS                                A A           ALL
    89  137 L L        +     0   0  105  372   61    M  M    M       ITT                                S S            II
    90  138 L E              0   0  104  274   69    E  A    D       TSS                                R R            SS
    91  139 L R              0   0  231  199   47                     RR                                K K            RR
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2   I II   II II   II    II IIIIIIIIIIIIIIIIIIII  IIIIII I I II I IIII   
    94   17 C V  B     -A  271   0A   7  590    9   V VV   VV VV   VV    VV VVVVVVVVVVVIIIVVVVVV  VVVVIV V V IV V IVVV   
    95   18 C G  S    S+     0   0   25  591    6   G GG   EG GG   GG    GG GGGGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
    96   19 C G  S    S-     0   0   26  592    0   G GG   GG GG   GG    GG GGGGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
    97   20 C Q  E     -B  237   0B  98  593   95   Y KY   SI YY   YY    KV TYSRVYYYYYYFTEHNYYRR  YRYYYE Y Y YY Y YSSY   
    98   21 C E  E     -B  236   0B  80  594   67   E PT   DA TT   EE    PV NEPPEEEEEEEEEPADEEPP  EPTETT T E NE T TTTE   
    99   22 C h        -     0   0    8  594   58   C TC   AV CC   CC    VA ACATACCCCCCAAATTCCTT  CTCCCC C C CC C CTTC   
   100   23 C K    >   -     0   0  123  593   78   T GK   ED PP   TT    SK ARTGKKKKKKKTTDTDKKLE  KLAA.Q E K PR A PTTT   
   101   24 C D  T 3  S+     0   0   60  594   85   P VE   II KK   PP    IP SKAVRAAAAAAPPIIIAAPA  PPAPEE E A RK P KIIP   
   102   25 C G  T 3  S+     0   0    0  595   74   Y NG   GS HH   YY    EG GNGNNYYYYYHGGLESYYNY  YNNHNA N Y NN N NQQH   
   103   26 C E  S <  S+     0   0   36  595   66   S QS   ME SL   SS    DA ASQQSSSSSSSSSDEDSSKD  SRSSSS S S SS S SYNS   
   104   27 C h    >   +     0   0    4  595   92   Q YV   SV VV   QQ    IW AVAYIQQQQQQVFFHVQQYY  QYVKLV V Q LV L LYFQ   
   105   28 C P  T 3   +     0   0    0  599    9   P PP   PP PP P PP    PP PAPPPPPAAPPPPPPPPPPP  PPPPPP P P PP P PPPP   
   106   29 C W  T 3  S+     0   0    5  600   26   W WY   WY YY W WW    YW HYYWWHHHHHWWWWHYHHWW  HWYWYY Y W YY Y YYYH   
   107   30 C Q  E <   -J  122   0C   7  601   26   T MQ   QQ QQ q QQ    Qq QQQLqQQQQQQQMqQQQQVm  QIQQqQ Q Q QQ Q QLQQ   
   108   31 C A  E     -JK 121 146C   1  593   49   V AV   VV VV a VV    Vi VVVAaVVVVVVVVsVVVVAg  VAVVsV V V VV V VVVV   
   109   32 C L  E     -JK 120 145C   3  598   68   S RS   MS SS V SS    SW SSSRLSSSSSSSSISASSRL  SRSHLS S S SS S SSSS   
   110   33 C L  E     -JK 119 144C   0  601    9   L IL   LL LL L LL    VA LLLLFLLLLLLLILVVLLLL  LLLLNL L L LL L LLLL   
   111   34 C I  E     -JK 117 143C   0  601   81   N IN   FQ NH N NN    NK QNQVKNNNNNNQQYIFNNVY  NVNNVN N N NN N NQQN   
   112   35 C N  E >   - K   0 142C  30  601   88   S YS   RR DD R VV    Fg RSQYHSSSSSVRQFYSSSYK  SYAYGA S S DG A DYYS   
   113   36 C E  T 3  S+     0   0   63  117   78   . ..   K. .. . ..    .d ....................  ...... . . .. . ....   
   114   37 C E  T 3  S-     0   0  136  242   77   . ..   SY .. R ..    FK ...........SN.I.....  ...K.. . . .. . .GG.   
   115   38 C N  S <  S+     0   0   84  565   53   G DG Q PN GG R GG    GG SGSD.GGGGGGGGGDKGGDG  GDGG.G G G GG G GGGG   
   116   39 C E        -     0   0  100  589   94   Y GY E QS II E YY    QA SYRGNYYYYYYSYKSGYYGA  YGYSYY Y Y TY Y SSSY   
   117   40 C G  E     +J  111   0C  14  600   57   H KH L EH SS P HH    HQHHHHQRHHHHHHHHHHVHHRL  HRHFHH H H GH H HHHH   
   118   41 C F  E     +     0   0C  28  611   33   F fF L lS hh F FF    LFFFFFffFFFFFFFILYfFFfY  FfFFIF F F hF F FIIF   
   119   42 C i  E     -J  110   0C   0  612    1   C cC C cC cc C CC    CCCCCCccCCCCCCCCCCcCCcC  CcCCCC C C cC C CCCC   
   120   43 C G  E     -J  109   0C   1  612    1   G GG A GG GG G GG    GGGGGGGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
   121   44 C G  E     -J  108   0C   0  612    9   G GG A AG GG G GG    GGAGGGAGGGGGGGGGGGGGGAA  GAGGGG G G GG G GGGG   
   122   45 C T  E     -JL 107 130C   0  612   45   S SS S SS SS T SS    SSTSSTSSSSSSSSTTSSSSSST  SSSSSS A S SS S SSSS   
   123   46 C I  E     + L   0 129C   0  612   23   L LL L LI LL L LL    ILLILILLLLLLLLLLIIILLLL  LLLLLL L L LL L LIIL   
   124   47 C L        -     0   0    6  612   27   V LI I II II V VV    LIIIIVLIVVVVVVLLLIVVVLI  VLIIII I V II I IIIV   
   125   48 C S  S    S-     0   0   22  612   56   S TS S SS SS S NN    SDTSSSTNNNNNNNNNSHSNNNN  NNNANN S N SS N TSSN   
   126   49 C E  S    S+     0   0   99  612   63   E KN D DS DD A EE    EPNDSKRSEEEEERSSRTPEEND  ENSPEE E E DS E DAAE   
   127   50 C F  S    S+     0   0   42  612   83   Y DQ R RN QQ G NN    RERRTDDRNNNNNDQHWRDNNDR  NDQREQ Q N QT Q QNNN   
   128   51 C Y  E     - M   0 185C   7  612   34   W YW W WY WW W WW    FWWWWWYWWWWWWWWWWFVWWYY  WYWWWW W W WW W WYYW   
   129   52 C I  E     -LM 123 184C   0  612   14   V VV V VI VV V VV    IVLIVIVVVVVVVVVVIIIVVVV  VVVIVV V V VV V VVVV   
   130   53 C L  E     +LM 122 183C   0  612   27   V LV L LL LL L VV    LLILVVLLVVVVVVLLLLVVVIV  VIVVLV V V LV V VLLV   
   131   54 C T  E     - M   0 182C   0  612   43   S SS T TT SS T SS    TTTTSTTTSSSSSSSSTTTSSTT  STSSSS S S SS S STTS   
   132   55 C A    >>  -     0   0    0  613    2   A AA A AA AA A AA    AAAAAAAAAAAAAAAAAAAAAAA  AAAAAA A A AA A AAAA   
   133   56 C A  G >4 S+     0   0    0  613    9   A AA A AA AA A AA    AAAAAAAAAAAAAAAAAAAAAAA  AAAAAA G A AA A AAAA   
   134   57 C H  G >4 S+     0   0    7  613    0   H HH H HH HH H HH    HHHHHHHHHHHHHHHHHHHHHHH  HHHHHH H H HH H HHHH   
   135   58 C i  G X4 S+     0   0    0  613    1   C CC C CC CC C CC    CCCCCCCCCCCCCCCCCCCCCCC  CCCCCC C C CC C CCCC   
   136   59 C L  G << S+     0   0   31  613   66   Y VY L LT YY V YY    IFVVYVVLYYYYYYLQFTLYYVV  YVYYYY Y Y YY Y YIIY   
   137   60 C Y  G <  S+     0   0  109  613   87   K KK L LD KK R QK    IEYSKDRPKKKKKKVAIYHKKRD  KRKLSM K K KK K KIIK   
   138   61 C Q  S <  S+     0   0   95  613   78   S kS y yq RR R SS    giggSgrsSTSSSTSSnqwSSrg  SnSLRS P S GS S RggS   
   139   61AC A        -     0   0   16  373   75   . r. v ev .. . ..    tkpa.ara.......Akaf..rm  .r.P.. . . .. . .aa.   
   140   62 C K  S    S-     0   0  172  387   77   . S. N NS .. . ..    PSSS.SNS.......SSEE..SE  .S.KK. . . R. . .SS.   
   141   63 C R  S    S-     0   0  162  602   78   R KR D DS RK R RR    DQLQRAKSRRRRRHGSGDDRRKS  RKRYSR R R KR R QQQR   
   142   64 C F  E     -K  112   0C  36  609   54   V II I LL LL L II    FYILILILVVVVVIMLLLVVVII  VIIVFI I V LI I FHHV   
   143   65 C K  E     -K  111   0C  67  609   79   E RQ L LS QQ I EE    TMKNQKRHAEEEEETRELIEERH  ERQVQQ Q Q QQ Q QRRE   
   144   66 C V  E     -KN 110 161C   0  609   16   V IV V VV VV V VV    VLVIVIVVVVVVVVVIIVVVVVV  VVVAVV V V VV V VVVV   
   145   67 C R  E     -KN 109 160C  40  609   55   R IR R RR RR L RR    RRRRRRVRRRRRRRVIIRRRRIL  RVRHRR R R RR R HRRR   
   146   68 C V  E     +KN 108 159C   1  610   43   L FL I IA LL A LL    TLLYLYLLLLLLLLAVHAALLLL  LLLILL L M LL L LVVL   
   147   69 C G  S    S+     0   0    9  610   15   G GG G GG GG G GG    GGGNGNGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
   148   70 C D        +     0   0   11  611   58   E DE K KS EE E EE    SEKTETDEEEEEEEEEESSEEDG  EDEMEE E E EE E DSSE   
   149   71 C R  S    S+     0   0   24  611   73   H HY Y HS HH H HH    NHHLHLHHHHHHHHHHRTSHHYH  HYHHNH H H HH H HTTH   
   150   72 C N  B >   -P  234   0D  18  611   65   N DN A SF NN S NN    YNITNSDNNNNNNNDNRMNNNDD  NDNDNN N D NN N NNFN   
   151   73 C T  T 3  S+     0   0   56  611   80   I QI R RY II L II    SFRHIHQLIIIIIILFVVSIIQL  LQIVII I I II I ISSL   
   152   74 C E  T 3  S-     0   0  119  611   84   A EE S TS DH H QQ    SNQNANFIKKKKKQSGGNRKKYE  RYESRE K T KA D DNNR   
   153   75 C Q  S <  S-     0   0  130  610   85   V IE R RR VV R VV    TEKSVSISVVVVVVRSTSSVVVN  VVVKVV V Y VV V ISSV   
   154   76 C E        +     0   0  165  610   85   N tV Y YG LL R TT    DDIGNGaNTTTTTTNLKGGTTNv  TNLAIT L S LN I IGGT   
   155   77 C E        -     0   0   93  469   27   E eE E E. EE E EE    .EE.E.eDEEEEEEDEN..EETe  ETEEEE E E EE E E..E   
   156   78 C G  S    S+     0   0   46  578   34   G SG R RG GG G GG    .GKGGGTGGGGGGNGGLGGGGDE  GDGGGG G G GG G GGGG   
   157   79 C G  S    S+     0   0   47  585   75   S QN n nV GG S TT    .TTSTSTSSSSSSTHTRQISSgE  KgNTNN N S GT G GTTK   
   158   80 C E        -     0   0   37  472   30   E AE e e. EE E EE    GEE.E.AEEEEEEEEE...EEpL  EpEVEE E E EE E E..E   
   159   81 C A  E     -N  146   0C  27  487   57   Q IQ K K. QQ Q QQ    EQQ.Q.IQQQQQQQQQ...QQIE  QVQQQQ Q Q QQ Q Q..Q   
   160   82 C V  E     -N  145   0C  71  590   83   Y QF I IV FF E NN    VDSVFLQVFFFFFFSS.VTFFML  FMFIFF F F FF F FIIF   
   161   83 C H  E     -N  144   0C  14  599   76   I RI S SV II V II    HFYVIVRIIIIIIIRTMRVIIRR  IRIIII I I II I IYYI   
   162   84 C E        -     0   0   90  602   78   T AN T MG DD R PP    KYDKNQASSSSSSPGGKGGSSAA  RADQDD H S DS D DQNR   
   163   85 C V  E     -O  186   0C  27  607   64   S VS L LV AA V SS    VIAASAVVSSSSSSVVVVVSSVV  SVSVVS A S AS S VVAS   
   164   86 C E  E    S+     0   0C  70  608   73   E TA E EK EE S SS    REESAATSSSSSSTEQDAKSSSV  SSAEAE A S EA A AAAS   
   165   87 C V  E     -O  185   0C  13  609   72   K AK K KR KK R KK    QKMKKQAARRRRRVREKQTRRVR  RAKKKK K R KK K KQQR   
   166   88 C V  E     -O  184   0C  72  610   46   V VV I IV II T VV    IYYIVIIIVVVVVVIVLICVVVM  VVVSIV I V IV V VTVV   
   167   89 C I  E     +O  183   0C  27  610   43   I II I YI II V II    IYKIIIIYIIIIIIIIIFEIIIV  IVIFII I I II I IIII   
   168   90 C K  E     -O  182   0C  68  610   82   R KR I IQ RR L RR    SIIPRSRRRRRRRKPPTQSRRRK  RRRQLR R R RR R IVRR   
   169   91 C H    >   -     0   0   19  611   13   H HH H HH HH H HH    HHHHHHHHHHHHHNHHHHHHHHH  HHHHHH H H HH H HHHH   
   170   92 C N  T 3  S+     0   0  156  611   61   P KP P PP PP P PP    EPPTPERPPPPPPPPPPKPPPKP  PRPYPP P P PP P PGAP   
   171   93 C R  T 3  S+     0   0  150  608   73   S SS G RL DE D SS    LKHSRKSQNNNNNGNNYNKNNNK  ENNKGG K N KN N ESSE   
   172   94 C F    <   -     0   0   24  611    5   Y FY Y YF YY Y YY    YYYYYYFYYYYYYYYFFFYYYFF  YFYYFY Y Y YY Y YYYY   
   173   95 C T     >  -     0   0   56  611   68   N DS n nN NN D DD    DDSSSDDSSSSSSDNDDDNSSDE  SDNNNS N S NS N TSNS   
   174   96 C K  T  4 S+     0   0  145  561   78   S PS r rY KK P SS    EEPSSSQ.SSSSSSDPSIRSSMP  SMSSMF N S DS S .SSS   
   175   97 C E  T  4 S+     0   0  174  569   91   W DQ E EN DD E WW    EKDSRYN.YYYYYWNLWDTYYNK  YNYSNW E Y KY Y SRRY   
   176   98 C T  T  4 S-     0   0   44  598   57   T TT N NT TT T TT    TTSTNNSGNNNNNTTTFTTNNST  NSTSNT T N TS M ITTN   
   177   99 C Y    ><  +     0   0   60  604   65   I YL L LI VL V II    TTYILIYLIIIIILLFLYVIIYF  IYIILL L I AL I YMLI   
   178  100 C D  T 3   +     0   0   25  609   37   D ND D DD DD D DD    DDDDDDNNDDDDDDDDDDDDDNN  NNDDDD D D DD D NDDD   
   179  101 C F  T 3  S+     0   0   21  595   66   S NN R RY NN M NN    YNSYNHHRNNNNNSNNNYFNNHN  NHNNNN N N NN N HYYN   
   180  102 C D    <   +     0   0    1  609    0   D DD D DD DD D DD    DDDDDDDDDDDDDDDDDDDDDDD  DDDDDD D D DD D DDDD   
   181  103 C I        +     0   0    0  611   13   I II I IF II L II    FMIIIIIVIIIIIIIIIIIIIVI  IVIIII I I II I IVII   
   182  104 C A  E     -MO 131 168C   0  611   60   M AM A AA MM A MM    SAAAMAAGMMMMMMMMASAMMAA  MAMMMM M M MM M MAGM   
   183  105 C V  E     -MO 130 167C   0  612   16   L LL L LI LL L LL    ILLLLILLLLLLLLLLLVVLLLI  LLLLLL L L LL L LLLL   
   184  106 C L  E     -MO 129 166C   0  613   30   I LI M ML II L II    FIIIIILMIIIIIIIILLCIILL  ILIILI V I II I VLII   
   185  107 C R  E     -MO 128 165C  40  613   43   K RK K KE KK R KK    EKRQKKKKKKKKKKKRLKRKKKQ  KKKKKK K K KK K KRRK   
   186  108 C L  E     - O   0 163C   0  613   16   L LL L LL LL L LL    LLLTLLLLLLLLLLLLLLLLLLF  LLLLLL L L LL L LTTL   
   187  109 C K  S    S+     0   0  101  613   69   S RS K KK KK R SS    EDASSARSSSSSSSSSKSKSSRD  SRKAKK S S KS K KSSS   
   188  110 C T  S    S-     0   0   82  614   74   K KS K KS SS S TT    DRQTKTKRKKKKKKSYSETKKKE  EKTETT T S SK T RTSE   
   189  111 C P        -     0   0   48  614   39   A PT P PP PP P PP    PPPPPSPPPPPPPPPPPSPPPSP  PSPPPP P P pP P PAGP   
   190  112 C I        -     0   0    4  562   63   A IA V VL AA L AA    IAVLALVAAAAAAAVVFLLAAVI  AVAAAV A V sA A A..A   
   191  113 C T        -     0   0   95  566   73   T AT A AK IV P RR    TTTTTTDTTTTTTTTTKVKTTKP  TKTQII I T QT T T.IT   
   192  114 C F        +     0   0   56  612   34   L FL F FF LL M LL    FLFLLLFILLLLLLIILLFLLFF  LFLFLL I L VL L IIVL   
   193  115 C R  B >   -Q  196   0E  52  613   63   N SN S SS NN G NN    SNTgNeTNNNNNNNSNDGNNNSS  NSNNNN N N SN S NsgN   
   194  116 C M  T 3  S+     0   0   29  594   77   Q KS D DK SS A SS    DKDaStKSTTTTTASTASSTTKR  QKSHDD A Q .S S SssQ   
   195  117 C N  T 3  S+     0   0   13  602   90   Y IR Y YN QQ F NN    TRYNYNTKYYYYYYWWTGKYYKL  YKRYQH R Y .Y R QGGY   
   196  118 C V  B <   +Q  193   0E   0  604   27   V IV I IC VV V VV    RVVAVAIVVVVVVVVVKVIVVII  VIVVVV V V .V V VVVV   
   197  119 C A        -     0   0    1  606   80   Q KS H HN SS A QQ    RNKQRKKSQQQQQQSSVARQQRG  QRSQAL S Q .K S SATQ   
   198  120 C P        -     0   0    8  608   54   P PT P PF TT P PP    ATPKTSPTPPPPPPPPPVSPPPP  PPSPTP T P TT T TTSP   
   199  121 C A        -     0   0    2  609   39   V VI V VA VV A VV    VIIIVVVVVVVVVVAAIIVVVIV  VIIIII I V IV I VIIV   
   200  122 C g  B     -c  290   0B   1  610   66   A CS C CK SS C AA    QCCASPCCAAAAAASCCPPAACC  ACTPSS S A SS S PGAA   
   201  123 C L        -     0   0   27  612    5   L LL L LL LL L LL    LLLLLLLLLLLLLLLLLLLLLLL  LLLLLL L L LL L LLLL   
   202  124 C P        -     0   0    7  613   30   P PP P PP PP P PP    PPPPPTPPPPPPPPPPSPAPPPP  PPPAPP P P PP P PEQP   
   203  124AC E     >  -     0   0   92  612   75   S RS D DK RR E KK    DESASSKQSSTTSSDAEERTTQQ  TQTHEK S T TS K KSTT   
   204  125 C R  H  > S+     0   0  109  612   78   G YS K RQ SS P SS    AAAQSQDTSSSSSGSAIDISSSS  SPSSSD A S SS Y SGAS   
   205  126 C D  H  > S+     0   0  124  612   85   C NC Q ED CC G CC    DDADCGRTCCCCCCMMTGECCGD  CGCCCC L C CC C CVNC   
   206  127 C W  H  >>S+     0   0    4  612   88   A YA I TE AA D AA    EDSSANSDAAAAAAVVDSPAANI  ATAPAA A A PA A PVNA   
   207  128 C A  I  X>S+     0   0    0  612   75   A DS V AQ SS T AA    DEDDGDENPPPPPPSAITEPPDD  PDAIFP A P VS A SSAP   
   208  129 C E  I  <5S+     0   0   75  613   82   A PT T AI TT L AA    IFYPSPPFAAAAAAADDVHAAPY  APTKVA A A TA V AVAA   
   209  130 C S  I  <5S+     0   0   70  614   66   G AG S SP ND A GG    AKASGASPGGGGGGGGRPNGGAA  GAGGDG G G GG G GGGG   
   210  131 C T  I  <5S+     0   0   18  108   73   . .. L L. .. . ..    ..Q....................  ...... . . .. . ....   
   211  131AC L  I ><  S-     0   0  119  503   80   M SS N nQ SS K MM    KELsgRSSMMMMMM.PISrMMSN  MSSGNS s T NS S SssM   
   227  146 C E  T 3  S+     0   0   47  527   75   S ES M VN II R SS    NGWESEEASSSSSS.SPEESSEE  SESFPS F M FS S FEES   
   228  147 C K  T 3  S+     0   0  169  548   68   S GG N GA GG H SS    HARGGGGGSSSSSSGGMNQSSGT  SGGFSG G S GS G GGGS   
   229  149 C G  S <  S-     0   0   29  559   66   T GS E KQ GG A TT    QGDGSGGGTTTTTTSSRGGTTGG  TGSGVA A S GS V GGGT   
   230  150 C R        -     0   0  213  584   86   A EN V GE KK N AA    ESRSNATIAAAAAANPSPHAAMN  AMNESD D V KN N VSSA   
   231  151 C Q  B     -R  224   0F  79  599   93   D LY Q QS YY G DD    STVLYGLLDDDDDDYYVLMDDLI  DLYFYY Y S YY Y YAAD   
   232  152 C S        -     0   0   14  607   51   S PP P PR PP S RR    NSAPPSPPGKSSGRPSSPASKPS  KPPPPP P G PP P PSSK   
   233  153 C T  S    S+     0   0   48  608   73   N SE S SD AA D NN    YKNSDTGNDNNNDNDYPVKNNGP  NGDDDD D D AD E ATTN   
   234  154 C R  B    S-P  150   0D 102  608   85   K IL V VQ LL L KK    HVRRRAIKKKKKKKKRQETKKKI  KKLRML E R IR L VTTK   
   235  155 C L        -     0   0    3  610    3   L VL L LL LL L LL    VLLLLLVLLLLLLLLLLLLLLVL  LVLLLL L L LL L LLLL   
   236  156 C K  E     -BD  98 221B  31  610   51   Q NQ Q QR QQ H QQ    RMHQRQQRQQQQQQQQNQQQQHA  QQQQQQ Q Q QM Q KRRQ   
   237  157 C M  E     -BD  97 220B  18  611   94   C QC M VA CC Q CC    AQETCIHKCCCCCCKRKESCCEQ  CECCCC C C CC C CQQC   
   238  158 C L  E     - D   0 219B   4  612   44   L VL V VA LL A LL    VAAVLVVALLLLLLVVVVVLLVV  LVLLLL L L LL L LVVL   
   239  159 C E  E     - D   0 218B 107  612   72   E KN N NK EE Q EE    SKTTDTDVNNNNNERNNDLNNQE  DQKDSQ E Q ED N DIAD   
   240  160 C V  E     - D   0 217B   0  612   46   I VV L LV AA V II    VVVVAVVKIIIIIIVVILLIIVV  IVALAA A I AA A VVVI   
   241  161 C P  E     - D   0 216B  34  612   28   P PP P PP PP P PP    PPPPPPPPPPPPPPPHNPPPPPP  PPPPPP P P PP P PPPP   
   242  162 C Y  E     -F  263   0B  36  613   46   I IV L IK VV V II    KLIVIIIIIIIIIIVTLTVIIII  IIVVIL V I VI L VIII   
   243  163 C V  E     -F  262   0B  24  614   37   L ML V VY LL V II    VVVVLVLVLLLLLLIIVIVLLYY  LYLLLL L L LL L LVVL   
   244  164 C D     >  -     0   0   88  613   57   S SS E EN SS P AA    NSDASSTSSSSSSSSPKQESSST  SSSPSS S S SS S SSAS   
   245  165 C R  H  > S+     0   0   51  613   78   D VQ R RD AA A DD    QRIRERLTYYYYYNRRWDRYYLN  FLDEDD Q D DD D DDDF   
   246  166 C N  H  > S+     0   0  105  614   74   S TA P PK SS Q KK    LDQASADSSSSSSAARENDSSTE  ETSDAA A R TS A AAAE   
   247  167 C S  H  > S+     0   0   48  614   78   D EK I VA SS D DD    EQTTSQQADDDDDDTQIVIDDQA  DQSSKE E D SS T ASAD   
   248  168 C j  H  X S+     0   0    1  614    2   C CC C CC CC C CC    CCCCCCCCCCCCCCCCCCCCCCC  CCCCCC C C CC C CCCC   
   249  169 C K  H >< S+     0   0   88  614   73   N rE K Kn KK r DD    qsrNRnrnNNNNNQnnSAnNNrq  DrRKER E N KK R HnnD   
   250  170 C L  H 3< S+     0   0  150  574   89   N kA A Dy KK v NN    yqaSNnkqNNNNNNnr.LlNNkk  NkNSTA A N SN K KyyN   
   251  171 C S  H 3< S+     0   0   23  604   76   S YA S SK SS Y SS    ISHASYYSSSSSSSASSMLSSYY  SYASAS S S SS A AAAS   
   252  172 C S    <<  -     0   0   20  607   83   Y KY T TG YY A YY    FYPYYGRYYYYYYYYYLYPYYRG  YRYYYY Y Y YY Y YSSY   
   253  173 C S  S    S+     0   0   79  607   83   P SP G RF PP D PP    GGDGPSAGPPPPPPANLGSPPAK  PAPGSP P P PP P PYYP   
   254  174 C F  S    S-     0   0  124  607   79   G TG I IG GG Y GG    ADYGGGSGGGGGGGGGTDYGGNQ  GNGDEG G G GG G GGGG   
   255  175 C I        -     0   0  100  608   87   M RQ R RG QQ L MM    IRISQQRAMMQMMMARLRDMMRA  MRQDKE K M QQ Q RGGM   
   256  176 C I        -     0   0   13  609   18   I II V II II I II    IIVIIIIIIIIIIIVVFLIIIII  IIIIII I I II I IVII   
   257  177 C T    >   -     0   0   16  614   35   T TT T TT TT S TT    STTTTTTTTTTTTTTTTTTTTTT  TTTTTT T T TT T STTT   
   258  178 C Q  T 3  S+     0   0  133  614   68   S SS D DD SS E DD    EEAASESQNNNNNDTSKEKNNEE  DENNKD S D SA D GAAD   
   259  179 C N  T 3  S+     0   0   24  614   60   T TN N NR NN N SS    QNNRNNNYAAAAATNNNRRAANN  ANNNNN N A SN N NRRA   
   260  180 C M  E <   - G   0 311B   2  614   13   M MM M MM MM M MM    MMMMMMMMMMMMMMMMMMMMMMM  MMMMMM M M MM M ALMM   
   261  181 C F  E     - G   0 310B   8  613   35   F LF F FI FF L FF    FLFFFFLIFFFFFFFFLFIFFIM  FIIFIV F F FF I FIIF   
   262  182 C j  E     +FG 243 309B   1  614    1   C CC C CC CC C CC    CCCCCCCCCCCCCCCCCCCCCCC  CCCCCC C C CC C CCCC   
   263  183 C A  E     +FG 242 308B   0  614   26   A AA A AA LL A AA    AAAAAAAAAAAAAAAAAAAAAAA  AALAAA V A LA L LAAA   
   264  184 C G  S    S-     0   0    3  614   10   G GG G GG GG G GG    GGGGGGGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
   265  185 C Y        -     0   0   56  591   57   Y RY Y YV FF F YY    YMFVFLKFYYYYYYYHNYVYYRY  YRYFFF F Y FF Y FYFY   
   266  185AC D  S    S-     0   0   81  594   83   L PL K KL LL R LL    QRELLAGQLLLLLLMPSPELLGD  LSLQLL L L LL L LTTL   
   267  185BC T  S    S+     0   0   76  614   61   E SE p pK EE R EE    EQnnEAKQEEEEEEDNQKGEENH  ENEEEE E E EE E ESAE   
   268  186 C K  S    S-     0   0  107  563   32   G .G k kG GG G GG    GGsgGG.GGGGGGGGGEG.GG.G  G.GGGG G G GG G GGGG   
   269  187 C Q  S    S+     0   0  102  569   37   G .G R RG GG R GG    GGRGGG.GGGGGGGGGGQ.GG.E  G.GGGG G G GG G GGGG   
   270  188 C E        +     0   0   33  613   55   K MK G GK KK V KK    KVGKKKQIKKKKKKKNKKKKKQL  KQKKKK K K KK K KRRK   
   271  189 C D  B     -A   94   0A   7  614    4   D DD D DD DD D DD    DDDDDDDDDDDDDDDDDDDDDDD  DDDDDD D D DD D DDDD   
   272  190 C A        -     0   0    7  614   42   S SS A AA SS S SS    SSAASASASSSSSSSSATTSSSA  SSSSSS S S SS S SAAS   
   273  191 C k    >   -     0   0    7  614    3   C CC C CC CC C CC    CCCCCCCCCCCCCCCCCCCCCCC  CCCCCC C C CC C CCCC   
   274  192 C Q  T 3  S+     0   0   90  614   25   Q QQ E EQ DD A QQ    QQQQQQQQQQQQQQQQQQQQQQQ  QQQQQQ Q Q DQ Q DQQQ   
   275  193 C G  T 3  S+     0   0    6  614    8   G GG G GG GG G GG    GGGGGGGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
   276  194 C D    X   +     0   0    0  614    0   D DD D DD DD D DD    DDDDDDDDDDDDDDDDDDDDDDD  DDDDDD D D DD D DDDD   
   277  195 C S  T 3  S+     0   0   14  614    1   S SS S SS SS S SS    SSSSSSSSSSSSSSSSSSSSSSS  SSSSSS S S SS S SSSS   
   278  196 C G  T 3  S+     0   0    0  614    0   G GG G GG GG G GG    GGGGGGGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
   279  197 C G    <   -     0   0    0  614    1   G GG G GG GG G GG    GGGGGGGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
   280  198 C P  E     - H   0 294B   1  614    2   P PP P PP PP P PP    PPPPPPPPPPPPPPPPPPPPPPP  PPPPPP P P PP P PPPP   
   281  199 C H  E     -EH 219 293B   0  614   49   V LV F FL VV L VV    VFFVVVLLVVVVVVVGLYLVVLL  VLVLLV V V LV V VLLV   
   282  200 C V  E     -EH 218 291B   3  614   26   V LV V VT VV L VV    VVSVVILMVVVVVVTVVEVVVLH  VLVVVA V V VV V VVVV   
   283  201 C T  E     - H   0 290B   0  614   66   C LC M MW CC A CC    DCVDCVVCCCCCCCRRCYVCCVL  CVCCCC S C CC C CAAC   
   284  202 C R  E     + H   0 289B  99  614   70   N SS K KD NN K NN    ETDSNNRPNNNNNNSSQEDNNQE  NQNDNN N N NS N NNGN   
   285  203 C F  E >  S- H   0 288B  22  614   71   N NN n sG GG d GG    NnnAGGKtGGGGGNGGkQGGGEg  GEGGGG G G GG G GGGG   
   286  204 C K  T 3  S-     0   0   85  222   71   . G. n n. .. h ..    .pq...Gp........q....Ad  .A.... . . .. . ....   
   287  205 C D  T 3  S+     0   0  108  223   55   . V. N N. .. G ..    .RH...DN........S....DR  .D.... . . .. . ....   
   288  206 C T  E <   - H   0 285B   3  233   75   . K. R R. .. R ..    .QR...KQ........I....KK  .K.... . . .. . ....   
   289  207 C Y  E     - H   0 284B  21  242   51   . F. W W. .. W ..    NWHG..HW........W....LI  .L.... . . .. . ....   
   290  208 C F  E     -cH 200 283B   0  613   91   V FK Y YV EE T EE    VTVKQEETEEEEEQTTYMTEEED  EEEEEE Q E EQ E ERRE   
   291  209 C V  E     + H   0 282B   1  613   38   L IL Q QV II I LL    QLLLLLIVLLLLLLVVQLLLLIL  LILLLL L L LL L LLQL   
   292  210 C T  E     +     0   0B   1  613   84   Q VQ M MV QQ Y QQ    HVLVQVVVQQQQQQYYLIAQQAI  QAQFQQ Q Q QQ Q QDVQ   
   293  211 C G  E     -IH 312 281B   0  613    0   G GG G GG GG G GG    GGGGGGGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
   294  212 C I  E     -IH 311 280B   0  613   19   I II I IV II V VV    VVVAVAIIVVVVVVVVIIVVVIV  VIIVII I V IV I VVVV   
   295  213 C V  E     +I  310   0B   7  613   14   V VV V VV VV T VV    VTIVVVVVVVVVVVVVVTVVVVV  VVVVVV V V VV V VVVV   
   296  214 C S  E     -     0   0B   1  612    0   S SS S SS SS S SS    SSSSSSSSSSSSSSSSSSSSSSS  SSSSSS S S SS S SSSS   
   297  215 C W  E     -I  309   0B  45  613    7   W WW W AW WW F WW    WWWWWWWWWWWWWWWWWWFWWWW  WWWWWW W W WW W WWWW   
   298  216 C G        -     0   0   26  613    0   G GG G GG GG G GG    GGGGGGGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
   299  217 C E  S    S-     0   0   25  609   90   Y VY E AY SS E YY    KKDRYRVEYYYYYFYYEDTYYVQ  YVYYIY Y Y YY Y TVVY   
   300  218 C G  S    S-     0   0   19  612   13   G GG G GG VV G GG    GGGGGGGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
   301  220 C k  S    S-     0   0    7  613    2   C CC C CC CC C CC    CCCCCCCCCCCCCCCCCCCCCCC  CCCCCC C C CC C CCCC   
   302  221 C A  S    S+     0   0    4  612   16   A GA D DA AA A AA    AAGAAAGAAAAAAAAGGGAAAGG  AGAAAA A A AA A AAAA   
   303  222 C R    >   -     0   0  105  611   73   Q RQ R RK MM R EE    LRKRQRRFEEEEEEQDQAREERR  ERQTEQ Q E LQ Q LRRE   
   304  223 C K  T 3  S+     0   0  152  611   64   K EK D DP RR Q KK    PAFPRPAPPPPPPKPAKAKPPPE  KPKKKK K R RR K KPPK   
   305  223AC G  T 3  S+     0   0   26  613   58   N GN G GR GG G DD    SLGQNNGNGGGGGNNRKNDGGGG  DGGGEG N D GN G GNND   
   306  224 C K    <   -     0   0   43  613   85   K YK K KY KK R HH    YKKYKYYKNNNNNQYYKSKNNYY  HYKYKR R H KK K KFFH   
   307  225 C Y        -     0   0   33  613   50   P PP Y YP PP Y PP    PYYPPPPYPPPPPPPPPPPPPPP  PPPPPP P P PP P PPPP   
   308  226 C G  E     -G  263   0B   4  611    2   G GG G GG GG G GG    GGGGGGGGGGGGGGGGGGGGGGG  GGGGGG G G GG G GGGG   
   309  227 C I  E     -GI 262 297B   6  612   11   V VV F FV VV I VV    VIVVVVVVVVVVVVVVVVVVVVV  VVVVVV V V VV V VVVV   
   310  228 C Y  E     -GI 261 295B   1  612    1   Y YY Y YY YY Y YY    YYYYYYYYYYYYYYYYYYYYYYY  YYYYYY Y Y YY Y YYYY   
   311  229 C T  E     -GI 260 294B   2  612   39   A TT T TS TT A AA    AATTATTTAAAAAATTTTTAATT  ATTTTT T A TT T TVAA   
   312  230 C K  E >   - I   0 293B  21  612   42   K RK H HR KK K KK    KNRRKRRRKKKKKKKKKRNKKRR  KRKKKK K K KK K KKKK   
   313  231 C V  G >  S+     0   0    1  611    8   V VV V VV VV V VV    VVLVVVVVVVVVVVVVVVVVVVM  VVVVVV V V VV V VVVV   
   314  232 C T  G 3  S+     0   0    2  609   71   C SC F FS CC E CC    SRFGCGATCCCCCCKASSACCSG  CTCCCC Y C CC C CSSC   
   315  233 C A  G <  S+     0   0   29  609   79   N KK R RA NN N KK    ARNLNNRSIIIIIKKNNYDIIRR  LRNHNN N L NN N NANL   
   316  234 C F  S <> S+     0   0    7  605   35   Y FF L LV YY A FF    VYFFYYYVFFFFFFYYYFLFFYY  FYYYYF Y F FY Y YVLF   
   317  235 C L  H  > S+     0   0   23  603   80   T IV K KR LL L SS    RLIRNLLLNNNNNTTVLI TTLL  NLVIVV V N LN V LRRN   
   318  236 C K  H  > S+     0   0  116  602   68   T PD K KD SS R SS    NHDTSTPSDNDDDTSGLQ NNNK  DKDDDN D D ST N DSSD   
   319  237 C W  H  > S+     0   0   26  602    1   W WW W WW WW W WW    WWWWWWWWWWWWWWWWWY WWWW  WWWWWW W W WW W WWWW   
   320  238 C I  H  X S+     0   0    1  599   12   I II I II II I LL    IIIIIMIVLLLLLLIIII LLII  LIIVII I L II I IIIL   
   321  239 C D  H  < S+     0   0   66  570   71   R KK R QK QQ R QQ    RNLTRKRNTTTTTQNNDD TTHA  EHKNKE R T RR K QQQE   
   322  240 C R  H >< S+     0   0  136  556   71   S SK K KE EE R QQ    E NTSEAKSSSSSQ S D SSTE  RATDEE D Q EN K ESSR   
   323  241 C S  H >< S+     0   0    6  523   72   T NT M VS TT T TT      ENT NITTTTTT Y I TTNN  TNTITT T T TT T SNNT   
   324  242 C M  T 3< S+     0   0   25  479   41   I LV V IV MM I MM      I M MIMMMMMM I I MMMT  MMIMII I M MM I I  M   
   325  243 C K  T <  S+     0   0  153  444   70   N EA   D  AA A SS      D S DAAAAAAA N K AAKP  AKAE A A   AS A A  A   
   326  244 C T    <         0   0   51  390   65   S NS      NN E SS        S ETTTSSTS   N SSED   END A A   AS E A      
   327  245 C R              0   0  197  273   47   N  N      NN N NN        N  K     N   N         NH N N   NN N N      
## ALIGNMENTS  561 -  630
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....7....:....8....:....9....:....0....:....1....:....2....:....3
     1   49 L Q              0   0  101  671   35  Q Q          QQ                         Q                           DD
     2   50 L a    >   +     0   0   22  858    0  C C          CCC                        C                           CC
     3   51 L E  T 3  S+     0   0  187  858   80  A D          AAA                        E                           AA
     4   52 L T  T 3  S-     0   0  105  864   61  E N          ESS                        D                           SS
     5   53 L S    <   +     0   0   89  868   72  K N          NSQ                        R                           FF
     6   54 L P        +     0   0   10  878   31  P M          PPP                        P                           PP
     7   55 L b        -     0   0   18  893   21  C C          CCC                        C                           CC
     8   56 L Q  S    S+     0   0   92  892   83  K V          MLL                        L                           LL
     9   57 L N  S    S-     0   0   63  893   51  N N          NNN                        N                           NN
    10   58 L Q  S    S-     0   0  152  893   57  G G          GQN                        H                           GG
    11   59 L G        -     0   0   16  893   40  A T          AGG                        G                           GG
    12   60 L K  E     -S   23   0G 117  852   79  M .          MSS                        H                           TT
    13   61 L a  E     -S   22   0G  45  882   10  C C          CCC                        C                           CC
    14   62 L K  E     -S   21   0G 155  890   81  L V          SKQ                        K                           QQ
    15   63 L X  E     +S   20   0G 120  768   39  D D          D.D                        D                           DD
    16   64 L G        -     0   0   44  862   73  S K          S.S                        G                           GG
    17   65 L L  S    S-     0   0  152  871   64  V Y          V.I                        I                           VV
    18   66 L G  S    S+     0   0   67  883   63  G Q          G.R                        G                           NN
    19   67 L E        -     0   0  119  837   61  G A          GVG                        D                           GG
    20   68 L Y  E     -S   15   0G  37  883   11  Y Y          YFY                        Y                           YY
    21   69 L T  E     -S   14   0G  71  886   82  D A          DLA                        T                           SS
    22   70 L b  E     -S   13   0G  20  889    0  C C          CGC                        C                           CC
    23   71 L T  E     -S   12   0G  85  890   86  V S          VGT                        T                           TT
    24   72 L c        -     0   0   44  890    0  C C          CFC                        C                           CC
    25   73 L L    >   -     0   0   62  890   88  K N          KLA                        A                           PP
    26   74 L E  T 3  S+     0   0  177  890   75  S H          SLP                        E                           PP
    27   75 L G  T 3  S+     0   0   29  893   20  G G          GQG                        G                           GG
    28   76 L F  E <   +T   36   0H  40  893    9  F Y          FFY                        F                           YY
    29   77 L E  E     +T   35   0H  74  893   73  S E          TmE                        E                           SS
    30   78 L G  S >  S-     0   0   32  889    5  G G          GcG                        G                           GG
    31   79 L K  T 3  S+     0   0  156  891   73  Q R          VTP                        K                           KK
    32   80 L N  T 3  S-     0   0   33  892   62  N Y          HGN                        N                           NN
    33   81 L c  S <  S+     0   0    1  892    3  C C          CSC                        C                           CC
    34   82 L E        +     0   0   87  891   44  Q D          EAA                        E                           SS
    35   83 L L  E    S-T   29   0H  96  889   88  E Q          KFF                        F                           TT
    36   84 L F  E     -T   28   0H 139  889   83  D P          DyA                        C                           PP
    37   85 L T        -     0   0   44  677   75  L l          EvE                        .                           ..
    38   86 L R        +     0   0   57  408   92  T a          TqS                        .                           ..
    39   87 L K        +     0   0   96  535   81  L T          LKE                        .                           ..
    40   88 L L        -     0   0   91  608   90  C N          CRC                        .                           ..
    41   89 L d  S  > S+     0   0   15  617   29  V C          TCH                        .                           ..
    42   90 L S  T  4 S+     0   0   98  624   84  M S          LDP                        .                           ..
    43   91 L L  T >4 S-     0   0  120  627   87  E L          EVL                        .                           ..
    44   92 L D  G >4 S-     0   0  107  638   73  K D          KNR                        .                           ..
    45   93 L N  G >< S-     0   0    8  700   56  D N          DNL                        .                           VV
    46   94 L G  G <  S-     0   0    0  882   52  K G          KGD                        .                           SS
    47   95 L D  G <  S+     0   0   44  887   62  G N          GDG                        .                           KK
    48   96 L e    <   -     0   0    0  892    0  C C          CCC                        .                           CC
    49   97 L D  S    S-     0   0   59  892   74  S D          SKQ                        .                           EE
    50   98 L Q  S    S+     0   0    2  892   63  Q H          QHH                        e                           hh
    51   99 L F  E     -U   62   0I   4  892   80  F E          FFF                        p                           tt
    52  100 L d  E     +U   61   0I  10  893    1  C C          CCC                        C                           CC
    53  101 L H  E     -U   60   0I  68  893   87  K T          KGY                        L                           HH
    54  102 L E  E     -U   59   0I  92  893   68  P D          PTP                        P                           EE
    55  103 L E  S    S-     0   0  100  893   82  g g          gig                        G                           RR
    56  104 L Q  S    S-     0   0  175  693   73  v d          .ne                        .                           NN
    57  105 L N  S    S+     0   0  154  838   66  . g          tF.                        .                           NN
    58  106 L S  S    S-     0   0   58  853   65  S t          SGS                        .                           RR
    59  107 L V  E     -U   54   0I   7  890   79  Y R          YAY                        .                           YY
    60  108 L V  E     -U   53   0I  45  891   88  E R          EKT                        .                           VV
    61  109 L e  E     +U   52   0I   5  893    1  C C          CCC                        G                           CC
    62  110 L S  E     -U   51   0I  24  893   75  S G          SFS                        G                           EE
    63  111 L f        -     0   0   23  893    0  C C          CCC                        C                           CC
    64  112 L A    >   -     0   0    8  893   75  A V          AAA                        E                           AA
    65  113 L R  T 3  S+     0   0  149  893   80  P N          RTR                        E                           RR
    66  114 L G  T 3  S+     0   0   24  893    8  G G          GGG                        G                           GG
    67  115 L Y  E <   -V   78   0J  20  893   11  W Y          WYH                        L                           YY
    68  116 L T  E     -V   77   0J  72  891   85  K N          REK                        H                           GG
    69  117 L L  E     -V   76   0J  67  888   64  L L          VLL                        R                           GG
    70  118 L A    >   -     0   0   23  889   78  S Q          KMG                        E                           LL
    71  119 L D  T 3  S+     0   0  175  889   77  t D          DSQ                        p                           NN
    72  120 L N  T 3  S-     0   0   92  694   44  d D          .DD                        g                           CC
    73  121 L G  S <  S+     0   0   16  713   66  R S          KGR                        G                           QQ
    74  122 L K  S    S+     0   0   71  687   76  N R          VVR                        Q                             
    75  123 L A        -     0   0   22  685   66  T T          KSS                        A                             
    76  124 L f  E     -V   69   0J  12  847    9  C C          CCC                        C                             
    77  125 L I  E     -V   68   0J  78  846   80  M R          EEL                        D                             
    78  126 L P  E     -V   67   0J  62  850   71  P P          AAP                        V                             
    79  127 L T  S    S+     0   0  103  652   80  A K          ATH                        .                             
    80  128 L G  S    S-     0   0   32  788   69  V G          VVD                        .                             
    81  129 L P  S    S+     0   0  116  601   75  P P          RER                        .                             
    82  130 L Y  S    S+     0   0   59  794   86  K S          YFC                        .                             
    83  131 L P    >   -     0   0   17  799   62  P S          PPA                        .                             
    84  132 L g  T 3  S+     0   0   16  800    5  C C          CCC                        C                             
    85  133 L G  T 3  S+     0   0    0  712   37  G G          GGG                        S                             
    86  134 L K    <   -     0   0   69  588   68  R Q          QKT                                                      
    87  135 L Q        -     0   0   37  477   65  L L          VTL                                                      
    88  136 L T        +     0   0    4  428   78  S L           G                                                       
    89  137 L L        +     0   0  105  372   61    I           L                                                       
    90  138 L E              0   0  104  274   69    G           T                                                       
    91  139 L R              0   0  231  199   47    R                                                                   
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2   I IIIIIIIIII   IIIIIIIIIIII IIIIIIIIIII IIIIIIIIIIIIIIIIIII IIIIIII  
    94   17 C V  B     -A  271   0A   7  590    9   V VVVVVVVVVV   VVVVVVVVVVVV VVVVVVVVVVV VVVVVVVVVVVVVVVVVVV VVVVVVV  
    95   18 C G  S    S+     0   0   25  591    6   G GGGGGGGGGG   GGGGGGGGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGGGG GGGGGGG  
    96   19 C G  S    S-     0   0   26  592    0   G GGGGGGGGGG   GGGGGGGGGGGG GGGGGGGGGGG GGGGGGGGGGGGGGGGGGG GGGGGGG  
    97   20 C Q  E     -B  237   0B  98  593   95   Y YYYYTREDYY   YQRSYYTKYYYY TEHDQYYFYYY YVYFYTTTEEEVFYQVVYY WSTYYSY  
    98   21 C E  E     -B  236   0B  80  594   67   E EEETEEFYTT   DPPPEEDNETEE SDDEEEEPEEE TKEEETQAEKEKEEEKKEE PQETESE  
    99   22 C h        -     0   0    8  594   58   C CCCCATVVCC   DTTACCATCCCC VVTSTCCVCCC CACCCAAAIAIAICAAACC AAVCCVC  
   100   23 C K    >   -     0   0  123  593   78   T LLKASSNPEE   TGGKRLTSTPKE KDSTRKKDKQQ EKTTKQKPSLSQDQTKKTK RSEARNE  
   101   24 C D  T 3  S+     0   0   60  594   85   P KKAKNIIIEE   IIVEKKLIPKAP IIIPRAAIPKK EAPRPQPKIAIAIHPAAPK KAPAKIP  
   102   25 C G  T 3  S+     0   0    0  595   74   H NNHNDEETNH   ENNNNNGSYHYH ESDHGYYKHNN NGHNYGGNNGNGLHHGGHN GGGNNEY  
   103   26 C E  S <  S+     0   0   36  595   66   S SSSSEEEESS   NEQASSEESSSS NTKSSSSESSG SDSGSGDAKEKDESSDDSA EEASSNS  
   104   27 C h    >   +     0   0    4  595   92   Q VVQLFHVAII   VFYYVVFVQVQQ FCHWWQQAQVV VCQVQWWWVCVCVQLCCQL FFFVVFQ  
   105   28 C P  T 3   +     0   0    0  599    9   P PPPPPPPPPP   PPPPPPPPPPPP GGPPPTPPPAA PPPPPPPPPPPPPPPPPAP PPPPAGP  
   106   29 C W  T 3  S+     0   0    5  600   26   H YYWYWWYYYY   YWWWYYYYWYHW WWHWWHHYWYY YYHYHWWWYYYYYHWYYHY WYWYYWW  
   107   30 C Q  E <   -J  122   0C   7  601   26   Q QQQQMQQQQQ   TMLMQQqlQQQQ QQQqqQQQQQQ QQQQQQQQqQqQQQqQQQQ qQqQQQQ  
   108   31 C A  E     -JK 121 146C   1  593   49   V AVVVAVAAVV   VAAAVVeaVVVA VVVlaVVVAVV VIVVVAVAlIlIIVtIIVVAaVmVVVA  
   109   32 C L  E     -JK 120 145C   3  598   68   S SSSSKSTQSS   SRRASSTMSSSS SSSRISSSTSS SSSSSQQQLSLSSSYSSSSMISLSSSS  
   110   33 C L  E     -JK 119 144C   0  601    9   L LLLLLLLLLL   LLLLLLFLLLLL LFLFLLLLLLL LLLLLLLLLLLLLLFLLLLLLLWLLLL  
   111   34 C I  E     -JK 117 143C   0  601   81   N FFNNIQHLNN   NSVYNFINNNNN FHIRTNNQNNN NQNNNRRRQQQQQNNQQNSHEQDNNFN  
   112   35 C N  E >   - K   0 142C  30  601   88   A TTAVYAWQSS   KYYYSTGNVDSA DNYyKSSFTAA ASASSTSSKSKSSAgSSSSRDDiSSDA  
   113   36 C E  T 3  S+     0   0   63  117   78   . ......F...   I........... ...e....... .....SRA......v....T..p....  
   114   37 C E  T 3  S-     0   0  136  242   77   . .....YNL..   G.....F..... RR.NW...... .....TESD.G...S....PGNT..R.  
   115   38 C N  S <  S+     0   0   84  565   53   G GGGGIGAGGG   FFDNGGSGGGGG KKTFHGGSGGG GSGGGGGGNSNSYGESSGGRKIRGGMG  
   116   39 C E        -     0   0  100  589   94   Y YYYYKFVSYY   GNGNYYFNYIYY GGNGEYYSYYY YSYYYYYFESESGYHSSYYGYGNSYGY  
   117   40 C G  E     +J  111   0C  14  600   57   H NNHHRHVAHH   HRQRHNHFHSHH HHHHQHHHHHH HHHHHPPPYHYHHHAHHHHPHHRHHHH  
   118   41 C F  E     +     0   0C  28  611   33   F FFFLfFLIFF   FfffFFFFFhFFLFFNWYFFFFFF FFFFFYYFfFfFFFYFFFFFSFyFFFF  
   119   42 C i  E     -J  110   0C   0  612    1   C CCCCcCCCCC   CcccCCCCCcCCCCCCCCCCCCCC CCCCCCCCcCcCCCCCCCCCCCcCCCC  
   120   43 C G  E     -J  109   0C   1  612    1   G GGGGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGSGGGG  
   121   44 C G  E     -J  108   0C   0  612    9   G GGGGGGAAGG   GGAGGGAGGGGGAGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGG  
   122   45 C T  E     -JL 107 130C   0  612   45   S IISSMSATSS   TMSSSISSSSSSSSSSSVSSSSSS SSSSSTTTSTSSSSSSSSSTVTSSSSS  
   123   46 C I  E     + L   0 129C   0  612   23   L LLLLLIIILL   LLLLLLIVLLLLLIILILLLVLLL LILLLLLLIIIIILLIILLLLLLLLIL  
   124   47 C L        -     0   0    6  612   27   V LLVIIIIIII   IILVILYVIIVVIIIIILVVIIII ILVIVIIVILILIVILLVILILIIIIV  
   125   48 C S  S    S-     0   0   22  612   56   N SSNSNSDSSS   SNTTSSNANNNNSSGAATNNSRSS SDNSNHHHSDSDGSSDDSSGDNNNSSN  
   126   49 C E  S    S+     0   0   99  612   63   Q EAEDDEKEDD   FDRDSAEPQDEEDDKKRPEESDSS DEQNEPPPKEKEEEREEASDNSKSSDE  
   127   50 C F  S    S+     0   0   42  612   83   N EENQRSSYQQ   ERDRSENNNQNNQEENNSNNRQQQ QYNLNEQRRYRYNNEYYNYQCRRQTEN  
   128   51 C Y  E     - M   0 185C   7  612   34   W WWWWYIWWWW   WYYYWWYLWWWWWWWWWWWWFWWW WWWWWWWFHWHWWWWRWWWWWWWWWWW  
   129   52 C I  E     -LM 123 184C   0  612   14   V VVVVVIILVV   VVVIVVAVVVVVIVIVVVVVIVVV VIVVVVIVIIIIVVIIIVVVVVVVVVV  
   130   53 C L  E     +LM 122 183C   0  612   27   V LLVLLLLVVV   LLLLVLIVVLVVLLLLVLVVLIVV VLVVVLLVLLLLLVALLVVLLLIVVLV  
   131   54 C T  E     - M   0 182C   0  612   43   S SSSTSTTSSS   TTTTSSTTSSSSTTTTTTSSTSSS STSSSTTTTTTTTSTTTSSTTSTSSTS  
   132   55 C A    >>  -     0   0    0  613    2   A AAAAAAAAAA   AAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAA  
   133   56 C A  G >4 S+     0   0    0  613    9   A AAAAAGAAAA   AAAAAAGAAAAAAAAAAAAAGAAA AAAAATTSAAAAGAAAAAAAAAAAAAA  
   134   57 C H  G >4 S+     0   0    7  613    0   H HHHHHHHHHH   HHHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHH  
   135   58 C i  G X4 S+     0   0    0  613    1   C CCCCCCCCCC   CCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCC  
   136   59 C L  G << S+     0   0   31  613   66   Y KKYYVATFYY   LVVVYKAVYYYYIVVIVLYYVWYY YVYYYLLIIVIVAYAVVYYLFQIYYVY  
   137   60 C Y  G <  S+     0   0  109  613   87   Q APKKKSYEKK   VKRFKPYYQKKKLYTSFRKQFVKK KNQKKKKVEAENDKKNNKKVEERKKFK  
   138   61 C Q  S <  S+     0   0   95  613   78   S DKSSgyKDSS   ggrrSKgeSRSSydkSgrSSeSSS SgSSSgnkGgGgdSdggSSnqSeSSdS  
   139   61AC A        -     0   0   16  373   75   . ....wpK...   pwrp..ph...Papi.rr..aP.. .a...appIaIad.aaa..knPe..pP  
   140   62 C K  S    S-     0   0  172  387   77   . .S..FDS...   DFNA.SSK...SNKETAR..NY.. .K...SQSSSSKV.EKK..DKNQ..KS  
   141   63 C R  S    S-     0   0  162  602   78   R .DRRMLHTRR   DMKRRDGSR.RRDQGYNRRREARR RKRRRRDSKKKKGRDKKRRSTRDRRQS  
   142   64 C F  E     -K  112   0C  36  609   54   V LVILIVLYII   LIIFIVLLILVLIYLYFVVVFQII ILVVVVILVLVLLIMLLVIFYLFIIYL  
   143   65 C K  E     -K  111   0C  67  609   79   E EEEQKTTGQQ   YKRRQEQAEQEELGKRKIEESIQQ QSEQEHVRTSTSNERSSEQSSSIQQAE  
   144   66 C V  E     -KN 110 161C   0  609   16   V VVVVVIVMVV   VVVVVVIFVVVVVVVVVIVVVVVV VIVVVIIIVIVIVVIIIVVVIIVVVVV  
   145   67 C R  E     -KN 109 160C  40  609   55   R RRRRTRRSRR   RTIQRRVRRRRRRRRRRRRRRIRR RRRRRRRRRRRRRRWRRRRKVVRRRRR  
   146   68 C V  E     +KN 108 159C   1  610   43   L LLLLFVTILL   AFLLLLAALLLLVVVVVTLLVLLL LYLLMLLLIYINVLLYYLLLVALLLVL  
   147   69 C G  S    S+     0   0    9  610   15   G GGGGGGGLGG   GGGLGGGGGGGGGGGGGGGGGGGG GNGGGGGGGNGNGGGNNGGGGGGGGGG  
   148   70 C D        +     0   0   11  611   58   E EEEEETATEE   SEDVEEESEEEEKSSSDEEEAEEE ETEEEAAASSSTSESTTEEKDEKEESE  
   149   71 C R  S    S+     0   0   24  611   73   H HHHHHSRGHH   THHYHHLSHHHHHSNSHWHHTHHH YLHHHHQHSLSLSHHLLHHHLWHHHSH  
   150   72 C N  B >   -P  234   0D  18  611   65   H NDNDNIYSNN   YNDNNDDKNNNHYLEISDNNDHNN NKHNNRRRNKNKLHDKKNNKSDTNNLH  
   151   73 C T  T 3  S+     0   0   56  611   80   I IIIIRMSTII   KRQRIIMAIIIIRRHKQLIIRIII IHIILRRRSHSHHILHHIIAKLSIIHI  
   152   74 C E  T 3  S-     0   0  119  611   84   R WWQDCESYEE   NCFTAWSNQDKGANNNMTKQQWNN DARDRTLANSNAGRTAAKARRSVDANR  
   153   75 C Q  S <  S-     0   0  130  610   85   N EEVVNSERVV   KDLQVEVVIVVLKKKSIYVVNEVV VSNAVKEDKLKSSVKSSVVDVRRVVKV  
   154   76 C E        +     0   0  165  610   85   N PPTLAGESLN   GDTpHPNGNLTNFGGGTDTTDFNN LGNTNGSSGGGGGTQGGTNKENgLTGN  
   155   77 C E        -     0   0   93  469   27   D DDEE..GKEE   .ATtEDE.EEEEE.G.EEEE.EEE E.DEESVG.....EE..EEDEEeEE.E  
   156   78 C G  S    S+     0   0   46  578   34   G GGNG.GHGGG   GVENGGGGGGGGKGRGPGGG.GGG G.GGGGGEGGGGGGS..GNTGGAGGGG  
   157   79 C G  S    S+     0   0   47  585   75   T TTTDtSRGDN   TrtSTTSVTGSTqVLVSSSS.TTT N.TTTNEsTETEQSS..NTTTHNNSFT  
   158   80 C E        -     0   0   37  472   30   E EEEEr...EE   .ea.EEE.EEEEe...EEEEGEEE EGEEEEEv.....ERGGEEEEEEEE.E  
   159   81 C A  E     -N  146   0C  27  487   57   Q QQQQP..QQQ   .TI.QQQ.QQQQK...IFQQEQQQ QEQQQQQQ.....QVEEQQQQQRQQ.Q  
   160   82 C V  E     -N  145   0C  71  590   83   F HHFFEV.KFF   IRQVFHIVFFFFIL.VTDFFLYFF FKFFFDDDVKVKLFKKKFFTETSFFIF  
   161   83 C H  E     -N  144   0C  14  599   76   I IIIITHHHII   RFREIIIVIIIIVHYHVQIIFMFL IIIIIFIFYIYIVIRIIIIVFRYIIHI  
   162   84 C E        -     0   0   90  602   78   T MMPQRQKQNN   KVARDMTKSDSGARDSDRSSEANN NQTNRRNRTSTQPSSQQSNQESINNKR  
   163   85 C V  E     -O  186   0C  27  607   64   S SSSAFVIISS   VLVSSSVASASALIIVLPSSIVSS SVSSSVVVAVAVVAVVVSSVIVVASIA  
   164   86 C E  E    S+     0   0C  70  608   73   S SSAAVAAEAA   QRTVASSKSESSDSKKAVSSQDAA AASAAITKKAKAKSIAASAALAEAAAS  
   165   87 C V  E     -O  185   0C  13  609   72   R KQLKIQKKKK   RAAKKQKKRKRHERENEHRRNAVV KERKRRRRSKSERRKEERKRVRRKKKK  
   166   88 C V  E     -O  184   0C  72  610   46   V FFVIRIIVVV   VIIAVFIVVIVVIVIQLEVVVIVV VIVVELIIKIKIVIKIIVVIVVIIVVV  
   167   89 C I  E     +O  183   0C  27  610   43   I VIIIVVIIII   IAIIIIIHIIIIIHKIQFIIIYVV IYIIIVIIVFVYIIIYYIIVHIIIIYL  
   168   90 C K  E     -O  182   0C  68  610   82   R RRRQIREIRR   PQRRTRLVRRRRLIKKIVRRRWKK RQRRRTKKAAAQQRQQQRKVVVVTSIR  
   169   91 C H    >   -     0   0   19  611   13   H HHNHSHHHHH   HKHTHHHHHHHNHHHHHHHHHHHH HHHHHHHHHHHHHHNHHHHHHHHHHHN  
   170   92 C N  T 3  S+     0   0  156  611   61   P PPPPNEPRPP   EFRFPPEPPPPPPPPPPPPPPQPP PEPPPPPEPEPEPPPEEPPPEPPPPPP  
   171   93 C R  T 3  S+     0   0  150  608   73   S QDNNKKEGRK   RSSFRDNKNDNNKDRKEDNNKSRR NNSRNNSRKKKNQSHNNNRANNDNRDN  
   172   94 C F    <   -     0   0   24  611    5   Y YYYFFFYYFY   YFFYYYFYYYYYYYYFYFYYYYYY YYYYYYYYYYYYYFYYYYYFYYFFYYY  
   173   95 C T     >  -     0   0   56  611   68   N NNDHSeDDNS   sLDSNNDDNNSNnDngNDSSNDNN NDNNShssNDNDNNNDDTSNtNNNSDN  
   174   96 C K  T  4 S+     0   0  145  561   78   S PPSKLkDESS   e.Q.SPYDSKSSkTrsKMSSGYGG SSSS.pppSSSSPRASS.DFvDGGSES  
   175   97 C E  T  4 S+     0   0  174  569   91   Y RRWDTRKYWW   I.N.YRNQWDYWEVTATTYYQQNN WMYN.VVVKYKMSYPMM.RTTNDNYVW  
   176   98 C T  T  4 S-     0   0   44  598   57   T TTTTNGTTTS   NNSGNTLFTTNDNSRTTTNNTTNN ITTNSGRNTQTTTTTTTSNTDTTTNSD  
   177   99 C Y    ><  +     0   0   60  604   65   I QQILFIVNLL   LFYLLQLVIVILLYYLFIIIILLL LIILYYYLKIKIILTIIYLFSLYLLYL  
   178  100 C D  T 3   +     0   0   25  609   37   D DDDNDpDDDD   DDNtDDDDDDDDDDDDSDDDDDDD DDDDnAAANDNDDEDDDnDLnNEDDDD  
   179  101 C F  T 3  S+     0   0   21  595   66   N SSNNNnNNYN   FNHnNSNYNNNSRNFFNSNNYFNN NNNNnNYNNNNNFNYNSnNSyHSNNNS  
   180  102 C D    <   +     0   0    1  609    0   D DDDDDDDDDD   DDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDD  
   181  103 C I        +     0   0    0  611   13   I IIIIIVIIII   IIIIIIIVIIIIIVVFLIIIFIII IVIIIIIIFIFVFIIVVIIIIIVIIVI  
   182  104 C A  E     -MO 131 168C   0  611   60   M MMMMAAASMM   GAAAMMSAMMMMAAAAAAMMAMMM MAMMMAAAAAAAAMAAAMMAAMAMMAM  
   183  105 C V  E     -MO 130 167C   0  612   16   L LLLLLVLLLL   LLLLLLLVLLLLLLLLVLLLILLL LLLLLLLVILILLLLLLLLLLLLLLVL  
   184  106 C L  E     -MO 129 166C   0  613   30   I IIIILLIIII   VLLMIILVIIIILLLLLVIIIMII IIIIILLIVIVILLLIIIILLILIILI  
   185  107 C R  E     -MO 128 165C  40  613   43   K KKKKRKKKKK   QRKEKKKEKKKKHKRERKKKEKKK KKKKKKKETKTKEKQKKKKKREQKKKK  
   186  108 C L  E     - O   0 163C   0  613   16   L LLLLLLLLLL   LLLLLLLLLLLLLVILLLLLLLLL LLLLLLLLVLVLLLLLLLLLLVLLLVL  
   187  109 C K  S    S+     0   0  101  613   69   S SSSANKEVSS   KNRTSSSQSKSSREADNQSSEASS SKSSSDRENKNKESDKKSSERSASSES  
   188  110 C T  S    S-     0   0   82  614   74   T RRRSETTKSS   RDKFSRGQQSKKKTKETKKKTHQQ STTQERKQKSKTQQKTTEQSKSLSSKK  
   189  111 C P        -     0   0   48  614   39   P PPPPRPPSPP   PRPPPPSDSPPPPKPPKPPPEPPP PPPPPPPPDPDPPPAPPPPPkPpPPRP  
   190  112 C I        -     0   0    4  562   63   A AAAAVIIIAA   .VVVAALLAAAALFIVLVAAIVAA AMAAAAAAMMMTVAVMMAAAa.vAAFA  
   191  113 C T        -     0   0   95  566   73   T TTTTPQEKAV   .PDTRTTESITTTKATQNTTQTTN VTTTSKERAKATQTETTTTRQ.TTKRT  
   192  114 C F        +     0   0   56  612   34   L LLLFMLFFLL   LIFILLFFVLLLFLYVYRLLFVLL LLLLLLLLILILLLFLLLILLFFLLLL  
   193  115 C R  B >   -Q  196   0E  52  613   63   N NNNSSGSNTN   pTSsDNNNNNNNTntTTSNNDNNN NdNNNDNNdnddSNNddNNNTnTNNnN  
   194  116 C M  T 3  S+     0   0   29  594   77   Q SSEADK.EGA   dDKdSSDKNSTSErcKRSTTEQSS AtQSQRKRkkktEQEttQNPDsESSkG  
   195  117 C N  T 3  S+     0   0   13  602   90   Y FFYRATERQR   YFTRYFNNYQYYNSTDESYYTFYY RNYYYYFATNTNEYYNNYYYHWYRYSY  
   196  118 C V  B <   +Q  193   0E   0  604   27   V VVVVISKQVV   IIILVVVVVVVVIVVVVVVVKVVV VAVVVVIVTATAFVVAAVVVVVIVVVV  
   197  119 C A        -     0   0    1  606   80   Q RSQSKQDKSS   DRKVRSAQQSQQVRVNRDQQQKKK AKQQQNNNKKKKFQRKKQRSRSLARRQ  
   198  120 C P        -     0   0    8  608   54   P PPPTPPRATT   WPPPTPPPPTPPPKPIPFPPPPTT TPPTPFLLIAIPAPPPPPTPTPPTTTP  
   199  121 C A        -     0   0    2  609   39   V AAVVIVPVII   IIVVVAIVVVVVIVVIVAVVIVVV IVVIVAVAIVIVVVIVVVVIAVIVVVV  
   200  122 C g  B     -c  290   0B   1  610   66   S VAASCPISSS   PCCCSAAEASAACKAKCCAAEASS SPSAACCCTGTPEACPPASCCSCSSKA  
   201  123 C L        -     0   0   27  612    5   L LLLLLLGLLL   LLLLLLLVLLLLLLLLLILLLLLL LLLLLLLLLLLLLLLLLLLLLVLLLLL  
   202  124 C P        -     0   0    7  613   30   P PPPPPFIAPP   IPPPPPPTPPPPPVAVAPPPPPPP PPPPPPPPAPAPPPPPPPPLPPPPPVP  
   203  124AC E     >  -     0   0   92  612   75   S SSKTTEARSS   MTKQSSEKSRSTTDEDKRTTESSS RPSSTDHTKAKAETEPPTSSTTERSDT  
   204  125 C R  H  > S+     0   0  109  612   78   G KRDSDKKVAA   YDDPSRQTSSSRKETQSKSSQRSS AQGSSQGQEKEQQSAQQSSESSISGER  
   205  126 C D  H  > S+     0   0  124  612   85   C CCCCKGSACC   DPRNCCGECCCCKDGDDECCDCCC CGCCCVMSGGGGDCQGGCCEAMPCCDC  
   206  127 C W  H  >>S+     0   0    4  612   88   A AAAPTEYPAA   TASDAAHPPAAAVHKVVDAAEPAA ASAAAPQNSSSSQAKSSAAANVEAAHA  
   207  128 C A  I  X>S+     0   0    0  612   75   P AAPSLEDKPA   TKESGATTPSPPAEEEKTPPETAA ADPGPEIESDSDEPRDDPGAQSAASEP  
   208  129 C E  I  <5S+     0   0   75  613   82   A DDATLAETAA   RTPIADAEATAAKVVLELAAVPAA PVAAAPPIVVVVVAAVVATTFVRAAVA  
   209  130 C S  I  <5S+     0   0   70  614   66   G GGGGYIPGGG   PYAYGGTNGNGGTDPTMPGGVGGG GKGGGKAQPKPKEGIKKGGTPGRGGDG  
   210  131 C T  I  <5S+     0   0   18  108   73   . ..........   ............L........... ...................T.TL....  
   211  131AC L  I ><  S-     0   0  119  503   80   M sDMss.SGss   kKS.sDSAMSMMSSMGQDMMKdSS SeMA.SSSseseq.See.S.NsVSGSM  
   227  146 C E  T 3  S+     0   0   47  527   75   S VESFEEEESS   QEEASEEESISNSEVSGTSSNSSS SGSSMSPEEGEGN.FGG.SDTSGSSEN  
   228  147 C K  T 3  S+     0   0  169  548   68   P RGSGENNYGG   KDGLGGGNSGSPPSGGTHSSGEGG GSPGSHGGGSGSP.RSS.GQDGGGGSP  
   229  149 C G  S <  S-     0   0   29  559   66   A ASTVGGGQTI   EGGGVSGGTGTAQGGGALTTMVSS TYASSGGGGYGYS.GYY.TGDTRSSGA  
   230  150 C R        -     0   0  213  584   86   D RRAKKDDRNN   TKTGNRNRAKAVSPPPQFAAEFNN NSDNTSWSSSSSEANSSANFFNTSYPV  
   231  151 C Q  B     -R  224   0F  79  599   93   D YYDYVHTAYY   QPLLFYTLDYDSLKAINGDDSNYY YLDYDAASSLSLSDTLLDYISYSYYNS  
   232  152 C S        -     0   0   14  607   51   G PPRPSPSSPP   FSPSPPPARPKGPPSTDTSKDPPP PPGPSPPPSPSPNSSPPRPAPPEPPPG  
   233  153 C T  S    S+     0   0   48  608   73   D DDNSCESTEE   QCGADDDTNANDQVTNNDNNIFDD ESDSNDITTSTSENPSSNDNNDKSDVD  
   234  154 C R  B    S-P  150   0D 102  608   85   K KKKLTVITLL   LIITNKVTKLKKVNHVVIKKVNRR LEKRRINVTETEARTEEKRETKLLRKK  
   235  155 C L        -     0   0    3  610    3   L LLLLLLLLLL   LLVLLLLLLLLLLLLLLLLLLLLL LLLLLLLLLLLLLLLLLLLLLLMLLLL  
   236  156 C K  E     -BD  98 221B  31  610   51   Q QQQQQQKKQQ   KQQQMQQQQQQQQQKQQRQQRQRR QQQMQQRMRRRQRQQQQQRRMQKQMQQ  
   237  157 C M  E     -BD  97 220B  18  611   94   C CCCCETSVCC   SEHECCKSCCCCQGGEEECCACCC CRCCCQQQARARACVRRCCEKKVCCGC  
   238  158 C L  E     - D   0 219B   4  612   44   L LLLLVVAALL   AVVLLLVVVLLLIVVVVALLALLL LVLLLAAVVVVVTLAVVLLVAVVLLVL  
   239  159 C E  E     - D   0 218B 107  612   72   N EEEDEDYTDD   VEDMDETYEENEHKKERPNNMDDD DDNWDTSEHDHDNDVDDNDFRDSKDKE  
   240  160 C V  E     - D   0 217B   0  612   46   I AAIAVVVVAA   VVVVAAVVVAIILVVVVVIIVIAA AIIALVVVVIVIVIVIIIALVVLAAVI  
   241  161 C P  E     - D   0 216B  34  612   28   P PPPPPPPPPP   QPPPPPPPPPPPPPPPPPPPPPPP PDPPPPPPQAQDPPPDDPPPPPPPPPP  
   242  162 C Y  E     -F  263   0B  36  613   46   I LLIVVIIVLL   IVIIILLVIVIIIYIFIIIISIII IVIIIVIIAVAVAIIVVIILLYVVIFI  
   243  163 C V  E     -F  262   0B  24  614   37   L LLLLLVMVLL   VILLLLVVLLLLVVVIIVLLVILL LVLLLVVVHVHVVLVVVLLVLIVLLVL  
   244  164 C D     >  -     0   0   88  613   57   S SSSSSTNDSS   SSTTSSSDSSSSQDSDATSSNSSS TSSSSGSSSSSSSSSSSSSDPSSSSDS  
   245  165 C R  H  > S+     0   0   51  613   78   D DDKDNKQQQQ   KNLNDDDRDAYEQQNFRDYYQHDD QRDDERRADRDRQDRRRKDTHRLDDHD  
   246  166 C N  H  > S+     0   0  105  614   74   S NDKTESEKDA   NDDATDEEESSSEDENETSSDESS AESSRAASDKDEEEEEEESNASRSSDN  
   247  167 C S  H  > S+     0   0   48  614   78   D TTDAEIKTQQ   AVQKSTDTDSDDTTETTKDDKVSS QQDSDRRTEEEQEDTQQDSTDDRSSTD  
   248  168 C j  H  X S+     0   0    1  614    2   C CCCCCCCCCC   CCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCC  
   249  169 C K  H >< S+     0   0   88  614   73   S FFQHrneaKE   qsrrRFrdNKNSRsnRnQNNNERR EdSKDMESKnKdrNnddDRNSnrKRsS  
   250  170 C L  H 3< S+     0   0  150  574   89   N NNNNkearAA   ankgNNdlNKNNDvgKtDNNHRNN AsNNNKV..s.ssSrssNNKRspSNvN  
   251  171 C S  H 3< S+     0   0   23  604   76   S AASSYDYYAS   LYYYSAYKSSSSSFGSWASSASSS SKSASATRKKKKYSSKKAATRAQSSFS  
   252  172 C S    <<  -     0   0   20  607   83   Y YYYYTMFIYY   YTRWYYGPYYYYTALYYFYYYYYY YAYYYYYAYAYAGYYAAYYYYYYYYTY  
   253  173 C S  S    S+     0   0   79  607   83   P PPPPPFLRPP   RSAPPPAVPPPPKGDSGEPPDPPP PGPPPRPYFNFGGPHGGPPDRDAPPGP  
   254  174 C F  S    S-     0   0  124  607   79   G FFGGSGDDGG   KSSFGFDVGGGGIKDTGYGGDGGG GAGGGGKGRARAYGGAAGGFNGQGGKG  
   255  175 C I        -     0   0  100  608   87   M QQMKMGPPQQ   VMRQGQEGMQMMRDKSKEMMEQQQ QDMQMQRRSESDQMQDDMQTKEEQKQM  
   256  176 C I        -     0   0   13  609   18   I IIIVIIIIII   IIIIIIILIIIIVIILVIIIIIII IVIIIILLLVLVIIIVVIIVMIIIIII  
   257  177 C T    >   -     0   0   16  614   35   T TTTTTPTTTT   TTTTTTLTTTTTTTSTTTTTTTTT TSTSTHHHTTTSTETSSTTTTTSTTTT  
   258  178 C Q  T 3  S+     0   0  133  614   68   N EKNDNDKNEE   RDSGAKDPKSNSDEDDNTNNDNSS EENSNEDESDSEDNTEENSSPAQGSDS  
   259  179 C N  T 3  S+     0   0   24  614   60   S NNSNNGNNNN   NNNRNNSRANATNNSRNNAARNNN NNSNASSSNNNNRTRNNANDRNNNNNT  
   260  180 C M  E <   - G   0 311B   2  614   13   M MMMMMQMMMM   MMMMMMMMMMMMMMMMMQMMMMMM MMMMMMMMMMMMMMMMMMMMMMMMMMM  
   261  181 C F  E     - G   0 310B   8  613   35   F IIFFLIFFVV   MMLLFIIFFFFFFLFFIMFFIVFF IIFFFLLVFIFIIFLIIFFILFFIFLF  
   262  182 C j  E     +FG 243 309B   1  614    1   C CCCCCCCCCC   CCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCC  
   263  183 C A  E     +FG 242 308B   0  614   26   A AAALAAAAAA   AAAAAAAAALAAAAAAAAAAAAAA AGAAAAAAAGAGAAAGGAAAAAAVAAA  
   264  184 C G  S    S-     0   0    3  614   10   G GGGGGAGGGG   GGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGG  
   265  185 C Y        -     0   0   56  591   57   Y YYYFYFDKFF   AYKYFYVLFFYYFVFFYYYYYYFF FDYFYLYRPDPDYYYDDYFFYYRFFVY  
   266  185AC D  S    S-     0   0   81  594   83   L LLLLPPGGLL   QLGILLPELLLLSRPLPRLLTLLL LVLLLDDAPVPVQLTVVLLQLMRLLKL  
   267  185BC T  S    S+     0   0   76  614   61   E EEEEkAKPEE   KgKEEEEGEEEEpREgEREEEEEE EaEEEAQSEaEaAEEaaEEAqSEEEKE  
   268  186 C K  S    S-     0   0  107  563   32   G GGGGgG..GG   .g.GGGG.GGGGiGGgGGGGGGGG GgGGGGGGGgGgGGGggGGGgGGGGGG  
   269  187 C Q  S    S+     0   0  102  569   37   G GGGGQG..GG   .K.GGGG.GGGGSGGGRGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGG  
   270  188 C E        +     0   0   33  613   55   K KKKKKKTTKK   HKQRKKKKKKKKGKKKKVKKKKKK KVKKKVIIKKKVKKVVVKKKVKKKKKK  
   271  189 C D  B     -A   94   0A   7  614    4   D DDDDDDDDDD   DDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDD  
   272  190 C A        -     0   0    7  614   42   S SSSSSTAASS   ASSSSSSSSSSSSSSASTSSASSS SSSSSASSSSSSASTSSSSATSASSSS  
   273  191 C k    >   -     0   0    7  614    3   C CCCCCCCCCC   CCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCC  
   274  192 C Q  T 3  S+     0   0   90  614   25   Q QQQQQQQQQQ   QQQQQQQQQDQQEQQQQAQQQQQQ QQQQQQQQQQQQQQQQQQQRNQEQQQQ  
   275  193 C G  T 3  S+     0   0    6  614    8   G GGGGGGGGGG   GGGGVGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGG  
   276  194 C D    X   +     0   0    0  614    0   D DDDDDDDDDD   DDDDDDDDDDDDDDDDDDDDDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDD  
   277  195 C S  T 3  S+     0   0   14  614    1   S SSSSSSSSSS   SSSSSSSSSSSSSSSSSSSSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSS  
   278  196 C G  T 3  S+     0   0    0  614    0   G GGGGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGG  
   279  197 C G    <   -     0   0    0  614    1   G GGGGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGG GGGGSGGGGGGGGGGGGGGGGGGGGGG  
   280  198 C P  E     - H   0 294B   1  614    2   P PPPPPPPPPP   PPPPPPPPPPPPPPPPPPPPPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPP  
   281  199 C H  E     -EH 219 293B   0  614   49   V MLVVLLAGVV   MLLLVLLLVVVVFLVVLLVVLLVV VVVLVMMMAVAVLVLVVVVLLVFVVLV  
   282  200 C V  E     -EH 218 291B   3  614   26   V MMVVVVVVVV   IVLQVMAVVVVVVVVVVMVVVVVV VVVVVVVVVVVVVVAVVVVAVVAVVVV  
   283  201 C T  E     - H   0 290B   0  614   66   C CCCCTIVICC   CAVVCCADCCCCMDDVCCCCACCC CDCCCCCCKDKDECTDDCCFCRACCDC  
   284  202 C R  E     + H   0 289B  99  614   70   N DNNNEAGDRN   TERYNNSDNNNNKEEDHENNESNN NINNNEEEGVGIGNQIINGFEGFNNAN  
   285  203 C F  E >  S- H   0 288B  22  614   71   G GGNGrGKGGG   GrHnGGDGGGGGnNNGEiGGNGGG GAGNGNSYNKNAKGvAAGGqRGDGGNG  
   286  204 C K  T 3  S-     0   0   85  222   71   . ....d.....   .dGt..T.....d...Dr...... .....AGN......s....eD.N....  
   287  205 C D  T 3  S+     0   0  108  223   55   . ....Q.....   .KDH..G.....D...GR...... .....GGG......D....EG.G....  
   288  206 C T  E <   - H   0 285B   3  233   75   . ....R.....   .RKR..S.....R...VR...... .T...RRK.N.T..KTT..TR.R....  
   289  207 C Y  E     - H   0 284B  21  242   51   . ....Y.....   .YHY..T.....WKR.YW...... .K...FFF.N.K..FKK..WW.W..K.  
   290  208 C F  E     -cH 200 283B   0  613   91   Q EEQEERKKEE   REEEQEYKEEEEYNVVRHEEKAQQ EQQQEYFNVQVQTEEQQERITRHQQKE  
   291  209 C V  E     + H   0 282B   1  613   38   L LLLLLQILLL   LLILLLLLLILLQLQLLVLLLLLL LILLLILLQVQILLLIILLQVVLLLLL  
   292  210 C T  E     +     0   0B   1  613   84   Q QQQQIAYVQQ   TIVVQQAAQQQQIVVHQYQQIQQQ QVQQQQHELVLVVQTVVQQGWYLQQVQ  
   293  211 C G  E     -IH 312 281B   0  613    0   G GGGGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGG  
   294  212 C I  E     -IH 311 280B   0  613   19   I VVVIVIIVII   VVIIVVIVIIVVIVIIVVVVVIVV IIILVAVVVIVIVVVIIVVVIVVIVVV  
   295  213 C V  E     +I  310   0B   7  613   14   V VVVVVVVVVV   VVVVVVVVVVVVVVVVVTVVVVVV VVVVVTTVVVVVVVVVVVVVTVVVVVV  
   296  214 C S  E     -     0   0B   1  612    0   S SSSSSSSSSS   SSSSSSSSSSSSSSXSSSSSSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSS  
   297  215 C W  E     -I  309   0B  45  613    7   W WWWWWWTSWW   WWWWWWWFWWWWWWWWWFWWWWWW WWWWWWWWFWFWWWWWWWWWFWWWWWW  
   298  216 C G        -     0   0   26  613    0   G GGGGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGG  
   299  217 C E  S    S-     0   0   25  609   90   Y HHYLNNMMYY   ENVREHYMYSYYENERFEYYKYYY YYYYYNVKVYVYIYAYYYYWFYDYYNY  
   300  218 C G  S    S-     0   0   19  612   13   G GGGGGGKEGG   GGGAGGGGGVGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGG  
   301  220 C k  S    S-     0   0    7  613    2   C CCCCCCCCCC   CCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCC  
   302  221 C A  S    S+     0   0    4  612   16   A AAAAAAGGAA   AAGAAAAAAAAADAAXAGAAAAAA AAAAAAGAAAAAAAAAAAAGAAAAAAA  
   303  222 C R    >   -     0   0  105  611   73   E QQELRRSSQQ   TRRQQQRREMEERRLLRDEEEQQQ QREQEAFRRRRREERRREQRSELQQRE  
   304  223 C K  T 3  S+     0   0  152  611   64   R RRKKVKSTKK   IPAKKRPRKRPQSPAPPKPPPPRR KKRRRPRPKKKKPKQKKKRKPRRKRPQ  
   305  223AC G  T 3  S+     0   0   26  613   58   N NNDGGGFYNN   GYGNNNGGNGGNGNGDRGGGNNNN NGNNDGGGNGNGGNYGGDNNGNGNNNN  
   306  224 C K    <   -     0   0   43  613   85   H KKHKYYYYKK   KYYYKKYKHKNHKMKYQKNNYYKK KYHKHKNKNYNYYHKYYHKRFFKKKKR  
   307  225 C Y        -     0   0   33  613   50   P PPPPPPPPPP   PPPPPPPPPPPPYPPPPFPPFPPP PPPPPFFYPPPPPPYPPPPYPPYPPPP  
   308  226 C G  E     -G  263   0B   4  611    2   G GGGGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGG  
   309  227 C I  E     -GI 262 297B   6  612   11   V VVVVVVVIVV   VVVVVVVVVVVVFVVVVIVVVVVV VVVVVVVVIVIVVVVVVVVVIVVVVVV  
   310  228 C Y  E     -GI 261 295B   1  612    1   Y YYYYYYYYYY   YYYYYYYYYYYYYYYYYYYYYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYY  
   311  229 C T  E     -GI 260 294B   2  612   39   A TTATTTTTTT   TTTTATTTTTAPTAASATAASTST TTATAASAATATSSTTTAATSTTTTAN  
   312  230 C K  E >   - I   0 293B  21  612   42   K KKKKRERRKK   SRRRKKENKKKKHKKKKKKKRKKK KRKKKRKKKRKRRKDRRRKNRKRKKKK  
   313  231 C V  G >  S+     0   0    1  611    8   V VVVVVIVVVV   VVVVVVVLVVVVLVVIVVVVVVVV VVVVVVVVVVVVVVVVVVVIVVLVVVV  
   314  232 C T  G 3  S+     0   0    2  609   71   C CCCCTAYDCC   FTANCCSACCCCF SSTTCCACCC CGCCCKTRSGSGACSGGCCIVNHCC C  
   315  233 C A  G <  S+     0   0   29  609   79   I NNKNNSKKNN   EQRKNNYNINIMR HYRNIISSNN NNINLYHHANANAVYNNINHNRRNN M  
   316  234 C F  S <> S+     0   0    7  605   35   F YYFYYVYYFF   LYYFYYH FYFFM  AYFFFVLYY FFFYFVSLAFAFVQFFFFYYFHFYF F  
   317  235 C L  H  > S+     0   0   23  603   80   S IIILIRYYTV   RLLLNIV TLNSR  RLSNNVLNN VVSTNLLRAIAVRSRVVNVLLARVN S  
   318  236 C K  H  > S+     0   0  116  602   68   D SSPDDDDEDD   SDPRSSD DSDDK  DRQDDDPST DDDTDDGAKDKDDEDDDDSPPSDNS D  
   319  237 C W  H  > S+     0   0   26  602    1   W WWWWWWWWWW   WWWWWWW WWWWW  WWWWWWWWW WWWWWWWWWWWWWWWWWWWWWWWWW W  
   320  238 C I  H  X S+     0   0    1  599   12   L IILIIIIIII   IIIIIII IILLM  IIILLIIII IILILIILIIIIILIIILIIIIIII L  
   321  239 C D  H  < S+     0   0   66  570   71   D KKQQKK  KK    KRKRKK AQTRL  KETTTKNRR QEDRTKLDKEKEKHDEEEQHNNTQR R  
   322  240 C R  H >< S+     0   0  136  556   71   S DDQEEE  ET    EANDD  QESTK  EEKSSEEDD SSSNNSKGSSSSESKSSRSDNGEQD T  
   323  241 C S  H >< S+     0   0    6  523   72   T TTTTNH  TT    NNNTT  TTTTT  NQITT ITT T TTTEEHT T  TM  TTVIY TT T  
   324  242 C M  T 3< S+     0   0   25  479   41   M MMMITV  II     MVMM  IMMMI   TLMM LMM I MIMMMI     MV  MMMII IM M  
   325  243 C K  T <  S+     0   0  153  444   70   A AAAAQN  AA     DKAA  AAAA    GKAA SKK A ANSAAR     SN  ASSGN AA A  
   326  244 C T    <         0   0   51  390   65   S SSSAD   AA     DDSS  SNTS    GNST SSS A SSS S      N   TSGE  AS S  
   327  245 C R              0   0  197  273   47   N   NN    NN      SN   NN      DN       N NN              N    NN N  
## ALIGNMENTS  631 -  700
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....4....:....5....:....6....:....7....:....8....:....9....:....0
     1   49 L Q              0   0  101  671   35  DDDD                                  QQ                   Q  QQQQQQ  
     2   50 L a    >   +     0   0   22  858    0  CCCC                                  CCC                  CC CCCCCC  
     3   51 L E  T 3  S+     0   0  187  858   80  AAAA                                  AAL                  DE DALLLL  
     4   52 L T  T 3  S-     0   0  105  864   61  PSSS                                  EEE                  NL PESSSS  
     5   53 L S    <   +     0   0   89  868   72  FFFF                                  NNN                  NV MKNNNN  
     6   54 L P        +     0   0   10  878   31  PPPP                                  PPP                  MD PPQQQQ  
     7   55 L b        -     0   0   18  893   21  CCCC                                  CCC                  CH CCCCCC  
     8   56 L Q  S    S+     0   0   92  892   83  LLLL                                  KKR                  VQ VKVVVV  
     9   57 L N  S    S-     0   0   63  893   51  NNNN                                  NNN                  NC NNNNNN  
    10   58 L Q  S    S-     0   0  152  893   57  GGGG                                  GGN                  GQ GGGGGG  
    11   59 L G        -     0   0   16  893   40  GGGG                                  AAG                  TH TATTTT  
    12   60 L K  E     -S   23   0G 117  852   79  TTTT                                  MMT                  CT .MCC.C  
    13   61 L a  E     -S   22   0G  45  882   10  CCCC                                  CCC                  VC CCVVCV  
    14   62 L K  E     -S   21   0G 155  890   81  QQQQ                                  SSV                  DV MSDDVD  
    15   63 L X  E     +S   20   0G 120  768   39  DDDD                                  DD.                  .S DD..D.  
    16   64 L G        -     0   0   44  862   73  GGGG                                  SSY                  KS QS..L.  
    17   65 L L  S    S-     0   0  152  871   64  VVVV                                  VVL                  YP IVLLYL  
    18   66 L G  S    S+     0   0   67  883   63  NNNN                                  GGe                  QA GGyyQy  
    19   67 L E        -     0   0  119  837   61  DDDD                                  GGt                  AS GGssSs  
    20   68 L Y  E     -S   15   0G  37  883   11  YYYY                                  YYY                  YY FYYYYY  
    21   69 L T  E     -S   14   0G  71  886   82  SSSS                                  DDQ                  AR NDAAAA  
    22   70 L b  E     -S   13   0G  20  889    0  CCCC                                  CCC                  CC CCCCCC  
    23   71 L T  E     -S   12   0G  85  890   86  TTTT                                  VVY                  SK IVRRRR  
    24   72 L c        -     0   0   44  890    0  CCCC                                  CCC                  CC CCCCCC  
    25   73 L L    >   -     0   0   62  890   88  PPPP                                  KKA                  NR NKNNNN  
    26   74 L E  T 3  S+     0   0  177  890   75  PPPP                                  SSE                  HE LSHHHH  
    27   75 L G  T 3  S+     0   0   29  893   20  GGGG                                  GGG                  GG GGGGGG  
    28   76 L F  E <   +T   36   0H  40  893    9  YYYY                                  FFF                  YF WFYYYY  
    29   77 L E  E     +T   35   0H  74  893   73  NNNN                                  TTE                  Et ETEEEE  
    30   78 L G  S >  S-     0   0   32  889    5  GGGG                                  GGG                  Gg GGGGGG  
    31   79 L K  T 3  S+     0   0  156  891   73  KKKK                                  VVR                  RK NVRRRR  
    32   80 L N  T 3  S-     0   0   33  892   62  NNNN                                  HHF                  YT NHYYYY  
    33   81 L c  S <  S+     0   0    1  892    3  CCCC                                  CCC                  CC CCCCCC  
    34   82 L E        +     0   0   87  891   44  SSSS                                  EEQ                  DK EEDDDD  
    35   83 L L  E    S-T   29   0H  96  889   88  TTTT                                  NNT                  QE YKQQQQ  
    36   84 L F  E     -T   28   0H 139  889   83  PPPP                                  VGE                  PI EDPPPP  
    37   85 L T        -     0   0   44  677   75  ....                                  LEv                  lD iEqqqq  
    38   86 L R        +     0   0   57  408   92  ....                                  ..f                  a. dTaaaa  
    39   87 L K        +     0   0   96  535   81  ....                                  ..L                  T. ALTTTT  
    40   88 L L        -     0   0   91  608   90  ....                                  ..K                  NF NCSSSS  
    41   89 L d  S  > S+     0   0   15  617   29  ....                                  YEC                  CC CVCCCC  
    42   90 L S  T  4 S+     0   0   98  624   84  ....                                  HHL                  SD SVAAAA  
    43   91 L L  T >4 S-     0   0  120  627   87  ....                                  AAY                  LL IDEEEE  
    44   92 L D  G >4 S-     0   0  107  638   73  ....                                  DDN                  DG NSDDDD  
    45   93 L N  G >< S-     0   0    8  700   56  VVVV                                  QQN                  ND NDNNNN  
    46   94 L G  G <  S-     0   0    0  882   52  SSSS                                  TTG                  GH GKGGGG  
    47   95 L D  G <  S+     0   0   44  887   62  KKKK                                  LLQ                  NG GGHHHH  
    48   96 L e    <   -     0   0    0  892    0  CCCC                                  CCC                  CC CCCCCC  
    49   97 L D  S    S-     0   0   59  892   74  EEEE                                  TTE                  DQ ESDDDD  
    50   98 L Q  S    S+     0   0    2  892   63  hhhh                                  wwH                  HH HQHHHH  
    51   99 L F  E     -U   62   0I   4  892   80  tttt                                  ggY                  ED FFEEEE  
    52  100 L d  E     +U   61   0I  10  893    1  CCCC                                  CCC                  CC CCCCCC  
    53  101 L H  E     -U   60   0I  68  893   87  HHHH                                  SSD                  TF YKSSSS  
    54  102 L E  E     -U   59   0I  92  893   68  EEEE                                  QQG                  DS HPDDDD  
    55  103 L E  S    S-     0   0  100  893   82  RRRR                                  ffs                  gT Pgssss  
    56  104 L Q  S    S-     0   0  175  693   73  NNNN                                  pp.                  dQ d.dddd  
    57  105 L N  S    S+     0   0  154  838   66  NNNN                                  tte                  lE etllll  
    58  106 L S  S    S-     0   0   58  853   65  RRRR                                  SSR                  TS nSAAAA  
    59  107 L V  E     -U   54   0I   7  890   79  YYYY                                  YYR                  RY RHRRRR  
    60  108 L V  E     -U   53   0I  45  891   88  VVVV                                  EER                  RI YESSSS  
    61  109 L e  E     +U   52   0I   5  893    1  CCCC                                  CCC                  CC CCCCCC  
    62  110 L S  E     -U   51   0I  24  893   75  EEEE                                  SSS                  GR SSSSSS  
    63  111 L f        -     0   0   23  893    0  CCCC                                  CCC                  CC CCCCCC  
    64  112 L A    >   -     0   0    8  893   75  AAAA                                  AAA                  VK VAIIII  
    65  113 L R  T 3  S+     0   0  149  893   80  RRRR                                  RRD                  NR SQHHHH  
    66  114 L G  T 3  S+     0   0   24  893    8  GGGG                                  GGG                  GG GGGGGG  
    67  115 L Y  E <   -V   78   0J  20  893   11  YYYY                                  WWF                  YY FWYYYY  
    68  116 L T  E     -V   77   0J  72  891   85  GGGG                                  KKK                  NV QKNNNN  
    69  117 L L  E     -V   76   0J  67  888   64  GGGG                                  LLL                  LL LILLLL  
    70  118 L A    >   -     0   0   23  889   78  LLLL                                  SSG                  QN DNQQQQ  
    71  119 L D  T 3  S+     0   0  175  889   77  NNNN                                  rrE                  DL InDDDD  
    72  120 L N  T 3  S-     0   0   92  694   44  CCCC                                  ttD                  DD NdDDDD  
    73  121 L G  S <  S+     0   0   16  713   66  QQQQ                                  RRG                  SG HTSSSS  
    74  122 L K  S    S+     0   0   71  687   76                                        DDR                  RK HTRRRR  
    75  123 L A        -     0   0   22  685   66                                        KKR                  TT SKTTTT  
    76  124 L f  E     -V   69   0J  12  847    9                                        CCC                  CC CCCCCC  
    77  125 L I  E     -V   68   0J  78  846   80                                        EEV                  RI EVQQQQ  
    78  126 L P  E     -V   67   0J  62  850   71                                        PPA                  PK PPPPPP  
    79  127 L T  S    S+     0   0  103  652   80                                        AAQ                  K. .TKKKK  
    80  128 L G  S    S-     0   0   32  788   69                                        VVV                  G. .GGGGG  
    81  129 L P  S    S+     0   0  116  601   75                                        PPE                  PT .RPPPP  
    82  130 L Y  S    S+     0   0   59  794   86                                        YYF                  SN .FAAAA  
    83  131 L P    >   -     0   0   17  799   62                                        PPP                  SH .PSSSS  
    84  132 L g  T 3  S+     0   0   16  800    5                                        CCC                  CC TCCCCC  
    85  133 L G  T 3  S+     0   0    0  712   37                                        GGG                  GA GGGGGG  
    86  134 L K    <   -     0   0   69  588   68                                        KKQ                  Q  VRQQQQ  
    87  135 L Q        -     0   0   37  477   65                                        VVL                  L  VVLLLL  
    88  136 L T        +     0   0    4  428   78                                          P                  L  TSLLLL  
    89  137 L L        +     0   0  105  372   61                                                             I  MSIIII  
    90  138 L E              0   0  104  274   69                                                             G   VGGGG  
    91  139 L R              0   0  231  199   47                                                             R   RRRRR  
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2      IIIIIII IIIIIIIIIIIIVIIIIIIIIII II   IIIIIIIIIIIIIIIIII  I      II
    94   17 C V  B     -A  271   0A   7  590    9      VVVVVVI VVVVVVVVVVVVVVVVVIVVVVI VI   VVVVVVVVVVVVVVVVVV  V      VV
    95   18 C G  S    S+     0   0   25  591    6      GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      GG
    96   19 C G  S    S-     0   0   26  592    0      GGGGGGG GGGGGGGGGGGGGGGGGGGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      GG
    97   20 C Q  E     -B  237   0B  98  593   95      YQYYVEI QYKKQKKKDYTYEYYRYEYFYYQYYE   YYYSESSSYYYTYQYYYY  Y      RY
    98   21 C E  E     -B  236   0B  80  594   67      EIESKKS KTEEEEEEPTDMTTTPTPTTEEEQQE   TTTTDTTTETTDTDEETE  E      PE
    99   22 C h        -     0   0    8  594   58      CTCVAAT ACCCCCCCVCACACCTCACCCCCCCV   CCCTITTTCCCSCACCCC  C      TC
   100   23 C K    >   -     0   0  123  593   78      SNRTQLT KATAVTATNQAPSQQGEDQARTEEEQ   EQQTDTTTRAASGETRET  L      IA
   101   24 C D  T 3  S+     0   0   60  594   85      KIKIAAI AAPPPPPPIAVKVAQVEIEEPPPAAP   EKKIIIIIKEEPKLPKEP  K      PA
   102   25 C G  T 3  S+     0   0    0  595   74      NSNDGGD GNYYHYYYENGNDNNNNLNNHHHHHF   NNNQTQQQNNNGNGHNNY  N      NH
   103   26 C E  S <  S+     0   0   36  595   66      SNSKDEK ESSSSSSSESESSSSQSDSSSSSSSS   SSSNGNNNSSSEAESSSS  S      KS
   104   27 C h    >   +     0   0    4  595   92      VFVACCY CIMMQMMMIVFVWVLYVFVVQQRQQI   VILFAFFFVVVWVWQVVQ  V      YQ
   105   28 C P  T 3   +     0   0    0  599    9      PPAPPPPPPPPPPPPPPPPPPPPPPPPPPAPPPK   PPPPPPPPAPPPPPPPPP  P      PP
   106   29 C W  T 3  S+     0   0    5  600   26      YWYYYYYWYYHYHHYHYYWYWYYWYWYYHHFWWY   YYYYYYYYYYYWYWHYYH  Y      WW
   107   30 C Q  E <   -J  122   0C   7  601   26      QQQqQQQmQQQQQQQQQQqQQQQLQqQQQQMQQq   QQQQQQQQQQQQQQQQQQ  Q      VQ
   108   31 C A  E     -JK 121 146C   1  593   49      VVVlIIVaIVVVVVVVVViVVVVAVsVVVVAVVi   VVVVVVVVVVVVVVVVVV  A      AV
   109   32 C L  E     -JK 120 145C   3  598   68      SSSLSSSLSSSSSSSSSSQSSSSRSISSSSSSSL   SSSSSSSSSSSSSSSSSS  S      RS
   110   33 C L  E     -JK 119 144C   0  601    9      LILLLLLLLLLLLLLLLLFLILLLLLLLLLLLLF   LLLLLLLLLLLLLLLLLL  L      LL
   111   34 C I  E     -JK 117 143C   0  601   81      DQNEQQHAQNNNNNNNNNHNQNNVNYNNNNNNNL   NNNQLQQQNNNHNHNNNN  F      VN
   112   35 C N  E >   - K   0 142C  30  601   88      ARSKSSYsSSSSSSSSYVRVYVSYVFASASYVVN   SSAYNYYYSSSASFAVSS  T      YE
   113   36 C E  T 3  S+     0   0   63  117   78      .......q..........................   .............K....  .      ..
   114   37 C E  T 3  S-     0   0  136  242   77      .S.G..NN........R..GN.............   ...GRGGG.....T....  .      ..
   115   38 C N  S <  S+     0   0   84  565   53      GGGKSSGNSGGGGGGGGG.GKGGDGGGGGGGGG.   GGGGGGGGGGGRGQGGGG  G      EG
   116   39 C E        -     0   0  100  589   94      YSYESSKRSSYYYYYYRYAMQYYGYKYYYYYYYY   SYYSRSSSYYYLYGYYYY  Y      GY
   117   40 C G  E     +J  111   0C  14  600   57      HHHYHHLLHHHHHHHHHHHHHHHQHHHHHHHHHH   HHHHHHHHHHHHHHHHHH  N      RH
   118   41 C F  E     +     0   0C  28  611   33      FFFyFFIFFFFFFFFFRIFLIIFfFLFFFFFFFF   FFFIFIIIFFFLFVFFFF  F      fF
   119   42 C i  E     -J  110   0C   0  612    1      CCCcCCCCCCCCCCCCCCCCCCCcCCCCCCCCCC   CCCCCCCCCCCCCCCCCC  C      cC
   120   43 C G  E     -J  109   0C   1  612    1      GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      GG
   121   44 C G  E     -J  108   0C   0  612    9      GGGGGGGGGGGGGGGGGGGGGGGAGGGGGGGGGG   GGGGGGGGGGGGGAGGGG  G      AG
   122   45 C T  E     -JL 107 130C   0  612   45      SSSSSTSVTSSSTSSSSSSTSSSSSSSSSSVSST   SASSSSSSSSSSSSSSSS  I      SV
   123   46 C I  E     + L   0 129C   0  612   23      LVLIIIILILLLLLLLILILILLLLILLLLLLLL   LLLIIIIILLLILILLLL  L      LL
   124   47 C L        -     0   0    6  612   27      IYIILLIILIVVVVVVLILVLIILILIILVVIII   IIIIIIIIIIIIIIVIIV  L      VL
   125   48 C S  S    S-     0   0   22  612   56      SSSSDDSNDNNNNNNNNSSNDSNTSSNNSNNNNH   SSNSDSSSSNNSSSNSSN  S      TN
   126   49 C E  S    S+     0   0   99  612   63      SKSKEEKEESEEEEEEENNHPNSKDRDDDEKDDK   EDSANAAASEDNSNQSEE  E      ND
   127   50 C F  S    S+     0   0   42  612   83      TDTRYYQWYQNNNNNNKQWQHQEDQWQQSNQRRQ   QQQNDNNNTEEQQKNTQN  E      DQ
   128   51 C Y  E     - M   0 185C   7  612   34      WTWHWWWFWWWWWWWWFWWWWWWYWWWWWWWWWW   WWWYLYYYWWWWWWWWWW  W      YW
   129   52 C I  E     -LM 123 184C   0  612   14      VIVIIIIVIVVVVVVVVVVVIVVVVIVVVVVIIV   VVVVIVVVVVVVVLVVVV  V      VV
   130   53 C L  E     +LM 122 183C   0  612   27      VIVLLLLLLVVVVVVVLVILLVVLVLVVVVLVVV   VLVLLLLLVVVLVLVVVV  L      II
   131   54 C T  E     - M   0 182C   0  612   43      STSTTTTTTSSSSSSSTSTSTSSTSTSSSSSSST   SSSTTTTTSSSTSSSSSS  S      TS
   132   55 C A    >>  -     0   0    0  613    2      AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAVAAA   AAAAAAAAAAAAAAAAAA  A      AA
   133   56 C A  G >4 S+     0   0    0  613    9      AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA   GAAAAAAAAAAAASAAGA  A      AA
   134   57 C H  G >4 S+     0   0    7  613    0      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH   HHHHHHHHHHHHHHHHHH  H      HH
   135   58 C i  G X4 S+     0   0    0  613    1      CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC   CCCCCCCCCCCCCCCCCC  C      CC
   136   59 C L  G << S+     0   0   31  613   66      YVYLVVVLVYYYYYYYTYFYFYYVYFYYSYWWWW   YYYILIIIYYYVYFYYYY  K      VW
   137   60 C Y  G <  S+     0   0  109  613   87      KRKVNAYNNKKKKKKKDQTNRQMRMIKKKKYQQR   KKKILIIIKKKTKKQQKK  A      RK
   138   61 C Q  S <  S+     0   0   95  613   78      SgSdgggdgSSSSSSSlSrTkSSrYnSYPSNNNP   PSSgggggSSSsSySSSS  D      rI
   139   61AC A        -     0   0   16  373   75      .i.iaalta.......l.k.v..r.r....PPPS   ...akaaa...p.v....  .      rP
   140   62 C K  S    S-     0   0  172  387   77      .S.SKSSES.......A.S.S..N.S....YFFH   ...SRSSS...N.R....  .      SS
   141   63 C R  S    S-     0   0  162  602   78      RTRQKKLEKRRRKRRRNRNRNRRKRGRRRRASSL   HQRQNQQQRRRIRTRRRR  .      KT
   142   64 C F  E     -K  112   0C  36  609   54      ILIVLLFVLIVVMVVVFFLIWFIIILIIIIMQQI   IIIHLHHHIIIWIFVIIV  L      IH
   143   65 C K  E     -K  111   0C  67  609   79      QKQHSSKTSQEEDEEERQNQKQQRQEQQEEQIIQ   QQQRQRRRQQQRQIEQQE  E      RV
   144   66 C V  E     -KN 110 161C   0  609   16      VVVAIIVVIVVVIVVVVVIVVVVVVIVVVVIAAV   VVVIVIIIVVVIVYVVVV  V      IA
   145   67 C R  E     -KN 109 160C  40  609   55      RRRRRRRRRRHRVHRRRRARRRRIRIRRRRMIIV   RRRRRRRRRRRYQHRRRR  R      II
   146   68 C V  E     +KN 108 159C   1  610   43      LALVYYVLYLLMLLMMTLVLALLLLHLLLLLLLL   LLLVAVVVLLLALLLLLL  L      LV
   147   69 C G  S    S+     0   0    9  610   15      GGGGNNAGNGGGGGGGGGGGGGGGGGGGGGGGGG   GGGGGGGGGGGGGYGGGG  G      GG
   148   70 C D        +     0   0   11  611   58      ESESTSSESEEEDEEESETDSEEDVEEEEEEDDD   EEESSSSSEEEIKCEEEE  E      DE
   149   71 C R  S    S+     0   0   24  611   73      HSHTLLSFLHHHHHHHNHTHDHHYYRHHHHHHHH   HHHTSTTTHHHLHNHHHH  H      YH
   150   72 C N  B >   -P  234   0D  18  611   65      NNNNKKYHKNNNNNHHHNHNKNDDNRNNNNNHHD   NNNFSFFFNNNRNQHNNN  N      DT
   151   73 C T  T 3  S+     0   0   56  611   80      IWINHHHFHILIRLIISILLLIIQIVIILLVIII   IIISNSSSIIIQLLIIII  I      QI
   152   74 C E  T 3  S-     0   0  119  611   84      AYADASDRADRRWRRREADRGAEFDGEERRRWWT   EEDNRNNNAEESETRAER  W      YW
   153   75 C Q  S <  S-     0   0  130  610   85      VEVKSLEWSVVVFVVVSVSVNVVVVTVVVVVMMK   VVVSESSSVVVETFNVVA  E      VY
   154   76 C E        +     0   0  165  610   85      SGNGGGGpGLKTMKTTNTPLFTLaMKEENNFQQQ   LLVGGGGGNDViTNNNLN  P      nT
   155   77 C E        -     0   0   93  469   27      E.E....l.EEEDEEE.E.E.EEeE.EEEEEEEE   EEE.....EEEeETDEEE  D      dE
   156   78 C G  S    S+     0   0   46  578   34      GGGGGGGS.GGGGGGGGG.GPGGTG.GGGGGGGG   GGGGGGG.GGGDSAGGGG  G      GG
   157   79 C G  S    S+     0   0   47  585   75      TVTKEEIR.NNNNNNNQNKSSNTPN.NGSSTPPP   NNGTVTT.TNNTTQTTNT  T      KT
   158   80 C E        -     0   0   37  472   30      E.E.....GEEEEEEE.EMELEEAENEEEEEEEE   EEE....DEEE.Q.EEEE  E      AE
   159   81 C A  E     -N  146   0C  27  487   57      Q.Q...LREQQQQQQQ.QEQPQQIQLQQQQQQQQ   QQQ....TQQQPQ.QQQQ  Q      IQ
   160   82 C V  E     -N  145   0C  71  590   83      FVFVKKIDKFYFIYFFVFRFVFFMFRFFYYLYYR   FFFIVIIIFFFFLRFFFF  H      MY
   161   83 C H  E     -N  144   0C  14  599   76      IVIYIITHLIIIIIIIHIRIAIIRIMIIIIMMMF   IIIYVYYYIIIFIRIIII  I      RM
   162   84 C E        -     0   0   90  602   78      DDNSQSNESNSSSSSSRNRSKNDANKSNSSKSSK   NKDNPNNNNNNKNRTDNS  M      AS
   163   85 C V  E     -O  186   0C  27  607   64      SPSTVVIVVASSASSSISLAISSVSVSSSSTVVV   AAAAVAAASSSVSVSSAS  S      VI
   164   86 C E  E    S+     0   0C  70  608   73      ATAKAASEAASSESSSGADTFAATADAASSEDDA   AAAAGAAAAAAEAKSVAS  S      SD
   165   87 C V  E     -O  185   0C  13  609   72      KDRSEKSRQKRRRRRRKKREVKSAKKKKRRNAAL   KKKQEQQQRKKEKRRKKR  K      AA
   166   88 C V  E     -O  184   0C  72  610   46      VIVMIIIIIIVVVVVVIVLVTVVIVLVVVVIIIV   IIIVYVVVVVVIVIVIIV  F      II
   167   89 C I  E     +O  183   0C  27  610   43      IKITYFIDYIIIIIIIHIVVEIIIIIIIIIIYYI   IIIIVIIIIIIIIIIIII  V      IY
   168   90 C K  E     -O  182   0C  68  610   82      RIRIQAPIQTRRPRRRKRMRLRRRRTRRRRWWWS   RRRRYRRRRRRVRTRRRR  R      RT
   169   91 C H    >   -     0   0   19  611   13      HHHHHHHHHHHHHHHHHHHHNHHHHHHHHHHHHH   HHHHNHHHHHHHHHHHHH  H      HH
   170   92 C N  T 3  S+     0   0  156  611   61      PEPPEEEEEPPPPPPPKPPPIPPRPPPPPPPEES   PPPARAAAPPPSSTPPPP  P      KE
   171   93 C R  T 3  S+     0   0  150  608   73      SSSNNKWKKNNNNNNNLSQDTSNSRYRKQQSRRQ   KNSSDSSSSKNQGGSSKN  Q      NS
   172   94 C F    <   -     0   0   24  611    5      YYYYYYYFYFYYYYYYFYFYYYYFYFYYYYYYYY   YYYYFYYYYYYYYYYYYY  Y      FF
   173   95 C T     >  -     0   0   56  611   68      NNNNDDDNDNNSENNNNNSNPNNDSDNNSSDDDK   NNNNTNNNNNNKSNNSNS  N      DD
   174   96 C K  T  4 S+     0   0  145  561   78      SASSSSEPSGSSSSSSRSQR.S.QSSSSSSYYYY   RSASFSSSSSSYPDSSSS  P      MY
   175   97 C E  T  4 S+     0   0  174  569   91      GQRRMYDKWNYYWYYYNREQ.R.NWWWWYYQQQW   IGNRHGRRRWWAYIYWWY  R      NF
   176   98 C T  T  4 S-     0   0   44  598   57      NTNTTQTTTTNNLNNNTTTT.TSSTFTTNNTTTT   TTTTNTTTNTTRTTTNTN  T      ST
   177   99 C Y    ><  +     0   0   60  604   65      LMLYIIYFILIIVIIIYYMVKYFYLLLLIILLLF   LYFLMLLLLILILYILLI  Q      YL
   178  100 C D  T 3   +     0   0   25  609   37      NMDDDDDDDDDDNDDDDDDDEDnNNDDDDDDDDD   NDDDDDDDDDDGDDDDDD  D      ND
   179  101 C F  T 3  S+     0   0   21  595   66      NNNYNNYYNNNNNNNNYNHNNNnHNNNNNNFYYN   NNNYSYYYNNNYNYNNNN  S      HY
   180  102 C D    <   +     0   0    1  609    0      DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD   DDDDDDDDDDDDDDDDDD  D      DD
   181  103 C I        +     0   0    0  611   13      IIIVVIVIIIIIIIIIFIIIIIIIIIIIIIIIII   IIIIVIIIIIIIIIIIII  I      VI
   182  104 C A  E     -MO 131 168C   0  611   60      MAMAAAAAAMMMMMMMSLAMALMAMAMLMMMMMM   MLMGGGGGMMMAMAMMLM  M      AM
   183  105 C V  E     -MO 130 167C   0  612   16      LVLILLLVLLLLLLLLILLLLLLLLLLLLLLLLL   LLLLLLLLLLLLLLLLLL  L      LL
   184  106 C L  E     -MO 129 166C   0  613   30      IIILIIIIIIIIIIIILIVIVIILILIIIIIMML   IIIIIIIIIIIMIMIIII  I      LM
   185  107 C R  E     -MO 128 165C  40  613   43      KRKTKKKKKKKKKKKKEKLKKKKKKLKKKKKKKK   KKKRWRRRKKKKKEKKKK  K      KK
   186  108 C L  E     - O   0 163C   0  613   16      LLLFLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL   LLLTLTTTLLLLLLLLLL  L      LL
   187  109 C K  S    S+     0   0  101  613   69      SKSSKKISQSSSSSSSVSDAQSERSKSSSSFAAD   SSNSQSSSSAAAAMSSSS  S      RK
   188  110 C T  S    S-     0   0   82  614   74      KLKQTSTESSKKQKKKDSTTFSTKSSSSEEHHHR   TSSSKSSSESSETETTSK  R      KY
   189  111 C P        -     0   0   48  614   39      PSPDPPPkPPPPPPPPLPPPPPPPPPPPPPPPPP   PAPGPGGGPPPPPPPPPP  P      SP
   190  112 C I        -     0   0    4  562   63      ALAIMMLdMAAAAAAAIA.ALAAVAFAAAAVVVA   AAA.L...AAAMALAAAA  A      VV
   191  113 C T        -     0   0   95  566   73      SPTATKSKTTTTTTTTKS.TTSEEVKVTVVETTD   VST.E...TTTNTETSVT  T      KT
   192  114 C F        +     0   0   56  612   34      LFLILLLALLLLLLLLFIFLFILFLLIILLVVVI   LILIFIIILLLFLFLLIL  L      FL
   193  115 C R  B >   -Q  196   0E  52  613   63      NGNddnGgdNNNNNNNDNhdSNSTNDSSNNTNNN   NNNaGaaaNNNTNSNNNN  N      SN
   194  116 C M  T 3  S+     0   0   29  594   77      STNvtkRgkSQQKQQQNSkhGSSKKASSQQSQQG   ASSsPsssQTTDKKQSSQ  S      KE
   195  117 C N  T 3  S+     0   0   13  602   90      YTYNNNNNNRYYYYYYTKDTTKRTRTRRRNAHHI   HRRGSGGGYRRLATYYRY  F      RY
   196  118 C V  B <   +Q  193   0E   0  604   27      VIVTAAAIAVVVVVVVRVTVVVVIVKVVVVVVVV   VVVVIVVVVVVQVVVVVV  V      VV
   197  119 C A        -     0   0    1  606   80      RKRKKKKWKAQKQQKKRSGDRSARAVSAVVAQQQ   SASAAAAAQAAQQQQSSQ  R      KK
   198  120 C P        -     0   0    8  608   54      ISTIPAIPSTAPPAPPSAPTPATPTPTTPPPPPP   TTTSPSSSPAAPTPPTAP  P      PP
   199  121 C A        -     0   0    2  609   39      VIVVVVIIVVVVVVVVVIIVIIVVVIVIVVIVVA   IVVIIIIIVIIIIIVVIV  A      II
   200  122 C g  B     -c  290   0B   1  610   66      SASTPGICQSAAAAAARSCTCSSCSCSSAAPAAS   SSSAIAAAASSCPCSSSA  V      CA
   201  123 C L        -     0   0   27  612    5      LLLLLLLLLLLLLLLLLLMLLLLLLLLLLLLLLL   LLLLMLLLLLLLLLLLLL  L      LL
   202  124 C P        -     0   0    7  613   30      PAPPPPAPPPPPPPPPLPPPPPPPPSPPPPPPPP   PPPQSQQQPPPPPPPPPP  P      PP
   203  124AC E     >  -     0   0   92  612   75      SKSSAATPSRSRSSRRSALTFASKSETSTTTEED   TRRSDSSSTSSSTASSTS  S      QK
   204  125 C R  H  > S+     0   0  109  612   78      SKSEQKPPQSSSSSSSASLTSSDEAISSSSRAAP   ASSAEAAASAAKRSGSAS  K      KA
   205  126 C D  H  > S+     0   0  124  612   85      CDCNGGPGGCCCCCCCRFRCDFCRCTCCCCCCCD   PVCNDNNNCCCECTCCPC  C      GC
   206  127 C W  H  >>S+     0   0    4  612   88      APANSSIVSAAAAAAAEPDAEPASADAAAAPPPS   PAAIEIIIAAADVHAAPA  A      SP
   207  128 C A  I  X>S+     0   0    0  612   75      SAGGDDNQDAPPPPPPEAPLKAPEAIPPPPTAAP   AASAEAAAPPPTAIPAAA  A      DT
   208  129 C E  I  <5S+     0   0   75  613   82      SDSAVVILVAAAAAAAIALPLAAPADAAAAGPPP   AVSAIAAAAAANTFAAAA  D      PP
   209  130 C S  I  <5S+     0   0   70  614   66      GGGVKKKEKGGGGGGGPGTGAGGAGRGGGGGGGL   GGGGdGGGGGGIGPGGGG  G      AG
   210  131 C T  I  <5S+     0   0   18  108   73      .......................G.........A   ....g.............  .      ..
   211  131AC L  I ><  S-     0   0  119  503   80      sYsseeSSeSQQMQQQ.SGsQSsSsVsSMMdT.l   ssSsrsssMSs.sRMAs.  s      AF
   227  146 C E  T 3  S+     0   0   47  527   75      SGSEGGTHGSSSSSSS.SEFDSSESPSSSSGD.Y   SSSEEEEESNSESESSS.  S      EP
   228  147 C K  T 3  S+     0   0  169  548   68      GSGGSSNGSGSSSSSS.GEGGGGGGMGGSSAQ.S   GGGGNGGGSGGKGQPGG.  P      GG
   229  149 C G  S <  S-     0   0   29  559   66      SPSGYYGGYSSTASTSVSHEGSSGSRIVSSAV.Y   ATTGGGGGTVVGSGASA.  A      GQ
   230  150 C R        -     0   0  213  584   86      YDYDSSEFSSAAVAAAENPKKNNTNSNNAANFFE   DNNSGSSSANNRNLDNDA  R      ME
   231  151 C Q  B     -R  224   0F  79  599   93      YIYSLLSPLYDDDDDDTYVLMYYLYVYYDDANNL   YYYATAAADYYVYLDYYD  Y      LF
   232  152 C S        -     0   0   14  607   51      PSPSPPSSPPKGSKGGSPSPSPPPPSPPSSPPPS   PPPSPSSSSPPQPAGPPR  P      AS
   233  153 C T  S    S+     0   0   48  608   73      DADKSSKESSNNNNNNFNRADNDAEPEDNNTFFP   DDSTKTTTNDDDDKDDDN  D      GY
   234  154 C R  B    S-P  150   0D 102  608   85      RTRTEEVVDLKKRKKKHLTQTLLLLQLLKKRYYV   ELLTTTTTRLLIQTKREK  K      QE
   235  155 C L        -     0   0    3  610    3      LLLLLLLLMLLLLLLLVLLLLLLVLLLLLLLLLL   LLLLLLLLLLLLLLLLLL  L      VL
   236  156 C K  E     -BD  98 221B  31  610   51      RQRLQRQLYQQQQQQQRQQQLQQQQNQQQQQQQK   QQQRQRRRQQQQQQQMQQ  Q      HH
   237  157 C M  E     -BD  97 220B  18  611   94      CYCARRTDRCCCCCCCACKCQCCHCKCCCCCCCS   CCCQMRQQCCCKCKCCCC  C      EC
   238  158 C L  E     - D   0 219B   4  612   44      LVLVVVLAVLLLLLLLVLVLALLVLVLLLLLLLV   LLLVVVVVLLLALALLLL  L      VV
   239  159 C E  E     - D   0 218B 107  612   72      DDDNDDTNDKNNNNNNSNEDSNDDDNDYNNDEEN   DNDALAAADNNPNSNDDN  E      QE
   240  160 C V  E     - D   0 217B   0  612   46      AVAVIIILIAIIIIIIVAMAVAAVAIAAIIVVVV   AAAVVVVVIAAVAVIAAI  A      VV
   241  161 C P  E     - D   0 216B  34  612   28      PYPPDAPPDPPPPPPPPPKPQPPPPNPPPPPPPD   PPPPPPPPPPPPPKPPPP  P      PP
   242  162 C Y  E     -F  263   0B  36  613   46      IIITVVIIIVIIIIIIVIVVVIIILLLLIIIIII   VIVIKIIIILLFVMIIVI  L      II
   243  163 C V  E     -F  262   0B  24  614   37      LVLLVVIWVLLLLLLLVLIIILLLLVLLLLVLLF   LLLVVVVVLLLMLILLLL  L      LL
   244  164 C D     >  -     0   0   88  613   57      SSSSSSDRASSSSSSSNSPSDSDTSKASSSDSSN   TSSASAATSSSSSNSSSS  S      SS
   245  165 C R  H  > S+     0   0   51  613   78      DRDVRRQRRDDDRDDDKDWESDDLQWQQTTENNN   QDDDADDDDDDKADDDQD  D      LD
   246  166 C N  H  > S+     0   0  105  614   74      SKSAEKENESRRERRRSSDRASADAEEAKKQKKC   ASSATAAAEAAEATSTAR  N      II
   247  167 C S  H  > S+     0   0   48  614   78      STSEQEVEQSDDDDDDESRKRSQQQIQDDDDDDQ   KVSAAAAADEEEEVDNED  T      QD
   248  168 C j  H  X S+     0   0    1  614    2      CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCY   CCCCCCCCCCCCCCCCCC  C      CC
   249  169 C K  H >< S+     0   0   88  614   73      RaRKdnqenKDDDDDDIRARnRHrESEENNEEEY   KHKnsnnnEKKqSQSREE  F      rE
   250  170 C L  H 3< S+     0   0  150  574   89      SyS.ssfieSNNNNNN.S.DdSNkA.AANNDGG.   ASSyyyyyRAArDKNNAN  N      kN
   251  171 C S  H 3< S+     0   0   23  604   76      SASKKKARESSSSSSSRSASASAYSSASSSASS.   SASAAAAASSSYAYSSSS  A      YS
   252  172 C S    <<  -     0   0   20  607   83      YYYSAARSAYYYYYYYSYRYYYYRYLYYYYYYYY   YYYSPSSSYYYWYLYYYY  Y      RY
   253  173 C S  S    S+     0   0   79  607   83      PGPVGNYDGPPPPPPPYPFPQPPAPLPPPPPPPY   PPPYSYYYPPPKPSPPPP  P      AP
   254  174 C F  S    S-     0   0  124  607   79      GDGSAARPAGGGDGGGPNPGGNGSGTGGGGGGGF   LGGGYGGGGGGHGNGGGG  F      NG
   255  175 C I        -     0   0  100  608   87      QDQNDEIITQQMMQMQIQQKEQQRQLQEMMMRRR   KKKGNGGGIEERESMEKM  Q      RR
   256  176 C I        -     0   0   13  609   18      IIIFVVVDIIIIIIIILIVIVIIIIFIIIIIIIV   IIIIIIIIIIIIILIIII  I      II
   257  177 C T    >   -     0   0   16  614   35      TKTSSTTYTTTTTTTTTTTTTTTTTTTTTTSTTT   TTTTTTTTDTTGTTTTTT  T      TT
   258  178 C Q  T 3  S+     0   0  133  614   68      SPSDEDARDGDDDDDDDSHDESNSDKDSDDRDDD   SSSAPAAAYSSDNTNSND  E      DE
   259  179 C N  T 3  S+     0   0   24  614   60      NSNRNNNYNNAAAAAARNNNENNNSNNNAARRRN   NNNRRRRRTNNKNRSNNA  N      NS
   260  180 C M  E <   - G   0 311B   2  614   13      MMMMMMMQMMMMMMMMMMMMMMMMMMMMMMMMMM   MMMMMMMMMMMVMMMMMM  M      MM
   261  181 C F  E     - G   0 310B   8  613   35      FIFLIILFIIFFFFFFLFLFLFMLVLVIFFVVVI   FIFILIIIFIIIMLFFFF  I      IM
   262  182 C j  E     +FG 243 309B   1  614    1      CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC   CCCCCCCCCCCCCCCCCC  C      CC
   263  183 C A  E     +FG 242 308B   0  614   26      AAAAGGAAGVAAAAAAAAAVAALAAAAAAAAAAA   VLLAAAAAAAAAVSAAVA  A      AA
   264  184 C G  S    S-     0   0    3  614   10      GHGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      GG
   265  185 C Y        -     0   0   56  591   57      FAFVDDDPNFYYDYYYYFFFIFFKFNFFYYYYYS   FFFFTFFFYFFYFYYFFY  Y      RY
   266  185AC D  S    S-     0   0   81  594   83      LSLSVVTKVLLLLLLLRLELMLLGLSLLLLMLLL   LLLTPTTTLLLDMLLLLL  L      GL
   267  185BC T  S    S+     0   0   76  614   61      EGEQaaTDaEEEEEEENEEDEEEKEQEEEEDEES   EEEAESSAEEEEESEEEE  E      SD
   268  186 C K  S    S-     0   0  107  563   32      G.GGggGGgGGGGGGGGGGGGGG.GEGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      .G
   269  187 C Q  S    S+     0   0  102  569   37      G.GGGGGEGGGGGGGGGGGGGGG.GGGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      .G
   270  188 C E        +     0   0   33  613   55      KKKKVKKEVKKKKKKKKKRKVKKQKKKKKKRKKR   KKKRKRRRKKKRKIKKKK  K      QK
   271  189 C D  B     -A   94   0A   7  614    4      DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD   DDDDDDDDDDDDDDDDDD  D      DD
   272  190 C A        -     0   0    7  614   42      SASASSTASSSSSSSSASSSTSSSSASSSSASSS   SSSAAAAASSSASASSSS  S      SA
   273  191 C k    >   -     0   0    7  614    3      CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC   CCCCCCCCCCCCCCCCCC  C      CC
   274  192 C Q  T 3  S+     0   0   90  614   25      QQQQQQHDQQQQQQQQQQQQQQQQQQQQQQNQQQ   QQQQQQQQQQQKQQQQQQ  Q      QQ
   275  193 C G  T 3  S+     0   0    6  614    8      GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      GG
   276  194 C D    X   +     0   0    0  614    0      DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD   DDDDDDDDDDDDDDDDDD  D      DD
   277  195 C S  T 3  S+     0   0   14  614    1      SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS   SSSSSSSSSSSSSSSSSS  S      SS
   278  196 C G  T 3  S+     0   0    0  614    0      GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      GG
   279  197 C G    <   -     0   0    0  614    1      GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSSGGG   GGGGGGGGGGGGGGGGGG  G      GG
   280  198 C P  E     - H   0 294B   1  614    2      PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP   PPPPPPPPPPPPPPPPPP  P      PP
   281  199 C H  E     -EH 219 293B   0  614   49      VLVAVVLLVVVVVVVVIVLLLVVLVLVVVLLLLL   VVVLLLLLVVVLVLVVVV  M      LL
   282  200 C V  E     -EH 218 291B   3  614   26      VVVVVVVMVVVVVVVVVAVVMAVLVVVVVVVVVM   VVVVVVVVVVVSVSVVVV  M      LV
   283  201 C T  E     - H   0 290B   0  614   66      CSCSDDYYDCCCCCCCRCCCYCCVCCCCCCCCCC   CCCAYAAACCCCCCCCSC  C      VC
   284  202 C R  E     + H   0 289B  99  614   70      NGNNVVNKVNNNDNNNVSSNQSNRNQNNNAANNN   NNNGNGGGNNNRNFNNNN  D      QN
   285  203 C F  E >  S- H   0 288B  22  614   71      GGGNAKNmAGGGGGGGSGsGSGGNGkGGGGGGGG   GGGGEGGGGGGHGeGNGN  G      EG
   286  204 C K  T 3  S-     0   0   85  222   71      .......s..........g....G.q........   ...........E.s....  .      G.
   287  205 C D  T 3  S+     0   0  108  223   55      .......G..........E.G..D.S........   ...........E.G....  .      D.
   288  206 C T  E <   - H   0 285B   3  233   75      ....TN.RS.......D.K.Q..K.I........   ...........V.K....  .      R.
   289  207 C Y  E     - H   0 284B  21  242   51      ....KN.WN.......G.W.W..H.W........   ...........W.W....  .      L.
   290  208 C F  E     -cH 200 283B   0  613   91      QLQVQQVAQQEEEEEEVVSQQVEEEYEEEEEEEK   QAQRKRRREEEYEFQQEE  E      EE
   291  209 C V  E     + H   0 282B   1  613   38      LLLQIVQVILLLLLLLLLQLVLLILQLLLVVLLF   LLLLLLLLLLLLLQLLLL  L      IL
   292  210 C T  E     +     0   0B   1  613   84      QVQLVVIVVQQQQQQQVQLQVQQVQLQQQQQHHM   QQQVAVVVQQQVQAQQQQ  Q      VQ
   293  211 C G  E     -IH 312 281B   0  613    0      GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      GG
   294  212 C I  E     -IH 311 280B   0  613   19      VIVVIIIIIIVVVVVVVIIIIIIIIIVIVLLVVI   IIVVVVVVVIIIIIIIIV  V      II
   295  213 C V  E     +I  310   0B   7  613   14      VVVVVVVVVVVVVVVVVVVIVVVVVVVVVVVVVV   VVVVVVVVVVVTVVVVVV  V      VI
   296  214 C S  E     -     0   0B   1  612    0      SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS   SSSSSSSSSSSSSSSSSS  S      SS
   297  215 C W  E     -I  309   0B  45  613    7      WWWFWWWWWWWWWWWWGWWWWWWWWWWWWWWWWW   WWWWWWWWWWWWWWWWWW  W      WW
   298  216 C G        -     0   0   26  613    0      GGGGGGGgGGGGGGGGGGGGGGGGGGGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      GG
   299  217 C E  S    S-     0   0   25  609   90      YYYSYYAgYYYYFYYYKYEYHYYVYEYYYQQQQI   YYYVLVVVYYYELEYYYY  H      VV
   300  218 C G  S    S-     0   0   19  612   13      GGGGGGQKGGGGGGGGGGGGGGGGGGGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      GG
   301  220 C k  S    S-     0   0    7  613    2      CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC   CCCCCCCCCCCCCCCCCC  C      CC
   302  221 C A  S    S+     0   0    4  612   16      AAAAAAAAAAAAAAAAAAAAGAAGAGAAAAAAAA   AAAAAAAAAAAAAAAAAA  A      GA
   303  222 C R    >   -     0   0  105  611   73      QIQRRRSVRQQEEQEQRQRLGQMREQQQEQQQQN   QLQRRRRREQQRQREQQE  Q      RE
   304  223 C K  T 3  S+     0   0  152  611   64      RPRPKKPAKKRRKRRRPRPKPRKAKKKKRPPPPP   KEKPPPPPKKKPEQRKKR  R      PP
   305  223AC G  T 3  S+     0   0   26  613   58      NGNGGGGGGNDDNDDDGNGGGNGGDKNNDNNNNY   RGGNKNNNDDDRGNNNND  N      GN
   306  224 C K    <   -     0   0   43  613   85      KYKNYYYQYKNNQNNNYKKKTKKYSKKKHYYYYY   RKKFYFFFHRRQYKHRRH  K      YL
   307  225 C Y        -     0   0   33  613   50      PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP   PPPPPPPPPPPPPPPPPP  P      PP
   308  226 C G  E     -G  263   0B   4  611    2      GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG   GGGGGGGGGGGGGGGGGG  G      GG
   309  227 C I  E     -GI 262 297B   6  612   11      VVVVVVVVVVVVVVVVVVIVVVVVVVVVVVVVVV   VVVVVVVVVVVVVVVVVV  V      VV
   310  228 C Y  E     -GI 261 295B   1  612    1      YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY   YYYYYYYYYYYYYYYYYY  Y      YY
   311  229 C T  E     -GI 260 294B   2  612   39      TVAATTTTTTAAAAAAATTTTTTTTTTTAVVTTT   TTTAAAAASTTTTTATTA  T      TT
   312  230 C K  E >   - I   0 293B  21  612   42      KNKNRRRRRKKKKKKKKKFKKKKRKKRKRKKKKK   KKKKKKKKKKKKKRKKKK  K      RK
   313  231 C V  G >  S+     0   0    1  611    8      VVVVVVIVVVVVTVVVIVVVVVVVVVVVVVVVVV   VVVVVVVVVVVVVVVVVV  V      VV
   314  232 C T  G 3  S+     0   0    2  609   71      CACTGGSSGCCCCCCCSYFCTYCACSCCCCCCCR   YYCSSSSSCCCACTCCYC  C      SC
   315  233 C A  G <  S+     0   0   29  609   79      NDNANNTASNLLILLLSNNNANNRNNNNLEESSN   NNNNANNNVNNDNSINNL  N      RS
   316  234 C F  S <> S+     0   0    7  605   35      YFYLFFIFFYFFFFFFVYYYFYYYFYFYFFFLLY   YYYLLLLLQYYYYLFYYF  Y      YL
   317  235 C L  H  > S+     0   0   23  603   80      NNNRVIRSIVNNTNNNRVLLLVILVLVVTLLTTL   VLVRRRGRTVVAVRSNVN  I      LV
   318  236 C K  H  > S+     0   0  116  602   68      SSSGDDSDDNDDDDDDENNDNN PDLDDSPPPPG   DSNSESSSDDDDSDDTDD  S      NS
   319  237 C W  H  > S+     0   0   26  602    1      WWWWWWWWWWWWWWWWWWWWWW WWWWWWWWWWW   WWWWWWWWWWWWWWWWWW  W      WW
   320  238 C I  H  X S+     0   0    1  599   12      IIIIIIIIIILLLLLLIIIIII LIIIILIIIII   IIIIIIIILIIIIILIIL  I      II
   321  239 C D  H  < S+     0   0   66  570   71      RDRREETYDQEEQEEE RKQ R RKDQQEQQNNN   KQQQDQQQLQQ QKDRKE  K      NN
   322  240 C R  H >< S+     0   0  136  556   71      NANKSSKHSQTTSTTT Q Q Q AQTEQSDDDD    DQQSESSSEEE S SNDS  D      TD
   323  241 C S  H >< S+     0   0    6  523   72      TATT   K TTTTTTT T T T NT TTTTTII    TTTN NNNTTT T TTTT  T      NT
   324  242 C M  T 3< S+     0   0   25  479   41      M M    I IMMMMMM I I I LI MIMLLLL    IIV     MII I MMIM  M      MI
   325  243 C K  T <  S+     0   0  153  444   70      S A    S AAAAAAA   E A DA AAAEESS    AAA     AAA A ASAA  A      KS
   326  244 C T    <         0   0   51  390   65      S S    S ANSSSSN   A A DK AASAATT    AAA     SAA S SSAS  S        
   327  245 C R              0   0  197  273   47      N N      N         N N  H NNNNN      NNN      NN H NNN            
## ALIGNMENTS  701 -  770
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1   49 L Q              0   0  101  671   35    D DDDDDDDDDDQ     Q                                          H    H 
     2   50 L a    >   +     0   0   22  858    0    CCCCCCCCCCCCC     C                                          C    C 
     3   51 L E  T 3  S+     0   0  187  858   80    AAAAAAAAAAAAL     D                                          K    Q 
     4   52 L T  T 3  S-     0   0  105  864   61    SSSSSSSSSSSSS     P                                          S    S 
     5   53 L S    <   +     0   0   89  868   72    FFFFFFFFFFFFN     M                                          E    E 
     6   54 L P        +     0   0   10  878   31    PPPPPPPPPPPPP     P                                          P    P 
     7   55 L b        -     0   0   18  893   21    CCCCCCCCCCCCC     C                                          C    C 
     8   56 L Q  S    S+     0   0   92  892   83    FLFALLLLFLLLF     V                                          A    Q 
     9   57 L N  S    S-     0   0   63  893   51    NNNNNNNNNNNNN     N                                          N    N 
    10   58 L Q  S    S-     0   0  152  893   57    GGGGGGGGGGGGG     G                                          G    G 
    11   59 L G        -     0   0   16  893   40    GGGGGGGGGGGGT     T                                          A    A 
    12   60 L K  E     -S   23   0G 117  852   79    TTTTTTTTTTTTC     C                                          T    T 
    13   61 L a  E     -S   22   0G  45  882   10    CCCCCCCCCCCCL     M                                          C    C 
    14   62 L K  E     -S   21   0G 155  890   81    QQQQQQQQQQQQD     D                                          n    V 
    15   63 L X  E     +S   20   0G 120  768   39    DDDDDDDDDDDD.     .                                          q    D 
    16   64 L G        -     0   0   44  862   73    GGGGGGGGGGGGN     Q                                          G    Q 
    17   65 L L  S    S-     0   0  152  871   64    VVVIVVVVVVVII     I                                          N    I 
    18   66 L G  S    S+     0   0   67  883   63    NNNNNNNNNNNNG     G                                          N    N 
    19   67 L E        -     0   0  119  837   61    DDDDDDGDDDDDR     G                                          .    T 
    20   68 L Y  E     -S   15   0G  37  883   11    YYYYYYYYYYYYF     F                                          Y    Y 
    21   69 L T  E     -S   14   0G  71  886   82    SSSSSSSSSSSSN     N                                          I    I 
    22   70 L b  E     -S   13   0G  20  889    0    CCCCCCCCCCCCC     C                                          C    C 
    23   71 L T  E     -S   12   0G  85  890   86    TTTTTTTTTTTTI     I                                          I    I 
    24   72 L c        -     0   0   44  890    0    CCCCCCCCCCCCC     C                                          C    C 
    25   73 L L    >   -     0   0   62  890   88    PPPPPPPPPPPPN     N                                          P    P 
    26   74 L E  T 3  S+     0   0  177  890   75    PPPPPPPPPPPPQ     L                                          P    V 
    27   75 L G  T 3  S+     0   0   29  893   20    GGGGGGGGGGGGG     G                                          K    N 
    28   76 L F  E <   +T   36   0H  40  893    9    YYYYYYYYYYYYW     W                                          F    L 
    29   77 L E  E     +T   35   0H  74  893   73    SNSNNNNSNNNSE     E                                          E    E 
    30   78 L G  S >  S-     0   0   32  889    5    GGGGGGGGGGGGG     G                                          G    G 
    31   79 L K  T 3  S+     0   0  156  891   73    KKKKKKKKKKKKR     N                                          R    R 
    32   80 L N  T 3  S-     0   0   33  892   62    NNNNNNNNNNNNL     N                                          N    H 
    33   81 L c  S <  S+     0   0    1  892    3    CCCCCCCCCCCCC     C                                          C    C 
    34   82 L E        +     0   0   87  891   44    SSSSSSSSSSSSQ     E                                          D    D 
    35   83 L L  E    S-T   29   0H  96  889   88    TTTATTTTTTTTY     Y                                          K    K 
    36   84 L F  E     -T   28   0H 139  889   83    PPPPPPPPPPPPE     E                                          a    e 
    37   85 L T        -     0   0   44  677   75    ............a     i                                          v    s 
    38   86 L R        +     0   0   57  408   92    ............y     d                                          s    s 
    39   87 L K        +     0   0   96  535   81    ............T     A                                          Y    F 
    40   88 L L        -     0   0   91  608   90    ............D     N                                          V    G 
    41   89 L d  S  > S+     0   0   15  617   29    ............C     C                                          C    C 
    42   90 L S  T  4 S+     0   0   98  624   84    ............S     S                                          L    L 
    43   91 L L  T >4 S-     0   0  120  627   87    ............T     I                                          Y    Y 
    44   92 L D  G >4 S-     0   0  107  638   73    ............Y     N                                          K    R 
    45   93 L N  G >< S-     0   0    8  700   56    VVVVVVVVVVVVN     N                                          N    N 
    46   94 L G  G <  S-     0   0    0  882   52    STSSSSSRSSSSG     G                                          G    G 
    47   95 L D  G <  S+     0   0   44  887   62    KKKKKKKKKKKKG     G                                          G    G 
    48   96 L e    <   -     0   0    0  892    0    CCCCCCCCCCCCC     C                                          C    C 
    49   97 L D  S    S-     0   0   59  892   74    EEEEEEEEEEEEE     E                                          E    E 
    50   98 L Q  S    S+     0   0    2  892   63    hhhhhhhhhhhhH     H                                          H    H 
    51   99 L F  E     -U   62   0I   4  892   80    ttttttttttttF     F                                          F    F 
    52  100 L d  E     +U   61   0I  10  893    1    CCCCCCCCCCCCC     C                                          C    C 
    53  101 L H  E     -U   60   0I  68  893   87    HHHHHHHHHHHHN     Y                                          T    V 
    54  102 L E  E     -U   59   0I  92  893   68    EEEEEEEEEEEEE     H                                          D    E 
    55  103 L E  S    S-     0   0  100  893   82    RRRRRRRRRRRRd     p                                          V    t 
    56  104 L Q  S    S-     0   0  175  693   73    NNNNNNNNNNNNt     e                                          Q    e 
    57  105 L N  S    S+     0   0  154  838   66    NNNNNNNNNNNNq     q                                          d    . 
    58  106 L S  S    S-     0   0   58  853   65    RRRRRRRRRRRRR     N                                          v    t 
    59  107 L V  E     -U   54   0I   7  890   79    YYYYYYYYYYYYR     R                                          H    H 
    60  108 L V  E     -U   53   0I  45  891   88    VVVVVVVVVVVVY     Y                                          Q    S 
    61  109 L e  E     +U   52   0I   5  893    1    CCCCCCCCCCCCC     C                                          C    C 
    62  110 L S  E     -U   51   0I  24  893   75    EEEEEEEEEEEES     S                                          H    D 
    63  111 L f        -     0   0   23  893    0    CCCCCCCCCCCCC     C                                          C    C 
    64  112 L A    >   -     0   0    8  893   75    AAAAAAAAAAAAS     V                                          A    A 
    65  113 L R  T 3  S+     0   0  149  893   80    RRRRRRRRRRRRP     S                                          P    P 
    66  114 L G  T 3  S+     0   0   24  893    8    GGGGGGGGGGGGG     G                                          G    G 
    67  115 L Y  E <   -V   78   0J  20  893   11    YYYYYYYYYYYYY     F                                          Y    Y 
    68  116 L T  E     -V   77   0J  72  891   85    GGGGGGGGGGGGR     Q                                          S    T 
    69  117 L L  E     -V   76   0J  67  888   64    GGGGGGGGGGGGL     L                                          L    L 
    70  118 L A    >   -     0   0   23  889   78    LLLLLLLLLLLHM     D                                          G    H 
    71  119 L D  T 3  S+     0   0  175  889   77    NNNNNNNNNNNND     I                                          E    S 
    72  120 L N  T 3  S-     0   0   92  694   44    CCCCCCCCCCCCD     N                                          D    D 
    73  121 L G  S <  S+     0   0   16  713   66    QQQQQQQQQQQQH     H                                          N    N 
    74  122 L K  S    S+     0   0   71  687   76                A     H                                          S    S 
    75  123 L A        -     0   0   22  685   66                K     S                                          S    S 
    76  124 L f  E     -V   69   0J  12  847    9                C     C                                          C    C 
    77  125 L I  E     -V   68   0J  78  846   80                E     E                                          I    V 
    78  126 L P  E     -V   67   0J  62  850   71                P     P                                          A    P 
    79  127 L T  S    S+     0   0  103  652   80                A     T                                          H    T 
    80  128 L G  S    S-     0   0   32  788   69                V     A                                          E    A 
    81  129 L P  S    S+     0   0  116  601   75                E     D                                          P    D 
    82  130 L Y  S    S+     0   0   59  794   86                F     F                                          F    F 
    83  131 L P    >   -     0   0   17  799   62                A     P                                          A    S 
    84  132 L g  T 3  S+     0   0   16  800    5                C     C                                          C    C 
    85  133 L G  T 3  S+     0   0    0  712   37                G     G                                          G    G 
    86  134 L K    <   -     0   0   69  588   68                K     V                                          R    R 
    87  135 L Q        -     0   0   37  477   65                V     L                                                 
    88  136 L T        +     0   0    4  428   78                K     Q                                                 
    89  137 L L        +     0   0  105  372   61                A     V                                                 
    90  138 L E              0   0  104  274   69                N     G                                                 
    91  139 L R              0   0  231  199   47                R                                                       
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2  II             IIIII IIIIIIIIIIIIIIIIIIII  IIII IIIIII IIIIIIII III  I
    94   17 C V  B     -A  271   0A   7  590    9  VV             VVVIV VVIVVVVVVVVVVVVVVIVV  VVVVVVVVVVV VVVVVVVV VVV  V
    95   18 C G  S    S+     0   0   25  591    6  GG             GGGGG GGGGGGGGGGGGGGGGGGGG  GGGGGGGGGGG GGGGGGGG GGG  G
    96   19 C G  S    S-     0   0   26  592    0  GG             GGGGG GGGGGGGGGGGGGGGGGGGG  GGGGGGGGGGG GGGGGGGG GGG  G
    97   20 C Q  E     -B  237   0B  98  593   95  SY             RRRVY YYYFYYRSYYYYNYYYYQYY  YKYYYYYETYY YYYYYTYT YYY  F
    98   21 C E  E     -B  236   0B  80  594   67  ST             EEEPT TTEEEEPTITTTTTEEIEET  EEETTEEDAET TITTTDTA TTT  E
    99   22 C h        -     0   0    8  594   58  AC             TTTAC CCCICCTTCCCCCCCCCCCC  CCCCCCCVACC CCCCCACT CCC  V
   100   23 C K    >   -     0   0  123  593   78  AE             TSSNQ QERDAAGTEQQGEETTEEAQ  RSQQQATDSAQ EEQQQVAT AAE  D
   101   24 C D  T 3  S+     0   0   60  594   85  LK             IIIIK REKIAAVIEEEKEEPPEPPE  KPPRRQPIAAE EEKEELAI EEE  V
   102   25 C G  T 3  S+     0   0    0  595   74  GN             EEERN NNNLHHNQNNNNNNHHNHHN  NYYNNHYSGHN NNNHHGNQ NNN  R
   103   26 C E  S <  S+     0   0   36  595   66  DS             EEEDS SSSESSQNSSSSSSSSSSSS  SSSAASSTESS SSSSSESA SSS  H
   104   27 C h    >   +     0   0    4  595   92  WL             HHHFL VVVVQQYFVVVLVVQQVRKV  VQQLLQQCFQV VVLVVFIH VVL  V
   105   28 C P  T 3   +     0   0    0  599    9  PP             PPPPP PPPPPPPPPPPPPPPPPPPP  APPPPPPGPPPPPPPPPPPP PPPP P
   106   29 C W  T 3  S+     0   0    5  600   26  WY             WWWWY YYYYWWWYYYYYYYWWYYWY  YHHYYWHWFWYWYYYYYYYY YYYY Y
   107   30 C Q  E <   -J  122   0C   7  601   26  QQ             QQQqQ QQMQQQLQQQQQQQQQQMQQ  QQQQQQQQIQQMQQQQQqQI QQQq Q
   108   31 C A  E     -JK 121 146C   1  593   49  VV             VVVhV VVVIVVAVVVVVVVVVVAVV  VVVVVVVIAVVAVVVVVtVV VVVy V
   109   32 C L  E     -JK 120 145C   3  598   68  SS             SSSIS SSSSSSRSSSSSSSYYSSHS  SSSSSSSSSSSRSSSSSFSS SSSL S
   110   33 C L  E     -JK 119 144C   0  601    9  LL             LLLLL LLLLLLLLLLLLLLFFLLLL  LLLLLLLFLLLLLLLLLLLL LLLL L
   111   34 C I  E     -JK 117 143C   0  601   81  HN             QQQEN NNNQNNVQNNNNNNTTNNNN  NNNNNNNQQNNSNNNNNGNQ NNNL Q
   112   35 C N  E >   - K   0 142C  30  601   88  VI             VFVNA SSVSIIYYSSSSSSQQSYYS  SSSSSLSSVIDYASAAAFSA AASQ T
   113   36 C E  T 3  S+     0   0   63  117   78  ..             ..... ....................  .................... ...K .
   114   37 C E  T 3  S-     0   0  136  242   77  Q.             LLS.. .......G......NE..K.  .......ES..........S ...D .
   115   38 C N  S <  S+     0   0   84  565   53  GG             GGGGG GGGYGGDGGGGGGGSNGGGG  GGGGGGGNGGGFGGGGGSGN GGGN S
   116   39 C E        -     0   0  100  589   94  IF             FFFSY YYYGYYGSYYYYYYQQYYSYQQYYYYYYYLRYSNYYYSSFSS YYSE G
   117   40 C G  E     +J  111   0C  14  600   57  HH             HHHHH HHHHHHQRHHHHHHVVHHFHEEHHHHHHHHHHHRHHHHHHHH HHHY H
   118   41 C F  E     +     0   0C  28  611   33  IN             FFFLF FFFFFFfIFFFFFFFFFFFFllFFFFFFFFIFLfFFFIIFFI FFFf F
   119   42 C i  E     -J  110   0C   0  612    1  CC             CCCCC CCCCCCcCCCCCCCCCCCCCccCCCCCCCCCCCcCCCCCCCC CCCc C
   120   43 C G  E     -J  109   0C   1  612    1  GG             GGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG G
   121   44 C G  E     -J  108   0C   0  612    9  GG             GGGGG GGGGGGAGGGGGGGGGGGGGAAGGGGGGGGGGGGGGGGGAGG GGGG G
   122   45 C T  E     -JL 107 130C   0  612   45  SS             SSSSS SSSSSSSSSSSSSSSSSVSSSSSSSSSSSSTSSMSSSSSSSA SSSS S
   123   46 C I  E     + L   0 129C   0  612   23  IL             IIIIL LLLILLLILLLLLLLLLLLLILLLLLLLLILLLLLLLLLILI LLLI I
   124   47 C L        -     0   0    6  612   27  II             IIILI IIIIIILIIIIIIIVVIIIIIIVVVIIIVIIIIIIIIIIYIL IIII V
   125   48 C S  S    S-     0   0   22  612   56  TS             SSSSS NSSGSSTSSNNNSRTTSNANSSNNSNNNNANSNNSSNTTNNS SSSS S
   126   49 C E  S    S+     0   0   99  612   63  PD             EQEED SESESSKAEDDNEEPPEKPDDDEEDSSDEPSSDDDESDDESS DDEK H
   127   50 C F  S    S+     0   0   42  612   83  DQ             DDDWQ QQSNEEDNQQQQQQRRQQRQRENNSQQQNKNEQRQQQQQNQT QQQR N
   128   51 C Y  E     - M   0 185C   7  612   34  WW             TTTWW WWWWWWYYWWWWWWWWWWWWWWWWWWWWWWTWWYWWWWWYWW WWWH F
   129   52 C I  E     -LM 123 184C   0  612   14  IV             IIIIV VVVVVVVVVVVVVVIIVVIVVIVVVVVIVIIVVVVVVVVAVI VVVI V
   130   53 C L  E     +LM 122 183C   0  612   27  VL             LLLLV VVVLVVLLVVVVVVIIVLVVLLVVVVVIVLVVVLVVVLLIVL VVVL F
   131   54 C T  E     - M   0 182C   0  612   43  TS             TTTTS SSSTSSTTSSSSSSSSSSSSTTSSSSSSSTTSSTSSSSSTST SSST T
   132   55 C A    >>  -     0   0    0  613    2  AA             AAAAA AAAAAAAAAAAAAAAAAVAAAAAAAAAAAAAAAAAAAAAAAA AAAA A
   133   56 C A  G >4 S+     0   0    0  613    9  AA             GGGAA AAAGAAAAGAAGGGAAGAAAAAAAAAAAAASAAAAGAAAGAA AAAA A
   134   57 C H  G >4 S+     0   0    7  613    0  HH             HHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HHHH H
   135   58 C i  G X4 S+     0   0    0  613    1  CC             CCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCC C
   136   59 C L  G << S+     0   0   31  613   66  VY             TTTFY YYYAYYVIYYYYYWYYYWYYIIYYYYYWYVSYYVYYYYYVYL YYYI T
   137   60 C Y  G <  S+     0   0  109  613   87  ER             VVVKK KKQDQQRIKKKKKKRRKYLKFLKKKKKQKEVQMKKKKHHYKG QQKE D
   138   61 C Q  S <  S+     0   0   95  613   78  eP             ssnsS SSSdTTrgSTTTPLPTSNLTyySSSSSNSwrTPgSSSPPgSr YYTG g
   139   61AC A        -     0   0   16  373   75  w.             aaaa. ...dAAra......PP.PP.ti.....P.lpA.w.....p.v ...I a
   140   62 C K  S    S-     0   0  172  387   77  T.             SSSS. ...VSSNS.....GKK.YK.EN.....Y.KSS.F.....S.S ...S S
   141   63 C R  S    S-     0   0  162  602   78  AN             MMMTR RRRGRRKQRRRRHRTTRAYRDDRRRRRARDNRRMRRRQQGRV RRRK H
   142   64 C F  E     -K  112   0C  36  609   54  FI             MMMLI IIILIIIHIIIIIILLIMVIIIVVVIIQVILIIIIIILLLIY IIIV L
   143   65 C K  E     -K  111   0C  67  609   79  AQ             ASSEQ QQNNSSRRQQQQEQVVQQVQLLVEEQQIETRSQKQQQQQQQS QQQT K
   144   66 C V  E     -KN 110 161C   0  609   16  GV             VVVVV VVVVVVVIVVVVVVAAVVAVVVVVVVVAVVVVVVVVVVVIVI VVVV V
   145   67 C R  E     -KN 109 160C  40  609   55  IR             RRRTR RRRRRRIRRRRRRRHHRMHRRRRRRRRVRRRRRTRRRRRVRR RRRR R
   146   68 C V  E     +KN 108 159C   1  610   43  LL             LVVHL LLLVIILVLLLLLLLLLLILILLMMLLVIIVILFLLLLLALA LLLI V
   147   69 C G  S    S+     0   0    9  610   15  RG             GGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG G
   148   70 C D        +     0   0   11  611   58  QE             SSSGE EEESEEDSEEEEEEDDEEMEKKEEEEEDESSEEEEEEEEEES EEES S
   149   71 C R  S    S+     0   0   24  611   73  SH             SSSEH HHHSHHYTHHHHHHHHHHHHHHHHHHHHHSLHHHYHHHHLHS HHHS N
   150   72 C N  B >   -P  234   0D  18  611   65  FN             RRKNN NNNLNNDFNNNNNNDDNDDNYNNHHNNHNISNNNNNNNNDNV NNNN E
   151   73 C T  T 3  S+     0   0   56  611   80  MI             TTTLI IIIHIIQSIIIIIILLIVVIRRIIIIIILRTIIRIIIIIMIR IIIS H
   152   74 C E  T 3  S-     0   0  119  611   84  FN             DASDD AEAGFFFNENNEEETTERSNTARRGDDWRNTFECDEDYYSDN DDKN G
   153   75 C Q  S <  S-     0   0  130  610   85  YV             RDSTV VVVSVVVSVVVVVVKKVVKVKKAVMAAMVKSVVDVVVEEVVS VVVK A
   154   76 C E        +     0   0  165  610   85  GI             GGGQL SLSGTTaGLLLLLLEELFALYFNTTLLYYGGTEDLLVIINLG VVLG G
   155   77 C E        -     0   0   93  469   27  SE             ....E EEE.EEe.EEEEEEEEEEEEEEEEEEEEE..EESEEEEEEE. EEEG .
   156   78 C G  S    S+     0   0   46  578   34  GG             GGG.G GGGGGGTGGGGGGGGGGGGGRKGGGGGGEGGGGVGGGGGGGG GGGT G
   157   79 C G  S    S+     0   0   47  585   75  YD             VAAND GNTQTTPTNNNTNNTTNTTNqgTKNGGTTRTTNrNNGAASNQ GGNV D
   158   80 C E        -     0   0   37  472   30  .E             ...LE EEE.EEA.EEEEEEEEEEVEeeEEEEEEE..EEeEEEEEEE. EEE. .
   159   81 C A  E     -N  146   0C  27  487   57  .Q             ...TQ QQQ.QQI.QQQQQQQQQQQQKKQQQQQQQ..QQTQQQQQQQ. QQQ. .
   160   82 C V  E     -N  145   0C  71  590   83  .F             LLLKF FFFLRRMIFFFFFFHHFLIFIIFFFFFYFVLRFRFFFFFTFV FFF. F
   161   83 C H  E     -N  144   0C  14  599   76  .I             HHHII IIIVIIRYIVVIIIIIIMIVRVIIIIIMIHVIIFIIIIIIII IIIY F
   162   84 C E        -     0   0   90  602   78  RD             EDEKN NNDPQQANNNNNNNQQNKQNMASSDDDSSKGQNVNNDDDTNA DDNT K
   163   85 C V  E     -O  186   0C  27  607   64  VA             VVVVS SASVAAVAAAAAAAVVATVALISSSAAVSVVASLSAAAAVAA AAAA V
   164   86 C E  E    S+     0   0C  70  608   73  AA             RHQDA AASKSSTAAAAATAEEADEAEDSSSAAESISSARAAAAASAS SSAK K
   165   87 C V  E     -O  185   0C  13  609   72  KK             EEKKK KKTPKKAQKKKKKKANKTKKRERRRKKARDAKKAKKKKKKKR KKKS K
   166   88 C V  E     -O  184   0C  72  610   46  VI             IIVLV IIVVAAIVIIIIIKAIIISIIIVVVIIIVFVAVIVIIMMIIV IIIK V
   167   89 C I  E     +O  183   0C  27  610   43  II             VVVII IIIIIIIIIIIIIIYYIIFIIIIIIIIYIHYIIAIIIIIIII IIIV H
   168   90 C K  E     -O  182   0C  68  610   82  SL             RRRIR RRRQRRRRRKKRRRKKRWQKIVRRRRRWRMTRRQRRRLLLTM RRRA Q
   169   91 C H    >   -     0   0   19  611   13  HH             HHHHH HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHKHHHHHHHH HHHH H
   170   92 C N  T 3  S+     0   0  156  611   61  PP             EEENP PPPPPPRAPPPPSPSFPPYPPPPPPPPQPPPPPFPPPPPEPP PPPP P
   171   93 C R  T 3  S+     0   0  150  608   73  NN             NNNYK RKSQQQSSKNNNKKSSKDKNKKNNQNNSNSNQRSNKSDDNNS KKQK L
   172   94 C F    <   -     0   0   24  611    5  YY             YFYFY YYYYYYFYYFFYYYYYYYYFYYYYYYYYYYYYYFYYYYYFFY YYYY F
   173   95 C T     >  -     0   0   56  611   68  DS             kkrDN NNNNSNDNNNNNNNKKNDNNnnSSDNNDSnNSNLNNNDDDNN SSDN N
   174   96 C K  T  4 S+     0   0  145  561   78  PK             iifSS QSSPSSQSSRRRGRDDSYSRrkSSSAAYSrASS.SSAKKYGS SSRS Y
   175   97 C E  T  4 S+     0   0  174  569   91  KD             LYYWA NWFSAANRRKKNNKENRQSKEEYYYNNTYAAAW.WRNWWDNR WWKK Q
   176   98 C T  T  4 S-     0   0   44  598   57  TT             GGGFT TTTTTTSTTTTTTTADTTNTNNNNNTTTNDTTTNITTTTLTT TTTT T
   177   99 C Y    ><  +     0   0   60  604   65  KS             IIAYI MLLIIIYLLLLLLLYVLLILLLIIIYYLIYYILFLLFVVLLI LLLK V
   178  100 C D  T 3   +     0   0   25  609   37  ND             pppLD DDDDDDNDDNNNNDDDDDDNDNDDDNNDNDDDDDDDDDDDDD DDNN D
   179  101 C F  T 3  S+     0   0   21  595   66  NN             nnnNN NNNFNNHYNNNNNNHHNHNNRRNNNNNYNFYNNNNNNNNNNF NNNN Y
   180  102 C D    <   +     0   0    1  609    0  DD             DDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDD D
   181  103 C I        +     0   0    0  611   13  II             VVVII IIIFIIIIIIIIIIIIIIIIIIIIIIIIIVVIIIIIIIIIII IIIF F
   182  104 C A  E     -MO 131 168C   0  611   60  AM             AAAAM MLMAMMAGLMMLMLMMLMMMAAMMMMMMMAAMMAMLMMMSMA LLMA S
   183  105 C V  E     -MO 130 167C   0  612   16  LL             VLVLL LLMLLLLLLLLLLLLLLLLLLLLLLLLLLVILLLLLLLLLLL LLLI L
   184  106 C L  E     -MO 129 166C   0  613   30  ML             LLLLI IIILIILVILLIIIVVIIILILIIIIIMILWIILIIIIILIV IIIV L
   185  107 C R  E     -MO 128 165C  40  613   43  KK             KKKLK KKKEKKKRKKKKKKKKKKKKQHKKKKKKKEKKKRKKKKKKKQ KKKT E
   186  108 C L  E     - O   0 163C   0  613   16  LL             LLLLL LLLLLLLTLLLLLLLLLLLLLMLLLLLLLLLLLLLLLLLLLL LLLV L
   187  109 C K  S    S+     0   0  101  613   69  QK             KKKKS SSNESSRSSSSSSSAASFASKRSSSKKASESSSNSSNKKSSA SSSN E
   188  110 C T  S    S-     0   0   82  614   74  TS             ASSSS SSSQSSKSSSSSTTKKSHESRRKKKTTHEKTSSDSSSSSGSS TTSK E
   189  111 C P        -     0   0   48  614   39  PP             SSSPP PRPPPPPGPPPPPPPPPPPPPPPPPAAPPPPPPRPPPPPSPP PPRD S
   190  112 C I        -     0   0    4  562   63  MA             IIILA AAAVAAV.AVVAAAAAAVAVIIAAAAAVAV.AAVAAAAALAI AAAM I
   191  113 C T        -     0   0   95  566   73  TT             KDVST TVGQTTEIVTTVVVQQVEQTGTTTTTTTTS.TVPVVTTTTTT VVVA T
   192  114 C F        +     0   0   56  612   34  FI             LLLLI LILLLLFVILLIIIYYIVFLFFLLLLLVLYVLIILILLLFLI IIII F
   193  115 C R  B >   -Q  196   0E  52  613   63  NS             DSGGS NNNSNNTgNNNNNNNNNTNNTTNNNNNNNtsNSTNNNNNNNA NNNd N
   194  116 C M  T 3  S+     0   0   29  594   77  DS             NKKVS SASEQQKsSAAADDQQSEHANDQQQSSEQcgQSDASSSSNS. AAAk S
   195  117 C N  T 3  S+     0   0   13  602   90  KR             TTTRR RRYEYYTGRRRRYHYYRSHRYEYYYRRYYTNYRFRRRKKNRV RRRT V
   196  118 C V  B <   +Q  193   0E   0  604   27  VV             RTSKV VVVFAAIVVVVVVVVVVVVVIIVVVVVVVVIAVIVVVVVVVA VVVT R
   197  119 C A        -     0   0    1  606   80  KS             QQRVS SSNFQQRASAASSSQQSAQAHHQQQSSRQVAQSRASSSSAAR SSSK Y
   198  120 C P        -     0   0    8  608   54  PT             PPPPT STTPAAPSATTTTTPPAPPTPPPATTTPPSFATPTATTTPTA TTTI P
   199  121 C A        -     0   0    2  609   39  VI             VIIIV IIVVVIVIIVVIIIIIIIIVVVVVVVVVVVAVVIIIVIIIVI LLII V
   200  122 C g  B     -c  290   0B   1  610   66  CS             PPPCS SSSEPPCASAASPPPPSSPACCAAAAAAADSPSCSSSPPAST AAST R
   201  123 C L        -     0   0   27  612    5  LL             LLLLL LLLLLLLLLLLLLLVVLLLLLLLLLLLLLLLLLLLLLLLLLM LLLL L
   202  124 C P        -     0   0    7  613   30  PP             FFFSP PPPPPPPQPPPPPPAAPPAPPPPPPPPPPAPPPPPPPPPPPA PPPA P
   203  124AC E     >  -     0   0   92  612   75  NR             DDDER KTSESSKSTSSTNTRRTTHSTTSSSRRKTEASTSRTRQQARA SSTK E
   204  125 C R  H  > S+     0   0  109  612   78  PS             LLAVS SATQSSEAASSAAASSAGSSKKSSSSSASSSSSDAASYYQSQ AAAE K
   205  126 C D  H  > S+     0   0  124  612   85  GC             NKKTC CPCDCCRNPCCPPPCCPCCCEQCCCCCCCGGCCPCPCCCGCG CCPG D
   206  127 C W  H  >>S+     0   0    4  612   88  MP             EEEAA APAQVVSIPAAPPPPPPPPAIVAAAPPPATSVASAPGPPHAG AAPS D
   207  128 C A  I  X>S+     0   0    0  612   75  MT             VENIA AASEGGEAAPPAAARRAYMPVAAPPSSVPEDGPNAASTTTAP PPAS D
   208  129 C E  I  <5S+     0   0   75  613   82  LV             AVAEA AAAVTTPAAAAAAAEEAGKAQKAAAAAAAVPTAAPASAAAAP AATV V
   209  130 C S  I  <5S+     0   0   70  614   66  EG             ptpRG GGGEGGAGGGGGGGGGGGGGTTGGGGGGGKAGGYGGGGGTGT GGGP y
   210  131 C T  I  <5S+     0   0   18  108   73  ..             ggg.. ....................LL.................... .... g
   211  131AC L  I ><  S-     0   0  119  503   80  YS             Erq.s sstqQQSsssssSs..ssGsSSMQ.ss.TkrQsKSsSkkSSs SSsS Q
   227  146 C E  T 3  S+     0   0   47  527   75  ES             EEE.S TSSNTTEESFFSSS..SGFFGSSS.SS.MEETSESSSFFESE SSSE N
   228  147 C K  T 3  S+     0   0  169  548   68  KG             AGG.G GGGPSSGGGGGGGG..GDFGGPSS.GG.SGGSGDGGGGGGGN GGGG S
   229  149 C G  S <  S-     0   0   29  559   66  GV             GGG.T QASSVVGGAVVAAAGGAAGVQKTS.TT.SGGVIGTATFFGSG VVAG Q
   230  150 C R        -     0   0  213  584   86  KK             ANN.N RDNEGGTSDSSDDDEEDIESASAA.NNFTGSGNKNDNEENSP NNDS E
   231  151 C Q  B     -R  224   0F  79  599   93  TY             SAATY YYYSSSLAYEEYYYFFYMFELLDDSYYNDGGSYPYYYSSTYS YYYS S
   232  152 C S        -     0   0   14  607   51  SP             PPPEP PPPNPPPSPTPPPPPPPPPPPPRGGPPPSTSPPSPPPPPPPA PPPS N
   233  153 C T  S    S+     0   0   48  608   73  ED             DAATE DDDEDDATDDDDDDDDDNDDQTNNDSSFSLADECEDSSSDST DDDT K
   234  154 C R  B    S-P  150   0D 102  608   85  VL             VVVGL VEKAVVLTELLEEERRERRLVVKKKLLNRQSVLVLELVVVLT LLET H
   235  155 C L        -     0   0    3  610    3  LL             LLLLL LLLLLLVLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LLLL L
   236  156 C K  E     -BD  98 221B  31  610   51  NQ             HRHQQ QQMRMMQRQQQQQQQQQQQQQQQQQQQQQQLMQQQQQQQQQQ QQQR R
   237  157 C M  E     -BD  97 220B  18  611   94  AC             TTTKC CCCACCHQCCCCCCCCCCCCQQCCCCCCCGKCCECCCCCKCV CCCA A
   238  158 C L  E     - D   0 219B   4  612   44  AL             VVVVL LLLTVVVVLLLLLLVVLLLLVILLLLLVLVVVLVLLLLLVLV LLLV T
   239  159 C E  E     - D   0 218B 107  612   72  MD             DDDNK QDDNQQDADDDEDDDDDDDDNHNNQDDKDKSQDEDDDDDTKQ EEDH V
   240  160 C V  E     - D   0 217B   0  612   46  VA             VVVIA AAAVAAVVAAAAAAVVAVLALLIIIAAVLVVAAVAAAAAVAV AAAV V
   241  161 C P  E     - D   0 216B  34  612   28  RP             PPPQP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPQ P
   242  162 C Y  E     -F  263   0B  36  613   46  LV             IIILI IVIAVVIIVLLVVVVVVAVLIIIIIVVIIAVVLVIVVVVLVI LLVA K
   243  163 C V  E     -F  262   0B  24  614   37  IL             VVVIL LLLVLLLVLLLLLLLLLVLLVVLLLLLLLIVLLLLLLLLVLV LLLH Y
   244  164 C D     >  -     0   0   88  613   57  ES             TTSKS STSSSSTASPPTTSSSSSPPDESSSSSSSSASASTSSSSSSS SSSS N
   245  165 C R  H  > S+     0   0   51  613   78  PD             KKKWA DQDQDDLDQQQQQQDDQNEQQQDDDDDNEPRDQNQQDDDDDQ HHQD D
   246  166 C N  H  > S+     0   0  105  614   74  WP             TATES SATETTDAAAAATASSAEDAEDRRRSSVRKATEEAASSSASA AAAD E
   247  167 C S  H  > S+     0   0   48  614   78  SA             EEDTV TESESSQAEDDKKESSEDSDTIDDDSSEDDTSQVQESVVESN DDKE Q
   248  168 C j  H  X S+     0   0    1  614    2  CC             CCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCC C
   249  169 C K  H >< S+     0   0   88  614   73  nH             nssFS RERrRRrnEEEEKEKKEEKEKREDKTTEEaqREsEEKHHrKr EEEK n
   250  170 C L  H 3< S+     0   0  150  574   89  qK             yyy.N NANsNNkyAAAALAAAAKSAADNNNSSGNssNAnAASKKdSa AAA. y
   251  171 C S  H 3< S+     0   0   23  604   76  VA             EEEEA ASSYSSYASSSSSSSSSASSSSSSSSSSSGYSAYSSSAAYSY SSSK T
   252  172 C S    <<  -     0   0   20  607   83  YY             SSPLY YYYGYYRSYYYYYYCYYYYYTTYYYYYYYGPYYTYYYYYGYG YYYY Q
   253  173 C S  S    S+     0   0   79  607   83  NP             WWWMP PPPGPPAYPPPPPPRRPPGPKSPPPPPPPKQPPAPPPPPAPQ PPPF Y
   254  174 C F  S    S-     0   0  124  607   79  NG             GGGPG GGGYGGSGGGGGFGGGGGDGIIGGGGGGGDEGGSGGGRRDGS GGGR G
   255  175 C I        -     0   0  100  608   87  LM             GGGLQ QKEQDDRGKKKRRKLLKMDKKRMMMKKMMKTDQMQKKQQEQA QQKS G
   256  176 C I        -     0   0   13  609   18  II             IIILI IIIIIIIIIIIIIIFFIIIIVIIIIIIIIIIIIIIIIIIIII IIIL I
   257  177 C T    >   -     0   0   16  614   35  TT             PPPTT STTTTTTTTTTTTTTTTTTTTTTTTTTTTTSTTTTTTTTFTT TTTT T
   258  178 C Q  T 3  S+     0   0  133  614   68  PS             EEQKS SSNDNNSANGGSSSEENRNGSDDDESSDNDTNDDENSNNDGD NNSS K
   259  179 C N  T 3  S+     0   0   24  614   60  AN             GGGSN NNNRNNNRNNNNNNNNNRNNNNAASNNRASRNNNNNNNNSNR NNNN T
   260  180 C M  E <   - G   0 311B   2  614   13  MM             QQQMM MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MMMM M
   261  181 C F  E     - G   0 310B   8  613   35  IF             IIILI IFFIIILIFVVFFFFFFVFVFFFFFFFVFLFIVMIFFFFIIF IIFF I
   262  182 C j  E     +FG 243 309B   1  614    1  CC             CCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCC C
   263  183 C A  E     +FG 242 308B   0  614   26  AL             AAAAL LVAALLAAVAAAVVAAVAAAAAAAALLAAAALAAAVLLLAVA AAVA A
   264  184 C G  S    S-     0   0    3  614   10  GG             AAAGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG G
   265  185 C Y        -     0   0   56  591   57  YF             FYFDF YFFYYYKFFFFFFFFFFYFFYFYYYFFYYLVYFYFFFFFVFL FFFP F
   266  185AC D  S    S-     0   0   81  594   83  LL             PPPLL MLLQLLGTLLLLLLLLLMQLKKLLLLLLLPTLLLLLLLLPLL LLLP E
   267  185BC T  S    S+     0   0   76  614   61  QE             ATAEE QEEAEEKAEEEEEEEEEDEEppEQEEEEEESEEgEEEEEEEg EEEE E
   268  186 C K  S    S-     0   0  107  563   32  GG             GGGGG GGGGGG.GGGGGGGGGGGGGnkGGGGGGGGGGGgGGGGGGGg GGGG G
   269  187 C Q  S    S+     0   0  102  569   37  SG             GGGGG GGGGGG.GGGGGGGGGGGGGRTGGGGGGGGGGGEGGGGGGGG GGGG G
   270  188 C E        +     0   0   33  613   55  VK             RKKKK KKKKKKQRKKKKKKKKKRKKGGKKKKKKKKRKKKKKKKKKKR KKKK K
   271  189 C D  B     -A   94   0A   7  614    4  DD             DDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDD D
   272  190 C A        -     0   0    7  614   42  SS             TTTAS SSSASSSASSSSSSSSSASSAASSSSSASSSSSSSSSSSSSA SSSS A
   273  191 C k    >   -     0   0    7  614    3  CC             CCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCC C
   274  192 C Q  T 3  S+     0   0   90  614   25  QQ             QQQQQ QQQQQQQQQQQQQQQQQNQQEEQQQQQQQQQQQQQQQQQQQQ QQQQ Q
   275  193 C G  T 3  S+     0   0    6  614    8  GC             GGGGG GGGGGGGGGGGGGGVVGGGGGGGGGGGGGGGGGGGGGYYGGG GGGG G
   276  194 C D    X   +     0   0    0  614    0  DD             DDDDD DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DDDD D
   277  195 C S  T 3  S+     0   0   14  614    1  SS             SSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSS S
   278  196 C G  T 3  S+     0   0    0  614    0  GG             GGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG G
   279  197 C G    <   -     0   0    0  614    1  GG             GGGGG GGGGGGGGGGGGGGGGGSGGGGGGGGGGGGGGGGGGGGGGGG GGGG G
   280  198 C P  E     - H   0 294B   1  614    2  PP             PPPPP PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PPPP P
   281  199 C H  E     -EH 219 293B   0  614   49  LV             LLLLV VVVLVVLLVVVVVVLLVLLVFFVVVVVLVLIVVLVVVVVLVL VVVA L
   282  200 C V  E     -EH 218 291B   3  614   26  VA             VVVVV VVAVVVLVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVAVL AAVV T
   283  201 C T  E     - H   0 290B   0  614   66  TC             LVICC CSCECCVASCCSCSCCSCCCMMCCCCCCCDNCCACSCCCACA CCCK H
   284  202 C R  E     + H   0 289B  99  614   70  LN             AAAQN NNNGNNRGNNNNNNNNNFDNKKNNNNNNNESNNVNNNNNSNN NNNG G
   285  203 C F  E >  S- H   0 288B  22  614   71  KG             GGGkG RGGKGGNGGRRGGGGGGGGRssNGGGGGGNAGGrGGGGGDGG GGGN D
   286  204 C K  T 3  S-     0   0   85  222   71  S.             ...k. ......G.............dd...........d.....T.. .... .
   287  205 C D  T 3  S+     0   0  108  223   55  S.             ...S. ......D.............NN...........K.....G.. .... .
   288  206 C T  E <   - H   0 285B   3  233   75  I.             ...K. ......K.............RR...........R.....S.. .... .
   289  207 C Y  E     - H   0 284B  21  242   51  W.             ...W. ......H.............WW.......RK..Y.....T.. .... .
   290  208 C F  E     -cH 200 283B   0  613   91  WE             RRRYE EQETQQEREEEQQEEEEEEEYYEEEQQEQKGQEEEEQEEYQV EEQV V
   291  209 C V  E     + H   0 282B   1  613   38  LL             QQQQL LLLLLLILLLLLLLLLLVLLQQLLLLLLLQFLLLLLLVVLLL LLLQ L
   292  210 C T  E     +     0   0B   1  613   84  IQ             AAALQ QQQVQQVVQQQQQQYYQQFQVIQQQQQHQVIQQIQQQQQAQT QQQL V
   293  211 C G  E     -IH 312 281B   0  613    0  GG             GGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG G
   294  212 C I  E     -IH 311 280B   0  613   19  DI             IIIII IIIVIIIVIIIIIIVVILVIIIVVIVVIVVVIVVIIVIIIII IIVV V
   295  213 C V  E     +I  310   0B   7  613   14  TV             VVVVV VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VVVV V
   296  214 C S  E     -     0   0B   1  612    0  SS             SSSSS SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SSSS S
   297  215 C W  E     -I  309   0B  45  613    7  WW             WWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWWF W
   298  216 C G        -     0   0   26  613    0  GG             GGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG G
   299  217 C E  S    S-     0   0   25  609   90  SA             NNNVY IYYIRRVVYYYDYYWQYQHYEEYYYYYQYQYRYNYYYDDYYA YYDV F
   300  218 C G  S    S-     0   0   19  612   13  GG             GGGGG GGGGGGGGGGGGGGGGGGEGGGGGGGGGGGGGGGGGGGGGGG GGGG G
   301  220 C k  S    S-     0   0    7  613    2  CC             CCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCC C
   302  221 C A  S    S+     0   0    4  612   16  AA             AAAGA AAAAAAGAAAAAAAAAAAAADDAAAAAAAAAAAAAAAAAAAA AAAA A
   303  222 C R    >   -     0   0  105  611   73  KL             RRRQQ QQQELLRRQLLQLQQEQLKLRREEEQQQQRRLQRQQQLLRQR QQQR Q
   304  223 C K  T 3  S+     0   0  152  611   64  AK             KQKKK KKRPPPAPKPPKKKRRKPKPDDRRRRRPRPPPKPKKKEEPKP KKKK P
   305  223AC G  T 3  S+     0   0   26  613   58  YG             GGGKG GNDGNNGNNDDNRNNNNEGDGGDDDGGNDGNNNYNNGGGGNN GGNN K
   306  224 C K    <   -     0   0   43  613   85  RK             YYYQK KKRYYYYFRNNKRKAARYYNKKHHHKKYHKLYKYKRKKKYKS KKKN Y
   307  225 C Y        -     0   0   33  613   50  PP             PPPPP PPPPPPPPPPPPPPPPPPPPYYPPPPPPPPPPPPPPPPPPPP PPPP P
   308  226 C G  E     -G  263   0B   4  611    2  GG             GGGGG GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGG G
   309  227 C I  E     -GI 262 297B   6  612   11  VV             VVVVV VVVVVVVVVVVVVVVVVVVVFFVVVVVVVIVVVVVVVVVVVV VVVI V
   310  228 C Y  E     -GI 261 295B   1  612    1  YY             YYYYY YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YYYY Y
   311  229 C T  E     -GI 260 294B   2  612   39  AT             TTTTT TTTSTTTATTTTTTAATVTTTTAAATTTAAATTTTTTTTTTA TTTA S
   312  230 C K  E >   - I   0 293B  21  612   42  NK             EEEQK KKKRKKRKKKKKKKKKKKKKHHKKKKKKKKRKRRKKKKKEKS KKKK R
   313  231 C V  G >  S+     0   0    1  611    8  VV             IIIVV VVVEVVVVVVVVVVVVVVVVLLVVVVVVVVVVVVVVVVVVVV VVVV V
   314  232 C T  G 3  S+     0   0    2  609   71  TC             AAASC CYCACCASYCCYYYCCYCCCHFCCCCCCCSSCCTCYCCCSCP CCYS S
   315  233 C A  G <  S+     0   0   29  609   79  LK             SAASN NNNANNRNNNNNNNNNNEHNRRLLLKKSIHANNRNNNNNYNN NNNA S
   316  234 C F  S <> S+     0   0    7  605   35  FY             FVVYY YYYVYYYLYYYYYYYYYFYYMMFFFYYLF LYFYFYYYYHYL YYYA V
   317  235 C L  H  > S+     0   0   23  603   80  TL             RRRLV VVNRNNLRVVVLVVLLVLIVRRNNNVVII LNVLVVVLLVVR VVVA R
   318  236 C K  H  > S+     0   0  116  602   68  DD             DEESD SDTDSSPSDDDTDDRGDYDDQRDDDNNPD PSDDDDNNNDNA DDKK E
   319  237 C W  H  > S+     0   0   26  602    1  WW             WWWWW WWWWWWWWWWWWWWWWWWWWWWWWWWWWW FWWWWWWWWWWW WWWW W
   320  238 C I  H  X S+     0   0    1  599   12  II             IIIII IIIIIILIIIIIIIVVIIVIMMLLIIIIL IIIIIIIIIIII IIII V
   321  239 C D  H  < S+     0   0   66  570   71  YQ             KNREK RKRKAARQKQQKKEQQKENQMKEEDQQDE QAQRQKQHQKQR QQKK H
   322  240 C R  H >< S+     0   0  136  556   71  RE             EEETQ QDNESSASDDDNDDNDDDDDKKSTSQQSR QSEESDQQQ QT EENS E
   323  241 C S  H >< S+     0   0    6  523   72  QT               HKT TTT TTNNTTTTTTIITVITIVTSTTTIT  TTNTTTTT TN TTTT V
   324  242 C M  T 3< S+     0   0   25  479   41  MI               ATI IIM MML IIIIIIIIILMIIIMMMIILM  MMSIIVIV I  III  V
   325  243 C K  T <  S+     0   0  153  444   70  RA               NKA SAS AAD AAAAAAEEAQEA  AAAAASS  AAKAAAAA A  AAA   
   326  244 C T    <         0   0   51  390   65  AA               A A AAS AAD AAAAAANNATDA  SN AAIS  AADAAAEA A  AAA   
   327  245 C R              0   0  197  273   47  NN                 N NNN NN  NNNNNNNNN HN     NNN   NN NNNNN N  NNN   
## ALIGNMENTS  771 -  840
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1   49 L Q              0   0  101  671   35     R                    D           H                        Q  E    D
     2   50 L a    >   +     0   0   22  858    0     C          C         C          CC                        C  C   CC
     3   51 L E  T 3  S+     0   0  187  858   80     R          F         A          RQ                        A  M   AA
     4   52 L T  T 3  S-     0   0  105  864   61     Y          S         S          FS                        E  K   SS
     5   53 L S    <   +     0   0   89  868   72     S          S         F          NE                        K  N   FF
     6   54 L P        +     0   0   10  878   31     P          P         P          PP                        P  I   PP
     7   55 L b        -     0   0   18  893   21     C          C         C          CC                        C  S   CC
     8   56 L Q  S    S+     0   0   92  892   83     Q          L         L          QQ                        K  N   AF
     9   57 L N  S    S-     0   0   63  893   51     N          N         S          NN                        N  C   NN
    10   58 L Q  S    S-     0   0  152  893   57     G          Q         G          GG                        G  N   GG
    11   59 L G        -     0   0   16  893   40     G          G         G          GA                        A  Q   GG
    12   60 L K  E     -S   23   0G 117  852   79     M          R         T          MT                        M  Q   TT
    13   61 L a  E     -S   22   0G  45  882   10     C          C         C          CC                        C  C   CC
    14   62 L K  E     -S   21   0G 155  890   81     K          F         Q          RV                        S  S   QQ
    15   63 L X  E     +S   20   0G 120  768   39     D          N         D          ED                        D  N   DD
    16   64 L G        -     0   0   44  862   73     L          Q         G          NQ                        S  T   GG
    17   65 L L  S    S-     0   0  152  871   64     F          S         V          RI                        V  L   IV
    18   66 L G  S    S+     0   0   67  883   63     N          d         N          GN                        G  G   NN
    19   67 L E        -     0   0  119  837   61     D          e         D          VT                        G  S   DD
    20   68 L Y  E     -S   15   0G  37  883   11     F          F         Y          QY                        Y  Y   XY
    21   69 L T  E     -S   14   0G  71  886   82     N          S         S          EI                        D  T   SS
    22   70 L b  E     -S   13   0G  20  889    0     C          C         C          CC                        C  C   CC
    23   71 L T  E     -S   12   0G  85  890   86     T          R         T          LI                        V  Y   TT
    24   72 L c        -     0   0   44  890    0     C          C         C          CC                        C  C   CC
    25   73 L L    >   -     0   0   62  890   88     P          E         P          PP                        K  Y   PP
    26   74 L E  T 3  S+     0   0  177  890   75     T          P         P          PV                        S  S   PP
    27   75 L G  T 3  S+     0   0   29  893   20     G          G         G          LN                        G  G   GG
    28   76 L F  E <   +T   36   0H  40  893    9     F          F         Y          YL                        F  Y   YY
    29   77 L E  E     +T   35   0H  74  893   73     T          T         S          SE                        T  e   SS
    30   78 L G  S >  S-     0   0   32  889    5     G          G         G          GG                        G  d   GG
    31   79 L K  T 3  S+     0   0  156  891   73     K          G         K          TR                        V  H   KK
    32   80 L N  T 3  S-     0   0   33  892   62     K          W         N          NH                        H  T   NN
    33   81 L c  S <  S+     0   0    1  892    3     C          C         C          CC                        C  C   CC
    34   82 L E        +     0   0   87  891   44     E          E         S          ED                        E  I   SS
    35   83 L L  E    S-T   29   0H  96  889   88     H          S         T          TK                        K  D   TT
    36   84 L F  E     -T   28   0H 139  889   83     N          D         P          Ee                        D  I   PP
    37   85 L T        -     0   0   44  677   75     .          A         .          Vs                        E  D   ..
    38   86 L R        +     0   0   57  408   92     .          G         .          .s                        T  .   ..
    39   87 L K        +     0   0   96  535   81     .          D         .          SF                        L  .   ..
    40   88 L L        -     0   0   91  608   90     .          L         .          DG                        C  E   ..
    41   89 L d  S  > S+     0   0   15  617   29     .          C         .          CC                        V  C   ..
    42   90 L S  T  4 S+     0   0   98  624   84     .          E         .          KL                        V  A   ..
    43   91 L L  T >4 S-     0   0  120  627   87     .          Q         .          YY                        D  V   ..
    44   92 L D  G >4 S-     0   0  107  638   73     .          N         .          KR                        S  D   ..
    45   93 L N  G >< S-     0   0    8  700   56     I          V         V          NN                        D  N   VV
    46   94 L G  G <  S-     0   0    0  882   52     G          D         S          GG                        K  G   SS
    47   95 L D  G <  S+     0   0   44  887   62     D          E         K          GG                        G  E   KK
    48   96 L e    <   -     0   0    0  892    0     C          C         C          CC                        C  C   CC
    49   97 L D  S    S-     0   0   59  892   74     F          L         E          LE                        S  E   EE
    50   98 L Q  S    S+     0   0    2  892   63     d          s         h          HH                        Q  Q   xh
    51   99 L F  E     -U   62   0I   4  892   80     t          e         t          YF                        F  N   tt
    52  100 L d  E     +U   61   0I  10  893    1     C          C         C          CC                        C  C   CC
    53  101 L H  E     -U   60   0I  68  893   87     V          Q         H          SV                        K  H   HH
    54  102 L E  E     -U   59   0I  92  893   68     D          D         E          QE                        P  N   EE
    55  103 L E  S    S-     0   0  100  893   82     G          G         R          Nt                        g  T   RR
    56  104 L Q  S    S-     0   0  175  693   73     V          I         N          Ee                        .  N   NN
    57  105 L N  S    S+     0   0  154  838   66     N          N         N          t.                        t  G   NX
    58  106 L S  S    S-     0   0   58  853   65     R          S         R          gt                        S  S   RR
    59  107 L V  E     -U   54   0I   7  890   79     Y          F         Y          VH                        H  Y   YY
    60  108 L V  E     -U   53   0I  45  891   88     T          T         V          ES                        E  Y   VV
    61  109 L e  E     +U   52   0I   5  893    1     C          C         C          CC                        C  C   CC
    62  110 L S  E     -U   51   0I  24  893   75     S          L         E          SD                        S  T   EE
    63  111 L f        -     0   0   23  893    0     C          C         C          CC                        C  C   CC
    64  112 L A    >   -     0   0    8  893   75     P          P         A          AA                        A  K   AA
    65  113 L R  T 3  S+     0   0  149  893   80     A          R         R          DP                        Q  D   RR
    66  114 L G  T 3  S+     0   0   24  893    8     G          G         G          GG                        G  G   GG
    67  115 L Y  E <   -V   78   0J  20  893   11     F          Y         Y          YY                        W  Y   YY
    68  116 L T  E     -V   77   0J  72  891   85     S          K         G          QT                        K  T   GG
    69  117 L L  E     -V   76   0J  67  888   64     G          G         G          LL                        I  M   GG
    70  118 L A    >   -     0   0   23  889   78     R          P         L          DH                        S  D   HL
    71  119 L D  T 3  S+     0   0  175  889   77     A          L         N          ES                        g  D   NN
    72  120 L N  T 3  S-     0   0   92  694   44     C          C         C          DD                        d  N   CC
    73  121 L G  S <  S+     0   0   16  713   66     E          E         Q          RN                        K  R   QQ
    74  122 L K  S    S+     0   0   71  687   76                                     HS                        T  K     
    75  123 L A        -     0   0   22  685   66                                     SS                        K  N     
    76  124 L f  E     -V   69   0J  12  847    9                                     CC                        C  C     
    77  125 L I  E     -V   68   0J  78  846   80                                     SV                        V  S     
    78  126 L P  E     -V   67   0J  62  850   71                                     PP                        P  D     
    79  127 L T  S    S+     0   0  103  652   80                                     AT                        T  I     
    80  128 L G  S    S-     0   0   32  788   69                                     GA                        G  D     
    81  129 L P  S    S+     0   0  116  601   75                                     .D                        R  .     
    82  130 L Y  S    S+     0   0   59  794   86                                     .F                        F  .     
    83  131 L P    >   -     0   0   17  799   62                                     .S                        S  E     
    84  132 L g  T 3  S+     0   0   16  800    5                                     .C                        C  C     
    85  133 L G  T 3  S+     0   0    0  712   37                                     TG                        G        
    86  134 L K    <   -     0   0   69  588   68                                     NR                        R        
    87  135 L Q        -     0   0   37  477   65                                     T                         V        
    88  136 L T        +     0   0    4  428   78                                     P                         S        
    89  137 L L        +     0   0  105  372   61                                     L                                  
    90  138 L E              0   0  104  274   69                                     T                                  
    91  139 L R              0   0  231  199   47                                     K                                  
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2  III IIIIIIIIII IIIIIIIII IIIIIILII   IIIIIIIIIIIIIIIIIIIIIIII II III  
    94   17 C V  B     -A  271   0A   7  590    9  VVV VVVVVVVVVV VVVVVVVVV VVVIVIVVT   VVVVVVVVVAVVVVVVVVVVVVVV VV IVV  
    95   18 C G  S    S+     0   0   25  591    6  GGG GGGGGGGGGG GGGGGGGGG GGGGGGGGG   GDGGGGGGGGGGGGGGGGGGGGGG GG GGG  
    96   19 C G  S    S-     0   0   26  592    0  GGG GGGGGGGGGG GGGGGGGGG GGGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGG GG GGG  
    97   20 C Q  E     -B  237   0B  98  593   95  YHY ATYHYQEYYM YYEYYKFYY YETREQTYE   YTYYYYYFYMYYSYYYYYYTYQYY VY YYY  
    98   21 C E  E     -B  236   0B  80  594   67  TPP AATNEDVEED EEPEEDETT EPEKEEATPD  EPTETTTTTDTTSTTTTTTDTPTE AT ETE  
    99   22 C h        -     0   0    8  594   58  CVV AACATAICCS CCACCTCCC CVTAIVACAA  CTCCCCCCCACCACCCCCCACACC SC CCC  
   100   23 C K    >   -     0   0  123  593   78  ALP NKADSDSTQT ETSTTTTQE TTDTSVASDQ  TTETTEETQEQQAQREQQQSKAQP SQ AQR  
   101   24 C D  T 3  S+     0   0   60  594   85  EII PQELIIAAAK AKPKKIKKE PNITIPPRLE  PIEPKEEKQEKKPEKEAAEIEEEV PR KEK  
   102   25 C G  T 3  S+     0   0    0  595   74  NSS GNNGERYHHG HHGHHQNNN HNSLNYGNNG  HTNHNNNNNGNNGNNNNNNENRNS GN NNN  
   103   26 C E  S <  S+     0   0   36  595   66  SEE DSSEDSYSSA SSSSSEGAS SQKEKSESDE  SKSSSSGASEASDSSSSSSHSKSS SS SSS  
   104   27 C h    >   +     0   0    4  595   92  VVV WWVWHYLQQY QQWQQHIIV QFVFVIFVFW  QHIQLVVVLWIVWVIVVVVWVWVK WV VVV  
   105   28 C P  T 3   +     0   0    0  599    9  PPP PPPPPPPPPP PAPSSPQPP APPPPKPPPP  PPPPPPPPPPPPPPPPPPPPPPPP PP PPP  
   106   29 C W  T 3  S+     0   0    5  600   26  YWW WWYWYHYHHW WHWHYYYYY HWYYYYFYWW  HYYWYYYYYWYYWYYYYYYWYWYF WY YYY  
   107   30 C Q  E <   -J  122   0C   7  601   26  QQq QQQIQQqQQq QQQQQqQQQ QQqQQQQQqQ  QQQQQQQQQQQQQQQQQQQQQQQQ QQ MQQ  
   108   31 C A  E     -JK 121 146C   1  593   49  VAl AAVAVInVVt AVVVVsVVV VVlVAVAVsA  VVVVVVVVVAVVVVVVVVVVAVVV VV VVV  
   109   32 C L  E     -JK 120 145C   3  598   68  SAY QQSASSSSSD SSSSSISSS SALEYSASIS  SSSLSSSSSSSSSSSSSSSSSSSS SS SSS  
   110   33 C L  E     -JK 119 144C   0  601    9  LLL LLLLLMALLL LLLLLLLLL LLLLLLLLLL  LILFLLLLLLLLLLLLLLLLLLLL LL LLL  
   111   34 C I  E     -JK 117 143C   0  601   81  NMG RRNFQRRNNR NNQNNYNNN NLKELQNNYQ  NHNTNNNNNQNNHNNNNNNQNQNN HN NNN  
   112   35 C N  E >   - K   0 142C  30  601   88  AYK TTANRYSSSK ISLSANSSV SYSMlVLSNQ  IYSFSSAASQSSVAASSSSQSISA DA ISA  
   113   36 C E  T 3  S+     0   0   63  117   78  ... TT........ ......... ....k.....  ........................ .. ...  
   114   37 C E  T 3  S-     0   0  136  242   77  ... TS.SNR.... ..R..D... ...TDD...N  ...N.....N..Q......G.K.. .. ...  
   115   38 C N  S <  S+     0   0   84  565   53  GS. GGGGGGAGG. GGGGGEGGG GE.YNRNGRS  GKGGGGGGGSGGGGGGGGGGGGGG FG GGG  
   116   39 C E        -     0   0  100  589   94  YE. FFYRANYYY. YYGYYYYYY YDYMEKGYRV  YDYRYYYYYVYYVKYYYYYQYSYY GY YYY  
   117   40 C G  E     +J  111   0C  14  600   57  HK. PHHQHHAHHG HHHHHHHHH HSYHYHGHHH  HKHNHHHHHHHHHHHHHHHHHHHH RH HHH  
   118   41 C F  E     +     0   0C  28  611   33  Fyf YYFFFRhFFF FFTFFSFFF FlFMfFLFLR  FlFWFFFFFRFFVLFFFFFTFFFF fF FFF  
   119   42 C i  E     -J  110   0C   0  612    1  Ccc CCCCCCcCCC CCCCCCCCC CcCCcCCCCC  CcCCCCCCCCCCCCCCCCCCCCCC cC CCC  
   120   43 C G  E     -J  109   0C   1  612    1  RGG GGGGGGGGGG GGGGGGGGG GGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGG GG GGG  
   121   44 C G  E     -J  108   0C   0  612    9  GAA GSGGGGGGGG AGGGGGGGG GGGGGGGGGA  GGGGGGGGGAGGGGGGGGGGGGGG GG GGG  
   122   45 C T  E     -JL 107 130C   0  612   45  SVV SSSSSSASSS SSSSSSSSS SSVSSTTSST  SSSSSASSSTSSSSASSSSTSSSS SS SSS  
   123   46 C I  E     + L   0 129C   0  612   23  LII LLLLIILLLL LLLLLLLLL LIIIILLLIL  LILLLLLLLLLLILLLLLLLLLLL LL LLL  
   124   47 C L        -     0   0    6  612   27  IYY IIIIYILVVL IVIVVIIII VIIIIIIILI  VIIIIIIIIIIIIIIIIIIVIIII II III  
   125   48 C S  S    S-     0   0   22  612   56  NSS HHNDSADNSN NSSSSSSNS SSSSSQSNSS  NNNSDSNNNSNNTNNSNNNSNSSN TQ SNS  
   126   49 C E  S    S+     0   0   99  612   63  DDE SPDTDSEEED DKSKKENSD APENKPESQN  EEAPKEESSNSSPDDESSDPDNDE DD SQS  
   127   50 C F  S    S+     0   0   42  612   83  QKK NQQTDNRNSQ QDRDDKLQQ NDKNRQSQWS  NRQRKQQQESQQEQQQQQQRQRQN QR TQT  
   128   51 C Y  E     - M   0 185C   7  612   34  WII WWWHIITWWW WWWWWWWWW WWFFHWIWWW  WWWWWWWWWWWWWWWWWWWWWWWW WW WWW  
   129   52 C I  E     -LM 123 184C   0  612   14  VII VIVIVIVVVV IVVVVVVVV VVIIIVIVIL  VIVIVVVVVLVVIVVVVVVVVVVV VV AVV  
   130   53 C L  E     +LM 122 183C   0  612   27  VII LLVLVVLVVL IVVVVLVVV VLLLLLLVLV  VLVIVVVVVVVVVVVVVVVVVLVV LL VVV  
   131   54 C T  E     - M   0 182C   0  612   43  STT TTSTTSTSST SSSSSTSSS STSTTTTSTT  STSSSSSSSTSSTSSSSSSTSTSS TS SSS  
   132   55 C A    >>  -     0   0    0  613    2  AAA AAAAAAAAAA AAAAAAAAA AAGAAAAAAA  AAAAAAAAAAAAAAAAAAAAAAAA AA AAA  
   133   56 C A  G >4 S+     0   0    0  613    9  AAA ATAAAAAAAA AAAAAGAAA AAAAAAAAAA  AAAAAGAAAAAAAAAAAAAAAAAA AA AAA  
   134   57 C H  G >4 S+     0   0    7  613    0  HHH HHHHHHHHHH HHHHHHHHH HHHHHHHHHH  HHHHHHHHHHHHHHHHHHHHHHHH HH HHH  
   135   58 C i  G X4 S+     0   0    0  613    1  CCC CCCCCCCCCC CCCCCCCCC CCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC CC CCC  
   136   59 C L  G << S+     0   0   31  613   66  YVV IVYVLVVYYF WYFYYIYYY YIIVIWLYFF  YVYYYYYYYFYYVYYYYYYFYIYY VY YYY  
   137   60 C Y  G <  S+     0   0  109  613   87  QED SEQAQNYKTK IKAKKDKKM KFVKERSKII  KYKQKKKKMIKKEMKKKKKSKLKM EK QKK  
   138   61 C Q  S <  S+     0   0   95  613   78  Yrn sqYhstnSSr NSdSSSSSY SAlsGPgSnk  SgSPSPSSSkSSePSSSSTgYGSS DS SSS  
   139   61AC A        -     0   0   16  373   75  .dd pa.vave..v P.a...... .NeaIAa.es  .l.P.....p..g......l.H.P P. ...  
   140   62 C K  S    S-     0   0  172  387   77  .TT AS.AEAE..E F.G..F... .VQTSSN.SV  .S.K.....K..E......S.L.S A. ...  
   141   63 C R  S    S-     0   0  162  602   78  HLL ESHRQDNRRE ARDRRKRRR RVNVKVTRAS  RVRTQRRRRQRRARRRQQRRRNRR GR SRR  
   142   64 C F  E     -K  112   0C  36  609   54  IYY VIIVLLFVVV QIWIIFVII VFLFVILILF  IFILIIIIIWIIVIIIIIIWIYIV II IIV  
   143   65 C K  E     -K  111   0C  67  609   79  QSS VVQTKTLQEE IEKEEYQQQ ETFRTQSQEG  EKQVQQQQQNQQNQQQQQQRQVQV TQ QQQ  
   144   66 C V  E     -KN 110 161C   0  609   16  VVV VIVVVIVVVL AVAVVIVVV VVVLVVLVIL  VVVAVVVVVVVVIVVVVVVVVVVV VV LVV  
   145   67 C R  E     -KN 109 160C  40  609   55  RRK RRRRRIVRRR IRVRRRRRR RRRRRVRRML  RRRLRRRRRSRRRRRRRRRMRKRR YR RRR  
   146   68 C V  E     +KN 108 159C   1  610   43  LVV LLLLVAALLL LLVLLVLLL LAVVILGLHL  MVLLLLLLLFLLVLLLLLVSLLLI LL LLL  
   147   69 C G  S    S+     0   0    9  610   15  GGG GGGGGGGGGG GGGGGGGGG GGGGGSGGGS  GGGGGGGGGGGGFGGGGGGGGGGG GG GGG  
   148   70 C D        +     0   0   11  611   58  ESS AAEDSTTEEK DENEESEKV ESSASEAEED  ESEEEEEEEPKEAEEEEEEQEDEE RE EEE  
   149   71 C R  S    S+     0   0   24  611   73  YVV HHYYTTEHHY HHHHHSHHY HNNDSHNYRP  HTYHHHHHHLHHHHHHHHHTYTHH HH HHH  
   150   72 C N  B >   -P  234   0D  18  611   65  NWW SKNNYQLDDD HHEHHLNNN NSYSNNANIQ  HYNDNNNNDLNNMNNNNNNFNNNN SN NNN  
   151   73 C T  T 3  S+     0   0   56  611   80  IKK RRIIWTRIIQ IILIIEIII IYTTSLVIIT  IYILIIIIISIISIIIIIIMILII QI III  
   152   74 C E  T 3  S-     0   0  119  611   84  DDT LTDRRIAYYM WRNRRGDAD KQTSNATAGQ  GDEKNEEAEDAAVKEEKKNSDQEF AM AEA  
   153   75 C Q  S <  S-     0   0  130  610   85  VLL GSVISWGRRE QVAVEEVVV VKTKKVRVIR  VKVKEVVVVPVVLVVVVVVAVHVS GE VVV  
   154   76 C E        +     0   0  165  610   85  LGG sNLNGPMNSE HNwNNGTSM TNGGGERSKS  TGVKILNNLQSSEEVLTTLLLDLS SL NIN  
   155   77 C E        -     0   0   93  469   27  E.. tIET.EDEEE EEsEE.EEE E...GE.E..  E.EEEEEEE.EEEEEEEEEGEAEE NE EEE  
   156   78 C G  S    S+     0   0   46  578   34  GGG TGGEGGGGGP GGGGGGGGG GGGGTG.G..  GGGGEGGGG.GGNGGGGGGGGPGG PG GGG  
   157   79 C G  S    S+     0   0   47  585   75  GQQ DTGtSQGTTQ TTsTTATGN NQSVVF.GN.  NINTTTNTT.GGsNNNSSNSNKNT GG TNT  
   158   80 C E        -     0   0   37  472   30  E.. MEEh...EEQ EEeEE.EEE E....E.EL.  E.EEEEEEE.EEiEEEEEE.EVEE QE EEE  
   159   81 C A  E     -N  146   0C  27  487   57  Q.. QQQI..VQQF QQQQQ.QQQ Q....Q.QK.  QLQQQQQQQTQQNQQQQQQ.QVQQ EQ QQQ  
   160   82 C V  E     -N  145   0C  71  590   83  FHH DDFEVEVFFV YYTFFVFFF FTLI.V.FR.  FIFHFFFFFQFFAFFFFFF.FTFF SF FFF  
   161   83 C H  E     -N  144   0C  14  599   76  IAA IIIKHLSIIS MIRIIHIII IRVYYC.IM.  IKIIIIIIIRIIYIIIIIV.IVII RV III  
   162   84 C E        -     0   0   90  602   78  DRR KKDKSARDDK SSNSSRDNN SKKNTT.NK.  SDNQNNDEDSNNRNNNSSTYSPNQ RD SNN  
   163   85 C V  E     -O  186   0C  27  607   64  AVV VVAVVVVSSI VSISSASSS SAVVAVVAVI  SIAVSAASSISSVSAASSAVTVAA VS SSS  
   164   86 C E  E    S+     0   0C  70  608   73  SAA SSSKRRESSA DSKSSLSAA SKKEKARADK  LVAESAEQAKAAGAAASSEDAQAQ QE SAA  
   165   87 C V  E     -O  185   0C  13  609   72  KVV AKKRAERRRD ASRSMKKKK RRNKSKKKKD  SSKALKKKSDKKKKKKKKKRKDKK QK RKK  
   166   88 C V  E     -O  184   0C  72  610   46  III IVIVFILVVI IVIVVQVVV VVSVKVFILI  VIIAVIIVVIVVVVIIVVIITIIA AV VVV  
   167   89 C I  E     +O  183   0C  27  610   43  IRR IIIVRIVIIH YIIIIYIII IITIVFVIII  IIIYIIIIIIIIIIIIIIIIIVII VI III  
   168   90 C K  E     -O  182   0C  68  610   82  RKK TLRRNIPRRF WRVRRRRRR RICCASVRII  TCRKRRRKRIRRSRRRRRRMRITR CR RRR  
   169   91 C H    >   -     0   0   19  611   13  HHH HHHHHHHHHH HHHHHHHHH HNHHHHHHHH  HHHHHHHHHNHHHHHHHHHNHHHH HH HHH  
   170   92 C N  T 3  S+     0   0  156  611   61  PEE SPPREEEPPP QPQPPEPPP PKDEPVGPPE  PKPFPPPPPEPPPPPPPPPGPQPP SP QPP  
   171   93 C R  T 3  S+     0   0  150  608   73  KDD NSKGGKLNNN SNQSTKSSR NRDKKASRYN  YKKGNDKSNNSSNRKKSSGDQEGR SQ SNR  
   172   94 C F    <   -     0   0   24  611    5  YYY YYYFYYYYYF YYYYYFYYY YFFYYYYYFY  YYYYYYYYYYYYYFYYYYFYYYYY YY YYY  
   173   95 C T     >  -     0   0   56  611   68  Svl ngSDNKNNNN NSnSSDNNS TNNrNNNNDH  DRNKDDSNNHNNDNNNSNSnDsNS NN NSN  
   174   96 C K  T  4 S+     0   0  145  561   78  Sta rpSAP.ASSG Y.g..ASSS SIFeSPSASY  RPSDSRSS.YSSSSASSSSrStSS FS SSS  
   175   97 C E  T  4 S+     0   0  174  569   91  WII TVWRRSSWWQ Q.V..KYNW YKDVKKKNWP  YLWEWKWR.PNNKMRRSARSKTAY LW YRR  
   176   98 C T  T  4 S-     0   0   44  598   57  TLL MTTTTLINDT TSRSSTTNT NTTPTTTTFA  STTAVTTNSANTTTTTTTTDTATN TL TTN  
   177   99 C Y    ><  +     0   0   60  604   65  LFF YLLLMYTILF MYHYYVLFL IMYKKFNILH  LYLYLLLLFHFIKAILLVLYLFML FL LLL  
   178  100 C D  T 3   +     0   0   25  609   37  DNN NADYIqDDDD DnDnnDDNN NDDdNNDDND  TDDDDNDDnDNDNEDDNDDDDgDD DD DDD  
   179  101 C F  T 3  S+     0   0   21  595   66  N.. .HNNNyNNNN HnYnnYNNN NCYfNNNNHN  NYNHNNNNnNNNNNNNNNN.NnNN NN NNN  
   180  102 C D    <   +     0   0    1  609    0  DDD DDDDDDDDDD DDDDDDDDD DDDDDDDDDD  DDDDDDDDDDDDDDDDDDD.DDDD DD DDD  
   181  103 C I        +     0   0    0  611   13  III IIIVVAIIII IIIIIYIII IIIIFIIIII  IVIIIIIIIIIIIIIIIIIIIIII II III  
   182  104 C A  E     -MO 131 168C   0  611   60  LAA AALAAAAMMA MMAMMGMMM MACAAMAMAA  MALMMLMMMAMMAMMLMMMALAMM CM MMM  
   183  105 C V  E     -MO 130 167C   0  612   16  LVV LLLIVVLLLL LLLLLLLLL LLLLIILLLV  LLLLMLLLLVLLLLLLLLLLLLLL LL LLL  
   184  106 C L  E     -MO 129 166C   0  613   30  IIM LLILILIIIV MIMIIIIII IILVVILILV  IIIVIIIIIVIIMIIIIIIMIVII LI III  
   185  107 C R  E     -MO 128 165C  40  613   43  KRR KKKTRVFKKQ KKEKKEKKK KREKTKAKLH  KKKKKKKKKHKKKKKKKKKRKLKK QK KKK  
   186  108 C L  E     - O   0 163C   0  613   16  LLL LLLLMLVLLL LLLLLLLLL LLLTVLLLLL  LLLLLLLLLLLLLLLLLLLLLLLL LL LLL  
   187  109 C K  S    S+     0   0  101  613   69  SVV AESDSDTSSM ASSSSDSSS SRETNTSSKS  SSAASSKSESSSQSKSKKASSSSS SK SAS  
   188  110 C T  S    S-     0   0   82  614   74  TDD TKTSSGPKKD HKSKKTRSS ESEEKASSSS  KTSKTSTTTSSSTSSSSSSSSFSR AD QSK  
   189  111 C P        -     0   0   48  614   39  PSS pSPPPDPPPR PPAPPPAPP PPPPDPPPPP  PPPPPPPTPPPPPPPRAAPPSPKP PR PPP  
   190  112 C I        -     0   0    4  562   63  ALL sAAVIFFAAA VAVAAVAAA AFLIMA.A.V  ALAAAAAAAVAALAAAAA.IAVAV LA AAA  
   191  113 C T        -     0   0   95  566   73  VII KTVTSEPTTS TTVTTQSTV TTKKAQ.T.L  TTVQAVLRELTTTVTVSS.GVNKE NE TAS  
   192  114 C F        +     0   0   56  612   34  IFF VVIFYFLLLF LLLLLLLLL LLFFIIILFY  LFIYLILLLYLLFIIILLVVIYIM FL LIL  
   193  115 C R  B >   -Q  196   0E  52  613   63  NNN GNNSRNdNNT NNSNNSNNN NNNTDNKNkT  NGNNNNSSSTNNnNSNNNAGNSNN TS NNN  
   194  116 C M  T 3  S+     0   0   29  594   77  AAA .NAKSErSSD KQTQQESSK QTDDGA.SaS  QEAQSASSSSSSdSSASS.ASTSQ AT SAS  
   195  117 C N  T 3  S+     0   0   13  602   90  RDD .NRMSSKYYY FYRYYNYRR YNNNKYNRNN  YYRYRRRNRNRRKWRRKKQSQHRR SR YRY  
   196  118 C V  B <   +Q  193   0E   0  604   27  VVV .VVIVVIVVI VVVVVVVVV VVIITVVVII  VIVVVVVIVIVVVVVVVVVQVIVV II VVV  
   197  119 C A        -     0   0    1  606   80  SRR .HSRRHAQRL QQKQQKQSA QQQKTQASIR  QKSQASTQARSSKSSSAAAKSQSR FA KAR  
   198  120 C P        -     0   0    8  608   54  TPP FTTPAPTPPP PPPPPLTAT PPPPKPFAPR  PPSPSTASTKAAPTTTAATPPPTP PP TTT  
   199  121 C A        -     0   0    2  609   39  LII VVLVIIIVVV IVVVVVIVV VIVIIAVIIA  VIIIVIIVVAVVVIIIVVVVVVII VI VVV  
   200  122 C g  B     -c  290   0B   1  610   66  APP CCACREEAAC AACAAKASS ASEEILKACC  ALSPSSSPSCSSCASSSSACACAS CA SSS  
   201  123 C L        -     0   0   27  612    5  LLL LLLLILVLLL LLLLLLLLL LVLLTLLLLL  LLLVLLLLLLLLLLLLLLLLLLLL LL LLL  
   202  124 C P        -     0   0    7  613   30  PAA PPPPAAGPPG PPPPPAPPP PAAVLPPPSP  PAPAPPPPPPPPPPPPPPPPPPPP AG PPP  
   203  124AC E     >  -     0   0   92  612   75  SDD EFSTDKPTTD KTETTESTS TKESATSKEE  SLRRSTKSSETTNTATSSVPSTKR AK STS  
   204  125 C R  H  > S+     0   0  109  612   78  ASS TNAGSEESGS AEAEEPSSA SFEKKAASVA  SPASSASADASSPSTASSSKGKSS AG GSS  
   205  126 C D  H  > S+     0   0  124  612   85  CAA EGCSNRLCCV CCGCCGCCC CTEEEDSCTT  CLSCCPCCCTCCGCCSCCCACSCC DC CCC  
   206  127 C W  H  >>S+     0   0    4  612   88  APP APAAPPPAAL PAQAAVAAA ARPPGTAPDY  AMAPVPAAAYAALAAPAAAFALAA SA AAA  
   207  128 C A  I  X>S+     0   0    0  612   75  SAA SASKREPPSL KAEAAESAA PKKSSPSAIT  PNPTEAPSPTATMPDASSPGSKAP TA GPS  
   208  129 C E  I  <5S+     0   0   75  613   82  AAA PPAYNHVAAE ADVDDLSAA ALGESETAQF  AIADAAAAAFAGLAVTAAALALAA FT AAS  
   209  130 C S  I  <5S+     0   0   70  614   66  GGG SSGDGGGGGr GGPGGEGGG GPGGVLYGKP  GTGGGGGGGPGTEGGGGGGLGRGG HG GGG  
   210  131 C T  I  <5S+     0   0   18  108   73  ... ......T..f ......... ..........  ........................ .. ...  
   211  131AC L  I ><  S-     0   0  119  503   80  sGG sASR.sT..e T.....aSS ..sMS.S.Vk  .Ssgss.ssk.S.sSsss..s.s. .s tsS  
   227  146 C E  T 3  S+     0   0   47  527   75  SII SSSE.EE..S D.G...STS ..EREYS.PS  .TSYSS.SSS.T.SVSSS.ESNSF .D SSS  
   228  147 C K  T 3  S+     0   0  169  548   68  GLL GGGSGGD..A S.S..SGRG .SNSGNGGTD  .NGNGGGGGDRR.GGGGG.NGDGI .G GGG  
   229  149 C G  S <  S-     0   0   29  559   66  VWW GGVGGGG..N V.G..RSES .TGGGFGQQG  .GSTTAYTSGEE.ISATTLGVGVD .V SVS  
   230  150 C R        -     0   0  213  584   86  NLL SDNPSVF..T FAADDRNKN ATQMSYRNST  AANRDDDNNTKK.NNDNNSKNSNG .N NNN  
   231  151 C Q  B     -R  224   0F  79  599   93  YQQ PTYQIIGSSL NDIDDSYYY DPNLSLIYMS  DSYYYYYYYSYY.YYYNNFVYLYM .Y YYY  
   232  152 C S        -     0   0   14  607   51  PPP PPPPPSSGGP PGSGGSPPP RSPASSSPTP  GSPPPPPPPPPPSPPPPPGSPSPP DP PPP  
   233  153 C T  S    S+     0   0   48  608   73  DAL DDDADNTDDR FDDDDASDE NNENTPQDEN  NEDDSDDDDNDDDDEDDDDSETDA DD DDD  
   234  154 C R  B    S-P  150   0D 102  608   85  LSS ILLVHIQQQF NKTKKARVL KDHHTITVEI  RVLQLELLLIVVMLLELLLSLRLD IL RLR  
   235  155 C L        -     0   0    3  610    3  LLL LLLLLLLLLL LLLLLLLLL LLLLLLLLLL  LLLLLLLLLLLLLLLLLLLLLLLL LL LLL  
   236  156 C K  E     -BD  98 221B  31  610   51  QLL QQQQLQRQQQ QQQQQQMQQ QMQMRRLQHQ  QRQQQQQQQQQQNQQQQQQQQHQQ QQ MQR  
   237  157 C M  E     -BD  97 220B  18  611   94  CKK EQCEAQQCCE CCQCCICCC CFSAAAKCKK  CTCCCCCCCKCCACCCCCCECECC EC CCC  
   238  158 C L  E     - D   0 219B   4  612   44  LTT AALVVVVLLI VLALLVLLL LVVVVVALVG  VVLLLLLLLGLLALLLLLLALALL VL LLL  
   239  159 C E  E     - D   0 218B 107  612   72  ESS SSETREQNER DSKNNTWQD NTLEHDTKNL  ATEEDENNDLQQMDDDNKDTDEKD AD NHD  
   240  160 C V  E     - D   0 217B   0  612   46  AVV VVAILVVIIL VLVLLVAAA IIILVVVAIV  VIAVAAAAAVAAVAAAAAAVAVAI VV AAA  
   241  161 C P  E     - D   0 216B  34  612   28  PKK PPPPRNPPPP PPPPPPPPP PSPPQETPDK  PSPPPPPPPKPPPPPPPPPRPNPP QP PPP  
   242  162 C Y  E     -F  263   0B  36  613   46  LII VILIILLIII IITIIYIIL IPVVAIVILI  IVLIVVIIIIIILLVVIILLLIVI VI ILI  
   243  163 C V  E     -F  262   0B  24  614   37  LLL VVLWVVVLLV VLVLLVLLL LVTVHFLLVI  LTLVLLLLLILLILLLLLLILVLL VL LLL  
   244  164 C D     >  -     0   0   88  613   57  SDD SSSTDEDSSD SSASSSSPS SINGSSESKD  SDSSSSSTDDPSEASSSSPDSGST GS SSS  
   245  165 C R  H  > S+     0   0   51  613   78  HPP RRHNRNRTTH KHLHHEDDQ KRKLDSNDWN  YQQDEQDADNDDPQDQDDQWQLDD ND DQD  
   246  166 C N  H  > S+     0   0  105  614   74  ANN ASAREAERRK EASAAESSA ESTKDCASEK  EEASFAASAKSSGESASSAAAETR NE TAS  
   247  167 C S  H  > S+     0   0   48  614   78  DVV RRDEEQVDDT DDTDDVTSQ DEDKEQAVIT  DKESDEQEQTSSQQVKTTDKDSAK QD DQS  
   248  168 C j  H  X S+     0   0    1  614    2  CCC CCCCCCCCCC CCCCCCCCC CCCCCLCCCC  CCCCCCCCCCCCCCCCCCCCCCCC CC CCC  
   249  169 C K  H >< S+     0   0   88  614   73  EKK eDEkaKqEEQ DAsDEkKRE DqfQKYNRSn  DrEKRERSHnRRnERERREsEnRD RR RER  
   250  170 C L  H 3< S+     0   0  150  574   89  A.. yKAnySaNNK INqNNsGNA Niy.K.KN.e  NyAANASNNeNSyAKASSAsAhNN .N NAS  
   251  171 C S  H 3< S+     0   0   23  604   76  SRR TASASSYSAA NSMSSHAAS AYEKY.KAQV  SASSASSSAVAAVSASSSSVSMAS CA SAS  
   252  172 C S    <<  -     0   0   20  607   83  YSS DYYAYYNYYT YYRYYSYYY YGIKFYYYLY  YRYYYYYYYYYYYYYYYYYYYLYY SY YYY  
   253  173 C S  S    S+     0   0   79  607   83  PYY PPPPGSWPPP PPPPPDPPP PKILRYGPMS  PNPPAPPPPGPPNPPPPPPGPTPP YP PPP  
   254  174 C F  S    S-     0   0  124  607   79  GQQ NGGGRIRGGY GGAGGRGGG GSSK.YGGPG  GRGRGGGGGGGGNGGGNNGSGDGG QG GGG  
   255  175 C I        -     0   0  100  608   87  EYY QKEGQMPMMP QMTMMLQQQ MIPGSRKQMV  MLEMQKQEQVQQLQQEQQRAEPKM EQ EQQ  
   256  176 C I        -     0   0   13  609   18  III IIIIILIIIV IIIIIIIII IIIVLVIILI  TVIIIIIIIIIIVIIIIIIVIVII LI III  
   257  177 C T    >   -     0   0   16  614   35  TTT HDTVKTTTTT STTTTSTTT TTTATNTSTT  DTTSTTTTTTTTTTTTTTTTTSTT TT TTT  
   258  178 C Q  T 3  S+     0   0  133  614   68  NKE DSNEDGEDDR DQAQPPSGD NKDNSDSSRP  NSKERSENNPGRPDNSSSSPEESS DD NNS  
   259  179 C N  T 3  S+     0   0   24  614   60  NTT SSNHTRGAAN TSRSSYNNS ANRDNNNNNG  TNNNNNNNNGNNTDNNNNKRNGNN NN NNN  
   260  180 C M  E <   - G   0 311B   2  614   13  MMM MMMFMMMMMM MMMMMMMMM MMMMMMMMMM  MMMMMMMMMMMMMMMMMMMMMGMM MM MMM  
   261  181 C F  E     - G   0 310B   8  613   35  III LLILILLFFF LFLFFFFIV FLIIFIIMML  FIVFMFMFMLIIVVMLFFVLVLVF MI FVF  
   262  182 C j  E     +FG 243 309B   1  614    1  CCC CCCCCCCCCC CCCCCCCCC CCCCCCCCCC  CCCCCCCCCCCCCCCGCCCCCCCC CC CCC  
   263  183 C A  E     +FG 242 308B   0  614   26  AAA AAAAAAAAAA AAAAAAALA AAAAAAALAA  AAAALVAALALLAALVLLAAAALA AI AAA  
   264  184 C G  S    S-     0   0    3  614   10  GAA GGGGYGAGGG GGGGGGGGG GAGGGGAGGG  GGGGGGGGGGGGGGGGGGGGGYGG GG GGG  
   265  185 C Y        -     0   0   56  591   57  FAA LLFQAVAYYY YYYYYKFYF YDLFPSAYNF  YDFFFFFFFFYYYFFFFFFLFGFY VS FFF  
   266  185AC D  S    S-     0   0   81  594   83  LLL DDLAEDSLLS PLNLLMMLL LPEEPRPMIL  LNLLLLLLLLLLLLLLLLLLLGLL AL LLL  
   267  185BC T  S    S+     0   0   76  614   61  ELG NKEGHGGEEq EEEEESEQE EKGKEFGEQE  EKEEEEEAEEQQREEKEEEQEEEE EA EEE  
   268  186 C K  S    S-     0   0  107  563   32  G.. GGG..GGGGi GGGGGGGGG G..GGG.GEG  G.GGGGGGGGGGGGGGGGGGG.GG GG GGG  
   269  187 C Q  S    S+     0   0  102  569   37  G.. GGG..GGGGI GGGGGGGGG G..NGG.GGS  G.GEGGGGGSGGSGGGGGGGG.GG GG GGG  
   270  188 C E        +     0   0   33  613   55  KKR VIKRKKKKKG KKIKKEKKK KKKKKKKKKV  KGKKKKKKKVKKVKKKKKKVKKKK KQ KKK  
   271  189 C D  B     -A   94   0A   7  614    4  DDD DDDDDDDDDD DDDDDGDDD DDDDDDDDDD  DDDGDDDDDDDDDDDDDDDDDDDD DD DDD  
   272  190 C A        -     0   0    7  614   42  SSA TASSAAASSA SSASSPSSS SASASSTSAA  STSSASSSSASSSSSSSSSASASS AS SSS  
   273  191 C k    >   -     0   0    7  614    3  CCC CCCCCCCCCC CCCCCCCCC CCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC CC CCC  
   274  192 C Q  T 3  S+     0   0   90  614   25  QHR QQQSQQQQQK QQQQQNQQQ QIQVQQQQQQ  QQQKQQQQQQQQQQQQQQQQQQQQ QQ QQQ  
   275  193 C G  T 3  S+     0   0    6  614    8  GGG GRGGGGGGGG GGGGGGGGG GGGGGGGGGG  GGGGGGGGGGGGGNGGGGGGGGGG GG GGG  
   276  194 C D    X   +     0   0    0  614    0  DDD DDDDDDDDDD DDDDDDDDD DDDDDDDDDD  DDDDDDDDDDDDDDDDDDDDDDDD DD DDD  
   277  195 C S  T 3  S+     0   0   14  614    1  SSS SSSSSSNSSS SSSSSSSSS SSSSSSSSSS  SSSSSSSSSSSSSSSSSSSSSSSS SS SSS  
   278  196 C G  T 3  S+     0   0    0  614    0  GGG GGGGGGGGGG GGGGGGGGG GGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGG GG GGG  
   279  197 C G    <   -     0   0    0  614    1  GGG GGGGGGGGGG GGGGGGGGG GGGGGGDGGG  GGGGGGGGGGGGGGGGGGGGGGGG GG GGG  
   280  198 C P  E     - H   0 294B   1  614    2  PPP PPPPPPPPPP PPPPPPPPP PPGPPPPPPP  PAPPPPPPPPPPPPPPPPPPPPPP PP PPP  
   281  199 C H  E     -EH 219 293B   0  614   49  VLL LLVLLLLVVF LVLVVVVVV VLLMALLVLL  VLVLVVVVVLVVLMVVVVVLVLVV LV VVV  
   282  200 C V  E     -EH 218 291B   3  614   26  AVV VVAMVIVVVV VVVVVVVVV VFVAVILVVV  VVVIVVVVVVVVVVVVVVVVVVVE VA VVV  
   283  201 C T  E     - H   0 290B   0  614   66  CSS CSCISYVCCV CCCCCSCCC CFVVKCVCCG  CGCCCSCCCGCCTCCCCCCHCCCC SC CCC  
   284  202 C R  E     + H   0 289B  99  614   70  NGG EKNNGNDNNQ NNENNNNNN NGDNGDGNQA  DYNNNNNNNANNLNNNNNNLNENN RN NNN  
   285  203 C F  E >  S- H   0 288B  22  614   71  GGG STGNDNNGGR GGLGGGNGG GNNNNGGGkd  GNGGGGGGGdGGKGGGGGGTGFGG gG GGG  
   286  204 C K  T 3  S-     0   0   85  222   71  ... GG.......K ..D...... ........qk  .........k..N......S.K.. a. ...  
   287  205 C D  T 3  S+     0   0  108  223   55  ... GE.G.....N ..G...... ........SG  .........G..S......S.D.. S. ...  
   288  206 C T  E <   - H   0 285B   3  233   75  ... KR.R.....R ..R...... ........IT  .........T..I......H.T.. V. ...  
   289  207 C Y  E     - H   0 284B  21  242   51  ... FF.W.....W ..Y...... ........WW  .G.......W..W......W.F.. W. ...  
   290  208 C F  E     -cH 200 283B   0  613   91  QQQ VYQTREKQQY EVVVVIQAE EEKKVYVEYF  ELQEEQEQEFAAWEQQAAQHEVQE IV QQE  
   291  209 C V  E     + H   0 282B   1  613   38  LLL LILQLLVLLI LLLLLQLLL LQLLQLQLQL  LQLLLLLLLLLLLLLLLLLLLQLL QL LLL  
   292  210 C T  E     +     0   0B   1  613   84  QVV HHQVVLVQQI QQIQQYQQQ QFVALEGQLA  QIQYQQQQQAQQIQQQQQQVQVQQ SQ QQQ  
   293  211 C G  E     -IH 312 281B   0  613    0  GGG GGGGGGGGGG GGGGGGGGG GGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGG GG GGG  
   294  212 C I  E     -IH 311 280B   0  613   19  III AAIIVIIVVI IVVVVIIVI VIIVVIIVII  VIIAIIVVIIVVDVIVIIIVIIIV II IIV  
   295  213 C V  E     +I  310   0B   7  613   14  VVV TTVVVVVVVV VVVVVVVVV VVIVVVTVVV  VVVVVVVVVVVVTVVVVVVVVVVV VV VVV  
   296  214 C S  E     -     0   0B   1  612    0  SSS SSSSSSSSSS SSSSSSSSS SSSASSSSSS  SSSSSSSSSSSSSSSSSSSSSSSS SS SSS  
   297  215 C W  E     -I  309   0B  45  613    7  WYY WWWWWWFWWW WWWWWWWWW WFTWFWFWWW  WWWWWWWWWWWWWWWWWWWWWWWW FW WWW  
   298  216 C G        -     0   0   26  613    0  GGG GGGGGGGGGG GGGGGSGGG GGGGGGGGGG  GgGgGGGGGGGGGGGGGGGGGGGG GG GGG  
   299  217 C E  S    S-     0   0   25  609   90  YII YYYIHTEYYV YYYYYFYAY YVFKVIYAVD  YqYrYYIYYDAASIYDYYYVYIYY DI YYY  
   300  218 C G  S    S-     0   0   19  612   13  GGG GGGGGGGGGG GGGGGGGGG GGGGGGGGGE  GEGYGGGGGEGGGGGGGGGGGGGG GG GGG  
   301  220 C k  S    S-     0   0    7  613    2  CCC CCCCCCCCCC CCCCCCCCC CCCCCCCCCC  CCCCCCCCCCCCCCCCCCCCCCCC CC CCC  
   302  221 C A  S    S+     0   0    4  612   16  AAA AAAGAAAAAG AAAAAAAAA AAGGAAAAGA  AAAIAAAAAAAAAAAAAAAAAGAA GA AAA  
   303  222 C R    >   -     0   0  105  611   73  QNN ARQKDRREER QEREELQQE ERVQRLDQEL  ESQSQQQQMLQQKQMQQQLRQRLE QL QLE  
   304  223 C K  T 3  S+     0   0  152  611   64  KPP KSKGVAARRK PRPRRPRKK KHKEKPSKKR  KVKKKKKRKPKKAKKKKKKKEIKR PP RKK  
   305  223AC G  T 3  S+     0   0   26  613   58  GFF GGGQKKQDDN NDNDDNNGD DGDGNYKGRN  NGNNGNNNGNGGNNGNNNDDNGGN GG NDD  
   306  224 C K    <   -     0   0   43  613   85  KFF KKKYYYYHHH YHTHHYQKS HYFVNYFKLK  HFRSRRYYKKKKRKKKKKSKLLRH VY RNH  
   307  225 C Y        -     0   0   33  613   50  PPP FFPPPPPPPY PPPPPPPPP PPPPPPPPPP  PPPPPPPPPPPPPPPPPPPPPPPP PP PPP  
   308  226 C G  E     -G  263   0B   4  611    2  GGG GGGGGGGGGG GGGGGSGGG GGGGGGGGGG  GGGGGGGGGGGGGGGGGGGGGGGG GG GGG  
   309  227 C I  E     -GI 262 297B   6  612   11  VVV VVVVVVVVVY VVIVVVVVV VVVVIVVVVV  VVVVVVVVVVVVVVVVVVVVVVVV VV VVV  
   310  228 C Y  E     -GI 261 295B   1  612    1  YYY YYYYYYYYYY YYYYYFYYY YYYYYYYYYY  YYYYYYYYYYYYYYYYYYYYYYYY YY YYY  
   311  229 C T  E     -GI 260 294B   2  612   39  TAA AATTAAAAAV TAAAAAATT ATTTATTTTT  STTATTTTTTTTGTTTTTTTTTTT TT TTS  
   312  230 C K  E >   - I   0 293B  21  612   42  KNN NHKRDAAKKK KKKKKKKKK RDSNKKRRKR  KRKKKKRKKRKKNRKKKKRNKDKK RR KRK  
   313  231 C V  G >  S+     0   0    1  611    8  VVV VVVVVVVVVV VVTVVVVVV VVIVVVVVVV  VVVVVVVVVVVVVVVVVVVVVVVV VV VVV  
   314  232 C T  G 3  S+     0   0    2  609   71  CAA KKCTAPPCCS CCSCCSCCC CRAASRSCST  CPSCCYCCCTCCTCCYCCCECSCC SC CCC  
   315  233 C A  G <  S+     0   0   29  609   79  NEV YNNHYEYIIN AVEVVANNN IRHHANNKNY  VANNNNKNNYNNMNNNNNNENFNN RN NNV  
   316  234 C F  S <> S+     0   0    7  605   35  YLL LLYFFLFFFY LLFLLIFYF FQ YAYYYYY  QIYYYYYYYYYYFFYYYYYMYYYY FY YYQ  
   317  235 C L  H  > S+     0   0   23  603   80  VKK LIVMHRQTTH LSSSSRTVV NI RANVVLR  TRVLVVVVIRVVTVVVVVVLVKVN QI NVT  
   318  236 C K  H  > S+     0   0  116  602   68  DPP TGDPREEDDD PGAGGDTSD DP KKRDSLD  EQDDSDDSSDSSDDRDSSDNNDQD TD SDE  
   319  237 C W  H  > S+     0   0   26  602    1  WWW WWWWWWWWWW WWWWWWWWW WW WWWWWWW  WWWWWWWWWWWWWWWWWWWWWWWW WW WWW  
   320  238 C I  H  X S+     0   0    1  599   12  III VVIIIIILLI IVIVVIIII LM IIIIIII  LVIIIIIIIIIIIIIIIIIIIIIL II IIL  
   321  239 C D  H  < S+     0   0   66  570   71  QLL KTQTELAKEK NRKLRKRRK EK DKDKQ    HTQKRREQQ RRYQQKRREHQVQI  N SQH  
   322  240 C R  H >< S+     0   0  136  556   71  ENN TSEKRAENTE EDDDDDNQQ RN TSWRQ    NEQNNDSNQ QQREDDQQNTDRQS  E NKS  
   323  241 C S  H >< S+     0   0    6  523   72  TAA QGTNTTQTTK ITKTT TTT TV HTITT    T TIITTTT TTQTTTTTTVTHTT  T TTT  
   324  242 C M  T 3< S+     0   0   25  479   41  III MMIL RRMMI LMIMM MII MF M ILI    M ITIIIII IIMMMIIIIVILII  M MIM  
   325  243 C K  T <  S+     0   0  153  444   70  AEK AAAK NAAA  TAHAA SAA AS K SAA    A AERAAAE AAKAAAAADEASAS  N AAA  
   326  244 C T    <         0   0   51  390   65  A   TKA  SASS  SNEST SAK TE E TNA    T ANTAAAN AA ASAAAATA AS  A NAS  
   327  245 C R              0   0  197  273   47  N   RNN  K           NNH    N E N      NNSNNN  NN NNNNNNKN NN  N NNN  
## ALIGNMENTS  841 -  910
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1   49 L Q              0   0  101  671   35  Q  Q            Q Q                                   Q         E     
     2   50 L a    >   +     0   0   22  858    0  C  C            C C                  CC               C   C     C     
     3   51 L E  T 3  S+     0   0  187  858   80  L  Q            A L                  LL               Q   T     A     
     4   52 L T  T 3  S-     0   0  105  864   61  S  S            E S                  SS               P   K   N S     
     5   53 L S    <   +     0   0   89  868   72  N  H            K N                  NN               G   N   N D     
     6   54 L P        +     0   0   10  878   31  P  M            P Q                  PP               P   P   P P     
     7   55 L b        -     0   0   18  893   21  C  C            C C                  CC               C   C   C C     
     8   56 L Q  S    S+     0   0   92  892   83  F  V            K V                  QQ               A   Q   D Q     
     9   57 L N  S    S-     0   0   63  893   51  N  H            N N                  NN               N   N   N N     
    10   58 L Q  S    S-     0   0  152  893   57  G  G            G G                  GG               G   G   G G     
    11   59 L G        -     0   0   16  893   40  T  D            A T                  GG               S   G   G A     
    12   60 L K  E     -S   23   0G 117  852   79  .  C            M .                  TT               T   T   S T     
    13   61 L a  E     -S   22   0G  45  882   10  C  V            C C                  CC               C   C   C C     
    14   62 L K  E     -S   21   0G 155  890   81  L  D            S V                  QQ               v   i   s N     
    15   63 L X  E     +S   20   0G 120  768   39  D  Q            D D                  HH               q   s   d D     
    16   64 L G        -     0   0   44  862   73  N  H            S L                  TT               G   G   G G     
    17   65 L L  S    S-     0   0  152  871   64  I  Q            V Y                  HH               N   P   S L     
    18   66 L G  S    S+     0   0   67  883   63  G  D            G Q                  TT               T   S   G N     
    19   67 L E        -     0   0  119  837   61  R  .            G S                  VV               .   V   D N     
    20   68 L Y  E     -S   15   0G  37  883   11  F  Y            Y Y                  YY               Y   Y   Y Y     
    21   69 L T  E     -S   14   0G  71  886   82  N  K            D A                  MM               I   T   N T     
    22   70 L b  E     -S   13   0G  20  889    0  C  C            C C                  CC               C   C   C C     
    23   71 L T  E     -S   12   0G  85  890   86  I  L            V R                  VV               L   T   A A     
    24   72 L c        -     0   0   44  890    0  C  C            C C                  CC               C   C   C C     
    25   73 L L    >   -     0   0   62  890   88  N  Y            K N                  PP               P   T   R I     
    26   74 L E  T 3  S+     0   0  177  890   75  Q  H            S H                  RR               P   P   P S     
    27   75 L G  T 3  S+     0   0   29  893   20  G  G            G G                  GG               K   G   G G     
    28   76 L F  E <   +T   36   0H  40  893    9  W  Y            F Y                  WW               F   V   F F     
    29   77 L E  E     +T   35   0H  74  893   73  E  E            T E                  EE               Q   T   T T     
    30   78 L G  S >  S-     0   0   32  889    5  G  G            G G                  GG               G   G   G G     
    31   79 L K  T 3  S+     0   0  156  891   73  R  R            V R                  RR               R   A   K T     
    32   80 L N  T 3  S-     0   0   33  892   62  L  Y            H Y                  VV               N   N   N N     
    33   81 L c  S <  S+     0   0    1  892    3  C  C            C C                  CC               C   C   C C     
    34   82 L E        +     0   0   87  891   44  Q  Q            E D                  SS               D   E   E E     
    35   83 L L  E    S-T   29   0H  96  889   88  Y  Y            K Q                  QQ               K   T   I .     
    36   84 L F  E     -T   28   0H 139  889   83  E  N            D r                  ag               e   V   G .     
    37   85 L T        -     0   0   44  677   75  a  v            E s                  sl               l   A   . .     
    38   86 L R        +     0   0   57  408   92  y  a            T a                  qK               f   .   . .     
    39   87 L K        +     0   0   96  535   81  T  S            L T                  CN               Y   .   . .     
    40   88 L L        -     0   0   91  608   90  D  N            C S                  SS               G   .   N .     
    41   89 L d  S  > S+     0   0   15  617   29  C  C            V C                  CC               C   .   Q .     
    42   90 L S  T  4 S+     0   0   98  624   84  S  S            V A                  KK               L   .   I .     
    43   91 L L  T >4 S-     0   0  120  627   87  T  V            D E                  VV               Y   .   S T     
    44   92 L D  G >4 S-     0   0  107  638   73  Y  D            S D                  NN               K   .   N N     
    45   93 L N  G >< S-     0   0    8  700   56  N  N            D N                  NN               N   .   G I     
    46   94 L G  G <  S-     0   0    0  882   52  G  G            K G                  GG               G   D   N D     
    47   95 L D  G <  S+     0   0   44  887   62  G  D            G H                  RR               G   Q   P E     
    48   96 L e    <   -     0   0    0  892    0  C  C            C C                  CC               C   C   C C     
    49   97 L D  S    S-     0   0   59  892   74  E  D            S D                  DD               E   S   Y A     
    50   98 L Q  S    S+     0   0    2  892   63  H  H            Q H                  hh               H   s   n s     
    51   99 L F  E     -U   62   0I   4  892   80  F  E            F E                  aa               F   e   t t     
    52  100 L d  E     +U   61   0I  10  893    1  C  C            C C                  AA               C   C   C C     
    53  101 L H  E     -U   60   0I  68  893   87  N  S            K S                  AA               T   K   D N     
    54  102 L E  E     -U   59   0I  92  893   68  E  E            P D                  AA               E   T   L D     
    55  103 L E  S    S-     0   0  100  893   82  d  S            g s                  gg               d   A   V G     
    56  104 L Q  S    S-     0   0  175  693   73  t  d            . d                  rr               d   G   N L     
    57  105 L N  S    S+     0   0  154  838   66  q  a            t g                  RR               L   S   N N     
    58  106 L S  S    S-     0   0   58  853   65  R  R            S a                  GG               A   T   R N     
    59  107 L V  E     -U   54   0I   7  890   79  R  R            H R                  AA               H   F   H Y     
    60  108 L V  E     -U   53   0I  45  891   88  Y  S            E S                  VV               R   T   Q T     
    61  109 L e  E     +U   52   0I   5  893    1  C  C            C C                  CC               C   C   C C     
    62  110 L S  E     -U   51   0I  24  893   75  S  S            S S                  SS               H   S   A A     
    63  111 L f        -     0   0   23  893    0  C  C            C C                  CC               C   C   C C     
    64  112 L A    >   -     0   0    8  893   75  S  L            A I                  AA               A   T   R I     
    65  113 L R  T 3  S+     0   0  149  893   80  P  N            Q H                  PP               T   A   V F     
    66  114 L G  T 3  S+     0   0   24  893    8  G  G            G G                  GG               G   G   G G     
    67  115 L Y  E <   -V   78   0J  20  893   11  Y  Y            W Y                  YY               Y   F   T F     
    68  116 L T  E     -V   77   0J  72  891   85  R  K            K N                  HH               S   T   T T     
    69  117 L L  E     -V   76   0J  67  888   64  L  L            I L                  LL               L   G   G       
    70  118 L A    >   -     0   0   23  889   78  M  D            S Q                  AA               A   D   K       
    71  119 L D  T 3  S+     0   0  175  889   77  D  D            g D                  RR               A   L   L       
    72  120 L N  T 3  S-     0   0   92  694   44  D  D            d D                  NN               D   C   .       
    73  121 L G  S <  S+     0   0   16  713   66  H  S            K S                  RR               N   D   .       
    74  122 L K  S    S+     0   0   71  687   76  A  R            T R                  RR               R   K   .       
    75  123 L A        -     0   0   22  685   66  K  K            K T                  SS               S   E   .       
    76  124 L f  E     -V   69   0J  12  847    9  C  C            C C                  CC               C   L   C       
    77  125 L I  E     -V   68   0J  78  846   80  E  S            V Q                  MM               V   Q   E       
    78  126 L P  E     -V   67   0J  62  850   71  P  P            P P                  AA               S   P   A       
    79  127 L T  S    S+     0   0  103  652   80  .  K            T K                  TT               Q   C   .       
    80  128 L G  S    S-     0   0   32  788   69  .  S            G G                  EE               V   V   .       
    81  129 L P  S    S+     0   0  116  601   75  .  T            R P                  RA               P   P   .       
    82  130 L Y  S    S+     0   0   59  794   86  .  S            F A                  VF               F   S   .       
    83  131 L P    >   -     0   0   17  799   62  .  S            S S                  AP               A   P   .       
    84  132 L g  T 3  S+     0   0   16  800    5  A  C            C C                  VC               C   C   .       
    85  133 L G  T 3  S+     0   0    0  712   37  G  G            G G                  GG               G   G   G       
    86  134 L K    <   -     0   0   69  588   68  R  Q            R Q                   R               K   N   K       
    87  135 L Q        -     0   0   37  477   65     I            V L                   V               P       Q       
    88  136 L T        +     0   0    4  428   78     L            S L                   V               V       R       
    89  137 L L        +     0   0  105  372   61     I              I                   S               V       L       
    90  138 L E              0   0  104  274   69     D              G                   P               N               
    91  139 L R              0   0  231  199   47     R              R                   K               Q               
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2   II IIIIIIIIIIII I IIIIIIIIIIIIIIIIII  IIIIIIIIIII III III III I IIIII
    94   17 C V  B     -A  271   0A   7  590    9   VV VVVVVIVVVVVV V IIVVVVVVVIIVVVVVVV  VVVVVVVVVIV VVV VVV VVV V VVVIV
    95   18 C G  S    S+     0   0   25  591    6   GG GGGGGGGGGGGG N GGGGGGGGGGGGGGGGGG  GGGGGGGGGGG GGG GGG GGG G GGGGG
    96   19 C G  S    S-     0   0   26  592    0   GG GGGGGGGGGGGG G GGGGGGGGGGGGGGGGGG  GGGGGGGGGGG GGG GGG GGG G GGGGG
    97   20 C Q  E     -B  237   0B  98  593   95   YY TSSFYNKFYYYV S RRYYFYYYYYYFHYYYFS  YVEYYYFYYHY YYY YYY QKS R KFYYV
    98   21 C E  E     -B  236   0B  80  594   67   TT SEETEQETNEEA F KKTETTTTTEETPEETEE  TTETSNTETDT VTT TPP TVT E DQPED
    99   22 C h        -     0   0    8  594   58   CC ACCCCSCCCCCS A AACCCCCCCCCCVCCCVC  CTSCCCCCCAC CCC CVV ATA A TVVCT
   100   23 C K    >   -     0   0  123  593   78   ER SAAAQNTAETQS A TTATTEEKEAAALSTTAA  REKGAEARENT TGG PPP KEP S TEEKS
   101   24 C D  T 3  S+     0   0   60  594   85   ER AAAKAIPKEAAP V TTEKKEEEEKKKIPPKRA  KSFAREKKEIK KAA EII VHP P IIIPN
   102   25 C G  T 3  S+     0   0    0  595   74   NN GHHNHSYNNHHG E LLNNNNNNNNNNSHYNNH  NNANSNNNNINNNNN HSS EGG N EASHY
   103   26 C E  S <  S+     0   0   36  595   66   SS ESSASASASSSS S EESGASSSSSSAESSSSS  SEKTASASSDSNGTT SEE DAA S NDQSF
   104   27 C h    >   +     0   0    4  595   92   VV FQQVQYMVVQQW H FFVVVVLVVVVVVRQILQ  IFWVAVVAVYIFVVV VVV WWW W HFVQA
   105   28 C P  T 3   +     0   0    0  599    9   PP PPPPPPPPPPPP P PPPPPPPPPPPPPPPPPP  PPPPPPPSPPPPPPP PPP PPP P PPPPK
   106   29 C W  T 3  S+     0   0    5  600   26   YY FWWYHWHYYHHW W YYYYYYYYYYYYWYHYYW  YWWYYYYYYWYWYYY YWW WWW W YYWWY
   107   30 C Q  E <   -J  122   0C   7  601   26   QQ IQQQQMQQQQQQ i QQQQQQQQQMMQQMQQQQ  QMqQQQQQQQQqQQQ Qqq QQQ Q QQqQv
   108   31 C A  E     -JK 121 146C   1  593   49   VV AVVVVAVVVVVV a VVVVVVVVVVVVAAVVAV  VVqVVVVAVIViAVV Vll AVV V VVsAs
   109   32 C L  E     -JK 120 145C   3  598   68   SS SSSSSASSSSSS I EESSSSSFSSSSASSSSS  SRTSSSSSSSSLSSS SYY GQM D SSLYS
   110   33 C L  E     -JK 119 144C   0  601    9   LL LLLLLLLLLLLL F LLLLLLLLLLLLLLLLLL  LLLLLLLLLFLLLLL LLL LIL L LLLLT
   111   34 C I  E     -JK 117 143C   0  601   81   NN QNNNNYNNNNNH S EENNNNNYNNNNMNNNQN  NSFNNNNQNQNQNNN NGG KGI V RQYVS
   112   35 C N  E >   - K   0 142C  30  601   88   SS LIIASYSASSSD R MMASASSSYIIAYYSSQI  AYSSSSASSHSSVSS SKK KYY V RRSDS
   113   36 C E  T 3  S+     0   0   63  117   78   .. ............ . ..................  ............... ... GKN . .....
   114   37 C E  T 3  S-     0   0  136  242   77   .. S........... . TT..............N.  .........R..... ... LTS N RN...
   115   38 C N  S <  S+     0   0   84  565   53   GG GGGGGQGGGGGF . YYGGGGGGGGGGSGGGGG  GF.GGGGGGLG.GGG G.. DMG G GS..A
   116   39 C E        -     0   0  100  589   94   YY SYYYYGYYYYYG . MMYYYYSYYYYYEYYYVY  YN.YYYYYSHYNYYY Y.. DGR T TRGNY
   117   40 C G  E     +J  111   0C  14  600   57   HH HHHHHQHHHHHR R HHHHHHHHHHHHKHHHHH  HRHHHHHHHHHMHHH H.. THQ R HHNKA
   118   41 C F  E     +     0   0C  28  611   33   FF FFFFFfFFFFFf f MMFFFFFFFFFFyFFFYF  FfSFFFFFFFFfFFF Flf iIF h THyfq
   119   42 C i  E     -J  110   0C   0  612    1   CC CCCCCcCCCCCc c CCCCCCCCCCCCcCCCCC  CcCCCCCCCCCcCCC Ccc cCC c CCccc
   120   43 C G  E     -J  109   0C   1  612    1   GG GGGGGGGGGGGG G GGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGG GGG GGG G GGGGG
   121   44 C G  E     -J  108   0C   0  612    9   GG GGGGGGGGGGGG G GGGGGGGGGGGGAGGGGG  GGGGGGGGGGGGGGG GAA GGG G GGAGG
   122   45 C T  E     -JL 107 130C   0  612   45   SS TSSSSSSSSSSS S SSSSSSSASSSSVVSSTS  AMVSSSSSSFSSSSS SVV SST S ASVSS
   123   46 C I  E     + L   0 129C   0  612   23   LL ILLLLLLLLLLL L IILLLLLLLLLLILLLLL  LLLLLLLLLLLLLLL LII LIL L IIILV
   124   47 C L        -     0   0    6  612   27   II IIIIVIVIIVVI I IIIIIIIIIIIIYIVIII  IILIIIIIIIIIIII IYY IVV I LIYIL
   125   48 C S  S    S-     0   0   22  612   56   SN NNNNNNNNNNNT S SSNSNNNCNSSNSNNSNN  NNSNSNNSSSSNTNN NSS NNT D NDSND
   126   49 C E  S    S+     0   0   99  612   63   DS SSSSEDASEEED P NNDNSEKEKSSSDNESAS  DDNSSESSEDSDSSS SED RSP K EADNS
   127   50 C F  S    S+     0   0   42  612   83   QQ NQQQNRDQQNNQ C NNQLQQQQQTTQKQNQKQ  QKNQQQQTQTQRQRR QKK EQE Q NGKRR
   128   51 C Y  E     - M   0 185C   7  612   34   WW TWWWWYWWWWWW W FFWWWWWWWWWWIWWWWW  WYWWWWWWWWWYWWW WII WWW W TWIWT
   129   52 C I  E     -LM 123 184C   0  612   14   VV IVVVVIVVVVVV V IIVVVVVVVAAVIVVVVV  VVVVVVVVVVVVVVV VII VIV V IIVVI
   130   53 C L  E     +LM 122 183C   0  612   27   VV VVVVVLVVVVVL V LLVVVVVIVVVVILVLLV  VLLVLVVVVVLLVVV LII VVI V LLIVV
   131   54 C T  E     - M   0 182C   0  612   43   SS TSSSSTSSSSST T TTSSSSSSSSSSTSSSTS  STTSSSSSSTSSSSS STT TTT T TTTST
   132   55 C A    >>  -     0   0    0  613    2   AA AAAAAAAAAAAA A AAAAAAAAAAAAAVAAAA  AAAAAAAAAAAAAAA AAA AAA S AAAAA
   133   56 C A  G >4 S+     0   0    0  613    9   AA AAAAAAAAGAAA A AAAAAAACAAAAAAAAAA  AAAAAGAAGAATAAA AAA AAA G AAAAA
   134   57 C H  G >4 S+     0   0    7  613    0   HH HHHHHHHHHHHH H HHHHHHHHHHHHHHHHHH  HHHHHHHHHHHHHHH HHH HHH H HHHHH
   135   58 C i  G X4 S+     0   0    0  613    1   CC CCCCCCCCCCCC C CCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCC CCC CCC C CCCCC
   136   59 C L  G << S+     0   0   31  613   66   YY SYYYYVYYYYYV F VVYYYYYYYYYYVWYYEY  YVVYYYYYYIYLYYY YVV IVV F VTLTV
   137   60 C Y  G <  S+     0   0  109  613   87   KK VQQKKAKKKKKE D KKQKKKKKKQQKEYKKIQ  KRHKKKKKKYKLKKK KDD DTV D YEDFY
   138   61 C Q  S <  S+     0   0   95  613   78   SS tTTSSrTSSSSD g ssYSSTPPPSSSrNSSTT  SglSSSSSPeSnSSS Snn rtd q ynrSn
   139   61AC A        -     0   0   16  373   75   .. vAA..a.....P i aa..........dP...A  .ws......t.v... .dd dsp l padRa
   140   62 C K  S    S-     0   0  172  387   77   .. RSS..K.....A N TT..........TY...S  .FR......E.K... .TT PRA S STVNE
   141   63 C R  S    S-     0   0  162  602   78   RR NRRRRQRRRRRG S VVHRRRRRRSSRLYRSSR  RMDGSRRRHNSKSGG RLL PYS Y EILKN
   142   64 C F  E     -K  112   0C  36  609   54   II VIIIVFVIIVVI L FFIVIIIIIIIIYMVILI  IILIIIIIILILIII IYY ITI Y FYYLF
   143   65 C K  E     -K  111   0C  67  609   79   QQ RSSQEEEQQQET S RRQQQQQQQQQQSQEQDS  QKLQQQQQQNQTQQQ QSS RMQ E SGSSL
   144   66 C V  E     -KN 110 161C   0  609   16   VV VVVVVVVVVVVV V LLVVVVVVVLLVVVVVLV  VVVVVVVVVIVVVVV VVV VYV F IVVVV
   145   67 C R  E     -KN 109 160C  40  609   55   RR RRRRRFQRRRRY H RRRRRRRIRRRRRIRKRR  RTRRKRRRRRKKRRR RKK IAR R RRRHV
   146   68 C V  E     +KN 108 159C   1  610   43   LL LIILLLLLLLLL L VVLLLLLLLLLLVLMLVI  LLLLLLLLLVLLLLL LVV LFL L AAVLA
   147   69 C G  S    S+     0   0    9  610   15   GG GGGGGRGGGGGG G GGGGGGGGGGGGGGGGLG  GGGGGGGGGGGLGGG GGG GSG G GGGGG
   148   70 C D        +     0   0   11  611   58   EE SEEEEREEEEER K AAEEEEEEEEEESDEEGE  EEEEEEEEESENEEE ESS EEA E SSSRT
   149   71 C R  S    S+     0   0   24  611   73   HH LHHHHIHHHHHH K DDYHHHHHHHHHVHHHEH  HHFDYHHHHSHPHDD YVV SHQ H TSKHD
   150   72 C N  B >   -P  234   0D  18  611   65   NN NNNNDNNNNDDS A SSNNNNNNNNNNWNHNHN  NNDNNNNNNENNNNN NWW DQN R LEYSN
   151   73 C T  T 3  S+     0   0   56  611   80   II NIIIIIFIIIIQ T TTIIIIIIIIIIKLILSI  IRQILIIIIWLGIII IKK VLR E RHKLR
   152   74 C E  T 3  S-     0   0  119  611   84   DA AFFAYRRAEYYA N SSDDAEKNEAAANRKALF  ECSNAEAAESAMDNN DTT TYT S NAFQA
   153   75 C Q  S <  S-     0   0  130  610   85   VV SVVLRGVLVRRG E KKVVVVVVVVVLLVISGV  VTNVAVLVVASNVVV VLL KQS T ETDTG
   154   76 C E        +     0   0  165  610   85   VS GNNNNSTNLNNS T GGLTNLLLLNNNGFNQnN  VTeVQLNNLKQGNAA QGG HLP T GGGNM
   155   77 C E        -     0   0   93  469   27   EE .EEEE.EEEEEN D ..EEEEEEEEEE.EEEeE  ESeEDEEEE.E.EEE E.. EDD E ...ED
   156   78 C G  S    S+     0   0   46  578   34   GG GGGGGNGGGGGP A GGGGGGGGGGGGGGGGGG  GPVGGGGGGGG.GGG DGG GGP G GGGNG
   157   79 C G  S    S+     0   0   47  585   75   NS TTTTTPNTNTTG t VVGTTTNTTTTTQTTTKT  NklNSNTTNKTATNN SQQ NSs W QQqTL
   158   80 C E        -     0   0   37  472   30   EE .EEEEEEEEEEQ e ..EEEEEEEEEE.EEEEE  EehEEEEEE.EQEEE E.. EEe E ..vG.
   159   81 C A  E     -N  146   0C  27  487   57   QQ .QQQQMQQQQQE Q ..QQQQQQQQQQ.QQQQQ  QTVQQQQQQ.QIQQQ V.. IQM E ..KQ.
   160   82 C V  E     -N  145   0C  71  590   83   FF TQQFFLYFFFFS I IIFFFFFFFFFFHLFTTQ  FRDFTFFFFLTVFFF VHH HNR I LLVKV
   161   83 C H  E     -N  144   0C  14  599   76   II SIIIIQIIIIIR F YYIIIIIIIIIIAMIIFI  IFYIIIIIIHIRIII RAA RII I IVAIV
   162   84 C E        -     0   0   90  602   78   NN AQQDSRSDNDXR S NNDNENHSNSSDRKSSMQ  NVSSSNDDNDSNSSS SRR DPS K TTGKR
   163   85 C V  E     -O  186   0C  27  607   64   SS VAASSKSSASSV V VVASSAAAASSSVTSSVA  AIIASASSAVSVSAA SVV VII G AVIVV
   164   86 C E  E    S+     0   0C  70  608   73   AA SSSQSVSQASSQ E EESEQAADASSQADESES  ARSSSAQVAKSRSSS SAA AER E SKREE
   165   87 C V  E     -O  185   0C  13  609   72   KK AKKKRERKKRRQ D KKKKKKKKKRRKVTRKRK  KAEKKKKKKRKRKKK VVV QGS K EAKKQ
   166   88 C V  E     -O  184   0C  72  610   46   VV IAAVVSVVIVVA L VVIVVIIIIVVVIIVVAA  IIISVIVVIYVIVSS III III L IVHIL
   167   89 C I  E     +O  183   0C  27  610   43   II YIIIIIIIIIIV I IIIIIIIIIIIIRIIIII  ITVIIIIIIIIMIII IRR CVH F FHEII
   168   90 C K  E     -O  182   0C  68  610   82   RR VQQKRTRKRRRC I CCRRKRRCPRRKKWRRRQ  RGSVRRKMRTRTRVV RKK IVN I ISDPP
   169   91 C H    >   -     0   0   19  611   13   HH HHHHHLHHHHHH H HHHHHHHHHHHHHHHHHH  HDHHHHHHHHHNHHH HHH HHH H HHYFH
   170   92 C N  T 3  S+     0   0  156  611   61   PP PPPPPNPPPPPS P EEPPPPPPPQQPEPPSAP  PFPPSPPPPPSDPPP PEE PPP P PPRPE
   171   93 C R  T 3  S+     0   0  150  608   73   KR NQQNNHNNQNNS H KKKSSDKEKSSNDSNGGQ  KSHSGQNSKQGKSSS KDD DSD K WEEKN
   172   94 C F    <   -     0   0   24  611    5   YY YYYYYYYYYYYY F YYYYYYYYYYYYYYYYYY  YYYYYYYYYYYFYYY YYY YYY Y YYYYY
   173   95 C T     >  -     0   0   56  611   68   NN iNNNNQNNDNNN D rrSNNDNNnNNNvDSNDN  NFNNNDNNNNNSSNN Sll HNg k DNKNN
   174   96 C K  T  4 S+     0   0  145  561   78   SA dSSSSGSSRSSF S eeSSSRNPvSSStY.APS  A.DSARSSRIAFSSS Saa ..k g DSKDA
   175   97 C E  T  4 S+     0   0  174  569   91   WN EWWRWGYRKWWL S VVWNRKETKYYRIQ.YAW  R.RNNKRRITYESNN III ..R L WGIRT
   176   98 C T  T  4 S-     0   0   44  598   57   TT HTTNNRNNTNNT S PPTTNTTTKTTNLTSTTT  TNTTTTNNITTTTTT TLL EDS D TNYPT
   177   99 C Y    ><  +     0   0   60  604   65   LI HIILIIILLIIF N KKLLLLLLYLLLFLYLVI  IFFLLLLLLMLFLLL LFF ILS Y LYFHT
   178  100 C D  T 3   +     0   0   25  609   37   DD DDDDDNDDDDDD N ddDDDNDDNDDDNDnDDD  DDKNNNDDNDDNNNN NNN kDN t DDFND
   179  101 C F  T 3  S+     0   0   21  595   66   SN FNNNNNNNNNNN N ffNNNNNNNNNN.FnNNN  NHNNNNNNNNNNNNN N.. nY. y WFNNN
   180  102 C D    <   +     0   0    1  609    0   DD DDDDDDDDDDDD D DDDDDDDDDDDDDDDDDD  DDDDDDDDDDDDDDD DDD DDD D DDDDD
   181  103 C I        +     0   0    0  611   13   II IIIIIVIIIIII I IIIVIIIIIIIIIIIIII  IIIIIIIIIIIIIII III LII I IFIII
   182  104 C A  E     -MO 131 168C   0  611   60   MM AMMMMAMMLMMC G AALMMLMMMMMMAMMMMM  MAAMMMMMMAMGMMM MAA AAA A ASAMA
   183  105 C V  E     -MO 130 167C   0  612   16   LL ILLLLLLLLLLL V LLLLLLLLLLLLVLLLLL  LLLLLLLLLLLLLLL LVV LLL L ILVLL
   184  106 C L  E     -MO 129 166C   0  613   30   II WIIIILIIIIIL Y VVIIIIVIIIIIIIIILI  ILLIIIIIILIVIII IMM ILL V LLIIV
   185  107 C R  E     -MO 128 165C  40  613   43   KK KKKKKRKKKKKQ A KKKKKKKKKKKKRKKKKK  KRRKKKKKKEKEKKK KRR RKR K KERKI
   186  108 C L  E     - O   0 163C   0  613   16   LL LLLLLLLLLLLL Y TTLLLLLLLLLLLLLLLL  LLLLLLLLLLLLLLL LLL LLL L LLLLV
   187  109 C K  S    S+     0   0  101  613   69   SS TSSSSTSSSSSS G TTSSSSSSSSSSVYRSPS  SNAKSSSSSASDQKK AVV RRS K EGAKS
   188  110 C T  S    S-     0   0   82  614   74   SS TSSTKEKTSKKA A EETSTSTTTQQTDHEKRS  SDKSKSTKTLKSSSS SDD TQR R QEDKP
   189  111 C P        -     0   0   48  614   39   PP PPPTPPPTPPPP C PPPSTPPPPPPTTPPAAP  PKPAARTPPPAPAAA ASS pPP P NASPP
   190  112 C I        -     0   0    4  562   63   AA .AAAAVAAAAAL . IIAAAAAAAAAALVAAAA  AVTAAAAAAVAIAAA VLL tIT A LVLV.
   191  113 C T        -     0   0   95  566   73   AT .TTRTSTRVSTN A KKVQRVIIVTTRIETTVT  TPVSTVRSVDTQSSS EII TTI V EQIT.
   192  114 C F        +     0   0   56  612   34   LL ILLLLILLILLF V FFIILIIIILLLFVLLLL  ILFLLILLILLFILL YFF FFL F LFFFL
   193  115 C R  B >   -Q  196   0E  52  613   63   NN sNNSNENSNNNT k TTNNSNNNNNNSNTNNNN  STRNNNSNNNNNNNN SNN TNT Y GGNNP
   194  116 C M  T 3  S+     0   0   29  594   77   TS gQQASPQASSSA a DDASSAADASSAAEQSAQ  SQASSAASAQSSSSS AAA KAH K PETK.
   195  117 C N  T 3  S+     0   0   13  602   90   RR NYYNYNYNRYYS S NNRYNRRYRYYNEAYYAY  RINRYRNYHSYQYRR DDD HYR R AGNY.
   196  118 C V  B <   +Q  193   0E   0  604   27   VV IAAIVLVIVVVI V IIVVIVVVVVVIVVVVVA  VIMVVVIVVVVIVVV IVV VVI V VVVV.
   197  119 C A        -     0   0    1  606   80   SS AQQQQVQQSQQF R KKSKQSSSSKKQRAQNQQ  ARIANSQSSRNSRAA QRR RSN H QQRK.
   198  120 C P        -     0   0    8  608   54   TA YAASPPPSAPPP V PPTTSTTITTTSPPPTPA  TPPSTTSTTPTPTSS PPP PQL S KPPP.
   199  121 C A        -     0   0    2  609   39   II AIIVVIVVIVVV V IILVVIIIIVVVIIVVVI  IIVIVIVVIAVIVVV III VVA V IIII.
   200  122 C g  B     -c  290   0B   1  610   66   SS NAAPACAPSAAC C EEASPSSPSSSPQPAPQA  SCCSPSPASKPCSSS APP CCC C DVPR.
   201  123 C L        -     0   0   27  612    5   LL LLLLLLLLLLLL L LLLLLLLLLLLLLLLLLL  LLLLLLLLLLLLLLL LLL LLM L LLLL.
   202  124 C P        -     0   0    7  613   30   PP APPPPPPPPPPA P VVPPPPPPPPPPAPPPAP  PPPPPPPPPPPPPPP PAA PPP P PVAPP
   203  124AC E     >  -     0   0   92  612   75   SK ASSSTESSTTTA P SSSSSTSTTSSSDTTTRS  GNLTTTSSTVTPSTT SDD TQN E EEDKT
   204  125 C R  H  > S+     0   0  109  612   78   AS SSSASGSAASSA L KKASAAAHAGGASRSSAS  TANSSAASAASSSSS SSS SAD K ADSKE
   205  126 C D  H  > S+     0   0  124  612   85   CC GCCCCSCCPCCD H EECCCPLPPCCCACCCGC  CTDCCPCCPGCGCCC CAA AAT S TEECQ
   206  127 C W  H  >>S+     0   0    4  612   88   AA SVVAADAAPAAS T PPAAAPAPPAAAPPAVAV  ADKAVPAAPQVVAAA APP TLV W LPPPP
   207  128 C A  I  X>S+     0   0    0  612   75   PP DNNSPSPSAPPT R SSSSSAAVAGGSAYPARN  DDISTASSAEARSSS KAA PLH S KSASP
   208  129 C E  I  <5S+     0   0   75  613   82   AS PTTAAYAAAAAF I EEGSAAAPPAAAAGATLT  VHNAATASAITKAAA AAA DAF P IDAVV
   209  130 C S  I  <5S+     0   0   70  614   66   GG AGGGGVGGGGGH P GGSGGGGCGGGGGGGGEG  GYTGGGGGGPGYGGG GGG LGP P QEGGG
   210  131 C T  I  <5S+     0   0   18  108   73   .. ............ . ..................  ..T............ ... ... . ....A
   211  131AC L  I ><  S-     0   0  119  503   80   .s ...s.T.ss... R MMSasssssttsG..SVQ  SKF.sssgsys.s.. sGG GGs A yRGRq
   227  146 C E  T 3  S+     0   0   47  527   75   .L ...S.A.SS... Y RRSSSSFYSSSSI..SGT  VEPSSSSSSVSQSSS NII EES E YSLTE
   228  147 C K  T 3  S+     0   0  169  548   68   .G GSSG.D.GG..D L SSGGGGGGGGGGL..GNS  GDHGGGGSGGGNGGG GLL NSG N QLFAS
   229  149 C G  S <  S-     0   0   29  559   66   LE GIVT.G.TA..G G GGVSTAAAASSTW..SGV  TGGTSATSAGSGTTT YWW ESG E GEGAG
   230  150 C R        -     0   0  213  584   86   SK SGGN.DAND..Q L MMNNNDDDDNNNLYALVG  NTPSLDNNDYLSNSS NLL DPS G PEIGL
   231  151 C Q  B     -R  224   0F  79  599   93   SY GSSYSLDYYSSF Y LLYYYYYYYYYYQMNYMS  YPYYYYYYYNYTYYY YQQ LGQ Y SSSSS
   232  152 C S        -     0   0   14  607   51   GP SPPPGSKPPGGA S AAPPPPPPPPPPPPRPPP  PSAPPPPPPEPAPPP PPP SSP S TRPAS
   233  153 C T  S    S+     0   0   48  608   73   KD SDDDDDNDDDDD Q NNDSDDDDDDDDTTDDDD  ECTDDDDDDYDTDDD ELI TNE D NQSSN
   234  154 C R  B    S-P  150   0D 102  608   85   LV SVVLQTKLEQQI Y HHLRLEEEERRLSLMNAV  LLKVVELTETNETVV LSS QVA V HFFVK
   235  155 C L        -     0   0    3  610    3   LL LLLLLLLLLLLL L LLLLLLLLLLLLLLLLLL  LLLLLLLLLLLLLLL LLL LLL L LLLLL
   236  156 C K  E     -BD  98 221B  31  610   51   QQ LMMQQQQQQQQQ K MMQMQQQQKMMQLQQQRM  QQQKQQQRQQQQQQQ QLL RQN R QRLQQ
   237  157 C M  E     -BD  97 220B  18  611   94   CC KCCCCQCCCCCE K AACCCCCCCCCCKCCCAC  CEQCCCCCCVCQCCC CKK HEQ E QAECQ
   238  158 C L  E     - D   0 219B   4  612   44   LL VVVLLLLLLLLV T VVLLLLLLLLLLTLLLVV  LVVLLLLLLVLVLLL LTT AAA A VVTLV
   239  159 C E  E     - D   0 218B 107  612   72   DK SQQNETNNDNEA E EEENNEDDDNNNSNDRYQ  DEQKNDNDDTRTDKK NSS TSV Q SVSNQ
   240  160 C V  E     - D   0 217B   0  612   46   AA VAAAIVIAAIIV V LLAAAAAAAAAAVVLALA  AVIAAAALAIAVAAA AVV IIV V VVVLV
   241  161 C P  E     - D   0 216B  34  612   28   PP PPPPPPPPPPPQ N PPPPPPPPPPPPKPPPDP  PPPPPPPPPPPPPPP PKK PPP R PPGPP
   242  162 C Y  E     -F  263   0B  36  613   46   LI VVVVIIIIVIIV L VVLIIVVVVIIIIIIVTV  VVIIVVIIVTVIIII III VLL L VLLVL
   243  163 C V  E     -F  262   0B  24  614   37   LL VLLLLMLLLLLV I VVLLLLLLLLLLLVLLTL  LMILLLLLLVLLLLL LLL LVR V VVVLV
   244  164 C D     >  -     0   0   88  613   57   ST ASSTSSSTSSSG S GGSSTSTTTSSTDDSSSS  SSSSSSTSTNSSSSS SDD SDT S DNDSD
   245  165 C R  H  > S+     0   0   51  613   78   ED RDDDTNDVQTTN H LLHDAQQQQDDDPLDSRD  DNNDSQDSQISNDDD DPP VQR R NRPQS
   246  166 C N  H  > S+     0   0  105  614   74   AS STTSRQRSARRN K KKASSAAAATTSNQRSGT  SEKSSASSANSSSSS QNN SRS D VTNRV
   247  167 C S  H  > S+     0   0   48  614   78   EA TSSQDEDQEDDQ L KKDTEEKEEDDQVVDQYS  VDQSQKQSKVQQNSS EVV EAE T IEYTQ
   248  168 C j  H  X S+     0   0    1  614    2   CC CCCCCCCCCCCC C CCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCC CCC CCC C CCCCC
   249  169 C K  H >< S+     0   0   88  614   73   ER qRRSEkDSEEER q KKERSEEEERRSKEESNR  RrrKSESNKqSkRKK QKK reE N saRKq
   250  170 C L  H 3< S+     0   0  150  574   89   AK qNNNNgNNANN. s ..ANNAAAANNN.NNSDN  KstSSANSAaSgRSS E.. nyR A yn.Rt
   251  171 C S  H 3< S+     0   0   23  604   76   SA YSSSSYSSSSSC Y KKSASSSCSSSSRASAAS  AYKAASSASIAYAAA ARR YRS S QKRAY
   252  172 C S    <<  -     0   0   20  607   83   YY PYYYYFYYYYYS Y KKYYYYYYYYYYSYYYYY  YHMYYYYYYTYKYYY YSS SNY Y NDSYY
   253  173 C S  S    S+     0   0   79  607   83   PP EPPPPRPPPPPY G LLPPPPPPPPPPYPPPSP  PPSPPPPPPNPPPPP PYY GLP S FIYKW
   254  174 C F  S    S-     0   0  124  607   79   GG EGGGGFGGGGGQ K KKGGGGGGGGGGQGGGGG  GKLGGGGGLDGSLGG GQQ HKG G GLRKR
   255  175 C I        -     0   0  100  608   87   QQ DDDEMQMEKMME R GGEQEKKRKEEEYMMQTD  QMVQRKEQKTQRLQQ DYY TPK I SPYIP
   256  176 C I        -     0   0   13  609   18   II IIIIIIIIIIIL I VVIIIIIIIIIIIIIILI  IIIIIIIIIIIIIII III III I IVLII
   257  177 C T    >   -     0   0   16  614   35   TT STTTTTTTTTTT T AATSTTTTTTTTTSTTTT  TSTTTTTTTTTYTTT TTT NTS N LTTTS
   258  178 C Q  T 3  S+     0   0  133  614   68   ES TNNKDNDKNDDD D NNNSNSSSSNNKKPPSDN  NDESSSKSSNSDSSS SEE DAA E SEKKE
   259  179 C N  T 3  S+     0   0   24  614   60   TN NNNNARSNNAAN N DDNNNNNNNNNNTRANNN  NNSNNNNNNNNNNNN NTT KRD R YSANA
   260  180 C M  E <   - G   0 311B   2  614   13   MM MMMMMMMMMMMM M MMMMMMMMMMMMMMMMMM  MMIMMMMMMMMMMMM MMM VMM Y HMMMM
   261  181 C F  E     - G   0 310B   8  613   35   VI VIIFFMFFFFFM L IIIFFFFFFFFFIVFIFI  MMLFIFFFFFILFFF III IRI I LIIFL
   262  182 C j  E     +FG 243 309B   1  614    1   CC CCCCCCCCCCCC C CCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCC CCC CCC C CCCCC
   263  183 C A  E     +FG 242 308B   0  614   26   AL ALLAAAAAVAAA A AAAAAVVIVAAAAAAVAL  LAAAIVAAVAVAAAA VAA AAA A AAAAA
   264  184 C G  S    S-     0   0    3  614   10   GG GGGGGGGGGGGG G GGGGGGGGGGGGaGGGVG  GGAGGGGGGGGGGGG GAA GGG G GGAGG
   265  185 C Y        -     0   0   56  591   57   FF QYYFYYYFFYYV S FFFFFFFFFFFFlYYYYY  FYVYYFFFFLYVFYY FAA YIN Y DYAFL
   266  185AC D  S    S-     0   0   81  594   83   LL TLLLLLLLLLLA P EELMLLLLLLLLLMLLAL  LEMLLLLMLILPMLL LLL EYP P AVLIP
   267  185BC T  S    S+     0   0   76  614   61   EE SEEAEDEAEEEE D KKEEAEEEEEEAKEEEAE  EETENEAEEgEEEEE EGG GGE G GeGKE
   268  186 C K  S    S-     0   0  107  563   32   GG GGGGGGGGGGGG W GGGGGGGGGGGG.GGGGG  GGGGGGGGGgGGGGG G.. GTG G .g.GG
   269  187 C Q  S    S+     0   0  102  569   37   GG GGGGGGGGGGGG T NNGGGGGGGGGG.GGGGG  GLGGGGGGGGGGGGG G.. KPG G .G.GG
   270  188 C E        +     0   0   33  613   55   KK KKKKKRKKKKKK T KKKKKKKKKKKK.KKKRK  KKRKKKKKKKKKKKK KRR IKV V IKKKK
   271  189 C D  B     -A   94   0A   7  614    4   DD DDDDDDDDDDDD D DDDDDDDDDDDDDDDDDD  DDDDDDDDDDDDDDD DDD DGD D DDDDD
   272  190 C A        -     0   0    7  614   42   SS SSSSSSSSSSSA S AASSSSSSSSSSSASSAS  SSSSSSSSSSSASSS SAA STT S AASSA
   273  191 C k    >   -     0   0    7  614    3   CC CCCCCCCCCCCC C CCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCC CCC CCC C CCCCC
   274  192 C Q  T 3  S+     0   0   90  614   25   QQ QQQQQQQQQQQQ N VVQQQQQQQQQQHNQQQQ  QQEQQQQQQSQQQQQ QRR KKQ G QQQQQ
   275  193 C G  T 3  S+     0   0    6  614    8   GG GGGGGGGGGGGG G GGGGGGRGGGGGGGGGGG  GGGGGGGGGGGGGGG GGG GGG G GGGGG
   276  194 C D    X   +     0   0    0  614    0   DD DDDDDDDDDDDD D DDDDDDDDDDDDDDDDDD  DDDDDDDDDDDDDDD DDD DDD D DDDDD
   277  195 C S  T 3  S+     0   0   14  614    1   SS SSSSSSSSSSSS S SSSSSSSSSSSSSSSSSS  SSSSSSSSSSSSSSS SSS SSS S SSSSS
   278  196 C G  T 3  S+     0   0    0  614    0   GG GGGGGGGGGGGG G GGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGG GGG GGG G GGGGG
   279  197 C G    <   -     0   0    0  614    1   GG GGGGGGGGGGGG G GGGGGGGGGGGGGSGGGG  GGGGGGGGGGGGGGG GGG GGG G GGGGG
   280  198 C P  E     - H   0 294B   1  614    2   PP PPPPPPPPPPPP P PPPPPPPPPPPPPPPPPP  PPPPPPPPPPPPPPP PPP PPP P PPPPP
   281  199 C H  E     -EH 219 293B   0  614   49   VV LVVVVLVVVVVL L MMVVVVVAVVVVLLVVLV  VLMVVVVVVAVLVVV VLL FLL L LLLVL
   282  200 C V  E     -EH 218 291B   3  614   26   VV VVVVVQVVVVVV V AAAVVVVVVVVVVVVVIV  VIVVVVVVVVVQVVV VVV VVV V VVVVV
   283  201 C T  E     - H   0 290B   0  614   66   CC DCCCCLCCSCCS C VVCCCSCCYCCCSCCCCC  CRVCCCCCCICICCC CSS CCC C YVSCV
   284  202 C R  E     + H   0 289B  99  614   70   NN ANNNNVNNNNNR E NNNNNNNDNNNNGDNNNN  NERSNNNNNDNYNNN NGG KEQ P GDGGN
   285  203 C F  E >  S- H   0 288B  22  614   71   GN SGGGGnGGGGGg A NNGNGGGGGGGGGGGGGG  GrrGGGGGGGGdGGG GGG dSH r GGGGN
   286  204 C K  T 3  S-     0   0   85  222   71   .. .....t.....a S ..................  .dd........t... ... tKG d .....
   287  205 C D  T 3  S+     0   0  108  223   55   .. .....G.....S G ..................  .KK........K... ... SGN G .....
   288  206 C T  E <   - H   0 285B   3  233   75   .. .....R.....V R ..................  .RR........S... ... RRQ S .....
   289  207 C Y  E     - H   0 284B  21  242   51   .. K....H.....W M ..................  .YW........Y... ... FWW F .....
   290  208 C F  E     -cH 200 283B   0  613   91   EQ TEEQQEEQEQQI F KKQQQQQEQQQQQEEQAE  QEEKQQQQQQQTEKK EQQ IVF V QQQQQ
   291  209 C V  E     + H   0 282B   1  613   38   LL LLLLLILLLLLQ L LLLLLLLLLLLLLVLLLL  LLLLLLLLLVLIVLL LLL LLL L VLLLL
   292  210 C T  E     +     0   0B   1  613   84   QQ VQQQQVQQQQQS F AAQQQQQQQQQQVQQQNQ  QIVQQQQQQVQVQQQ QVV HMT T VAVKV
   293  211 C G  E     -IH 312 281B   0  613    0   GG GGGGGGGGGGGG G GGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGG GGG GGG G GGGGG
   294  212 C I  E     -IH 311 280B   0  613   19   II VIIVVVVVIVVI I VVIIVIVIVIIVILVIII  IVIIIVVVIIIIIII III AVV I IVIVI
   295  213 C V  E     +I  310   0B   7  613   14   VV VVVVVVVVVVVV V VVVVVVVVVVVVVVVVVV  VVIVVVVVVVVVVVV VVV VTT V VVVVV
   296  214 C S  E     -     0   0B   1  612    0   SS SSSSSSSSSSSS S AASSSSSSSSSSSSSSSS  SSSSSSSSSSSSSSS SSS SSS S SSSSS
   297  215 C W  E     -I  309   0B  45  613    7   WW WWWWWWWWWWWF W WWWWWWWWWWWWYWWWWW  WWWWWWWWWWWWWWW WYY WWW W WWFFW
   298  216 C G        -     0   0   26  613    0   GG GGGGGGGGGGGG G GGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGG GGG GsG G GGGGG
   299  217 C E  S    S-     0   0   25  609   90   YA YRRYYKYYYYYD E KKYYYYYDYYYYIQYIYR  YNLSIDYYYYIEYYY III VnH K YNYNE
   300  218 C G  S    S-     0   0   19  612   13   GG GGGGGEGGGGGG G GGGGGGGGGGGGGGGGGG  GGEGGGGGGSGGGGG GGG GGG G GDGGG
   301  220 C k  S    S-     0   0    7  613    2   CC CCCCCCCCCCCC C CCCCCCCCCCCCCCCCCC  CCCCCCCCCCCCCCC CCC CCC C CCCCC
   302  221 C A  S    S+     0   0    4  612   16   AA AAAAAAAAAAAG A GGAAAAAAAAAAAAAAAA  AAAAAAAAAAAGAAA AAA AAA A AAAAA
   303  222 C R    >   -     0   0  105  611   73   QQ QLLQEQQQQEEQ G QQQQQQRQQQQQNEEQYL  MRKQQQQQQDQQQQQ LNN RDF R FKNKR
   304  223 C K  T 3  S+     0   0  152  611   64   KK PPPRRRKRKRRP K EEKRRKKKKRRRPPRKPP  KPPKKKRRKPKPKKK KPP KSA P KPPPP
   305  223AC G  T 3  S+     0   0   26  613   58   GG NNNNDNDNNDDG N GGGNNNNNNNDNFNDGNN  GGGNGNNNRKGNNNN GFF GGG N GGFKN
   306  224 C K    <   -     0   0   43  613   85   RK LYYYHYNYRHHV K VVKKYRRKRRRYFYHYYY  KFMKYKYKRYYYSKK YFF QYK Y YYFYT
   307  225 C Y        -     0   0   33  613   50   PP PPPPPPPPPPPP P PPPPPPPPPPPPPPPPPP  PPPPPPPPPPPPPPP PPP PAY V PPPPP
   308  226 C G  E     -G  263   0B   4  611    2   GG GGGGGGGGGGGG G GGGGGGGGGGGGGGGGGG  GGGGGGGGGGGGGGG GGG GGG G TGGGG
   309  227 C I  E     -GI 262 297B   6  612   11   VV VVVVVVVVVVVV V VVVVVVVVVVVVVVVVVV  VVVVVVVVVIVVVVV VVV IVV V VVVVV
   310  228 C Y  E     -GI 261 295B   1  612    1   YY YYYYYYYYYYYY Y YYYYYYYYYYYYYYYYYY  YYYYYYYYYYYYYYY YYY YYY Y YYYYY
   311  229 C T  E     -GI 260 294B   2  612   39   TT STTTAATTTAAT T TTTATTTTTTTTAVATTT  TTTTTTTTTTTTTTT TAA TAA L TSATA
   312  230 C K  E >   - I   0 293B  21  612   42   KK RKKKKRKKKKKR Q NNKKKKKKKKKKNKRKKK  KRRKKKKKKKKRKKK KNN DDG Q RNNEN
   313  231 C V  G >  S+     0   0    1  611    8   VV IVVVVVVVVVVV V VVVVVVVVVVVVVLVVVV  VV VVVVVVVVVVVV VVV IVV V VVVVV
   314  232 C T  G 3  S+     0   0    2  609   71   CC GCCCCTCCYCCS T AACCCYYHYCCCACCCSC  CA CCYCCYSCNCCC CAA KVQ T SAACA
   315  233 C A  G <  S+     0   0   29  609   79   QN TNNNIKLNNIIR N HHNNNNNNNNNNEEINNN  NR NNNNNNANRNNN NVV KYQ S DYHRH
   316  234 C F  S <> S+     0   0    7  605   35   FY FYYFFFFFYFFF Y YYYFYYYYYYYFLFFYYY  YY YYYFYYFYFYYY YLL YFL M FVLYF
   317  235 C L  H  > S+     0   0   23  603   80   VV RNNVNVNVVTNQ N RRVTVVVLLNNVKHIVIN  VL VVVVRVRVLNVV VKK LKK M IRKTN
   318  236 C K  H  > S+     0   0  116  602   68   DS SAATDANTDDDT K KKDTSDDAASSTPSDSTA  RN SSKTSDDSSSSS DPP NDQ S EDPKN
   319  237 C W  H  > S+     0   0   26  602    1   WW FWWWWWWWWWWW W WWWWWWWWWWWWWWWWWW  WW WWWWWWWWWWWW WWW WWW F FWWWW
   320  238 C I  H  X S+     0   0    1  599   12   II IIIILALIILLI I IIIIIIIIIIIIIFLIII  II IIIIIIIIIIII III IIV I IIIII
   321  239 C D  H  < S+     0   0   66  570   71   QQ SAAQEREQKKE    DDQRQRRKKSSQLEEQEA  Q  KKKQSKNQKNQQ QLL DRF N HRLKA
   322  240 C R  H >< S+     0   0  136  556   71   EQ QQQSTSTSDNT    TTENNDDEDNNSNETSNQ  D  QTNSSDESSRQQ ENN NQH E EENSQ
   323  241 C S  H >< S+     0   0    6  523   72   TT  TTTTNTTTTT    HHTTTTTTTTTTAVTTTT  T  TTTTTT TNTTT TAA ITV T H AT 
   324  242 C M  T 3< S+     0   0   25  479   41   II  IIIM MIIMM    MMIMIIIIIMMIILMIII  M  IMIIMI ISIII III VVM I M II 
   325  243 C K  T <  S+     0   0  153  444   70   AA  AASA ASAAA    KKANAAAAAAASEAAAAA  A  ASASSA AKQAA AKK KST S   KA 
   326  244 C T    <         0   0   51  390   65   AA  AASS SSASS    EEASAAAAANNS ASANA  A  SSASSA ADNSS A   NTN A    K 
   327  245 C R              0   0  197  273   47   NN  NNN   NN      NNNNNNNNNNNN   NNN  N  NNNNNN N NNN         N    N 
## ALIGNMENTS  911 -  980
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1   49 L Q              0   0  101  671   35  EE        Q        Q   E  QQ Q Q    Q     E Q      Q                  
     2   50 L a    >   +     0   0   22  858    0  CC        C        C   C  CC C C    C  C  C C      C                  
     3   51 L E  T 3  S+     0   0  187  858   80  AG        S        S   L  SS N S    S  Q  A D      N                  
     4   52 L T  T 3  S-     0   0  105  864   61  NT        P        P   E  PP P P    P  T  S S      P                  
     5   53 L S    <   +     0   0   89  868   72  YS        L        L   E  LL L L    L  N  Q S      L                  
     6   54 L P        +     0   0   10  878   31  PE        P        P   K  PP P P    P  P  P P      P                  
     7   55 L b        -     0   0   18  893   21  CG        C        C   C  CC C C    C  C CC C      C                  
     8   56 L Q  S    S+     0   0   92  892   83  QD        N        N   S  NN S N    N  Q QQ V      S                  
     9   57 L N  S    S-     0   0   63  893   51  NV        E        E   F  EE E E    E  N NN H      E                  
    10   58 L Q  S    S-     0   0  152  893   57  GC        D        D   E  DD E D    D  G GG G      E                  
    11   59 L G        -     0   0   16  893   40  Gd        g        g   E  gg g g    g  G GG T      g                  
    12   60 L K  E     -S   23   0G 117  852   79  Tt        s        t   A  ss n s    s  R TT .      n                  
    13   61 L a  E     -S   22   0G  45  882   10  CC        C        C   R  CC C C    C  C CC C      C                  
    14   62 L K  E     -S   21   0G 155  890   81  SE        K        R   E  KK K K    R  T ST k      K                  
    15   63 L X  E     +S   20   0G 120  768   39  DN        D        D   .  DD D D    D  V KH k      D                  
    16   64 L G        -     0   0   44  862   73  GY        G        G   .  GG G G    G  E PG F      G                  
    17   65 L L  S    S-     0   0  152  871   64  MP        R        Q   .  RR Q K    Q  R NI L      Q                  
    18   66 L G  S    S+     0   0   67  883   63  NG        A        A   .  AA A T    A  G RN G      A                  
    19   67 L E        -     0   0  119  837   61  DT        T        T   .  TT T S    T  A .S .      T                  
    20   68 L Y  E     -S   15   0G  37  883   11  YF        F        F   .  FF F F    F  S .F Y      F                  
    21   69 L T  E     -S   14   0G  71  886   82  KI        T        T   .  TT T T    T  V .R T      T                  
    22   70 L b  E     -S   13   0G  20  889    0  CC        C        C   .  CC C C    C  C CC C      C                  
    23   71 L T  E     -S   12   0G  85  890   86  TS        I        I   .  II I I    I  L DQ I      I                  
    24   72 L c        -     0   0   44  890    0  CC        C        C   .  CC C C    C  C CC C      C                  
    25   73 L L    >   -     0   0   62  890   88  PH        K        K   .  KK K K    K  P PP D      K                  
    26   74 L E  T 3  S+     0   0  177  890   75  PE        P        P   .  PP P S    P  P PA E      P                  
    27   75 L G  T 3  S+     0   0   29  893   20  GG        G        G   V  GG G G    G  Q GG G      G                  
    28   76 L F  E <   +T   36   0H  40  893    9  YF        W        W   F  WW W W    W  Y WF F      W                  
    29   77 L E  E     +T   35   0H  74  893   73  Te        Q        Q   e  QQ Q Q    Q  G NG E      Q                  
    30   78 L G  S >  S-     0   0   32  889    5  Gn        G        G   e  GG G G    G  G GG G      G                  
    31   79 L K  T 3  S+     0   0  156  891   73  KV        D        D   K  DD E E    D  K KP N      E                  
    32   80 L N  T 3  S-     0   0   33  892   62  NS        K        R   T  KK K K    K  T HT Q      K                  
    33   81 L c  S <  S+     0   0    1  892    3  CC        C        C   N  CC C C    C  C CC C      C                  
    34   82 L E        +     0   0   87  891   44  SQ        E        E   E  EE E E    E  E QE E      E                  
    35   83 L L  E    S-T   29   0H  96  889   88  SD        Y        Y   F  YY I F    Y  S TT R      I                  
    36   84 L F  E     -T   28   0H 139  889   83  PI        D        D   w  DD D D    D  G DA L      D                  
    37   85 L T        -     0   0   44  677   75  I.        i        i   q  ii i i    i  K V. I      i                  
    38   86 L R        +     0   0   57  408   92  ..        c        c   d  cc c r    c  . .. .      c                  
    39   87 L K        +     0   0   96  535   81  .D        K        K   A  KK K K    K  . D. .      K                  
    40   88 L L        -     0   0   91  608   90  .E        D        D   S  DD D D    D  Q E. .      D                  
    41   89 L d  S  > S+     0   0   15  617   29  .C        P        P   C  PP P P    P  T C. .      P                  
    42   90 L S  T  4 S+     0   0   98  624   84  .A        A        S   S  AA T S    S  N S. .      T                  
    43   91 L L  T >4 S-     0   0  120  627   87  .L        N        N   I  NN N N    N  T N. .      N                  
    44   92 L D  G >4 S-     0   0  107  638   73  .Q        I        I   K  II I I    V  S G. .      I                  
    45   93 L N  G >< S-     0   0    8  700   56  .L        N        N   N  NN N N    N  V SQ .      N                  
    46   94 L G  G <  S-     0   0    0  882   52  ST        G        G   G  GG G G    G  N HS D      G                  
    47   95 L D  G <  S+     0   0   44  887   62  KN        G        G   R  GG G G    G  A DP P      G                  
    48   96 L e    <   -     0   0    0  892    0  CC        C        C   C  CC C C    C  C CC C      C                  
    49   97 L D  S    S-     0   0   59  892   74  ES        S        S   T  SS S S    S  R AD D      S                  
    50   98 L Q  S    S+     0   0    2  892   63  hQ        Q        Q   Q  QQ Q Q    Q  h Qt e      Q                  
    51   99 L F  E     -U   62   0I   4  892   80  tQ        I        M   F  II I I    I  y Hq e      I                  
    52  100 L d  E     +U   61   0I  10  893    1  CC        C        C   C  CC C C    C  C CC C      C                  
    53  101 L H  E     -U   60   0I  68  893   87  HV        D        D   K  DD D D    D  S LQ H      D                  
    54  102 L E  E     -U   59   0I  92  893   68  EN        N        N   F  NN N N    N  E NV A      N                  
    55  103 L E  S    S-     0   0  100  893   82  Rt        T        T   s  TT t T    T  P TE l      t                  
    56  104 L Q  S    S-     0   0  175  693   73  K.        P        P   d  PP . H    P  p AN g      .                  
    57  105 L N  S    S+     0   0  154  838   66  Ng        G        G   H  GG g G    G  g GG k      g                  
    58  106 L S  S    S-     0   0   58  853   65  RS        S        S   K  SS S S    S  A SS k      S                  
    59  107 L V  E     -U   54   0I   7  890   79  YF        Y        Y   V  YY Y Y    Y  V YA F      Y                  
    60  108 L V  E     -U   53   0I  45  891   88  VT        R        H   V  RR H H    R  A HV V      H                  
    61  109 L e  E     +U   52   0I   5  893    1  CC        C        C   C  CC C C    C  C CC C      C                  
    62  110 L S  E     -U   51   0I  24  893   75  AT        S        S   S  SS S S    S  G EV N      S                  
    63  111 L f        -     0   0   23  893    0  CC        C        C   C  CC C C    C  C CC C      C                  
    64  112 L A    >   -     0   0    8  893   75  VR        K        K   T  KK K K    K  A WQ A      K                  
    65  113 L R  T 3  S+     0   0  149  893   80  PD        S        S   E  SS S S    S  D DA T      S                  
    66  114 L G  T 3  S+     0   0   24  893    8  GG        G        G   G  GG G G    G  G GG G      G                  
    67  115 L Y  E <   -V   78   0J  20  893   11  YF        F        F   Y  FF F F    F  Y YY W      F                  
    68  116 L T  E     -V   77   0J  72  891   85  GT        F        V   Q  FF V V    F  E ST T      V                  
    69  117 L L  E     -V   76   0J  67  888   64  GL        M        M   L  MM M M    M  L LG G      M                  
    70  118 L A    >   -     0   0   23  889   78  HA        L        L   A  LL L L    L  E SA M      L                  
    71  119 L D  T 3  S+     0   0  175  889   77  NA        L        L   E  LL A S    L  P GA Y      A                  
    72  120 L N  T 3  S-     0   0   92  694   44  .N        N        N   N  NN N N    N  D DC .      N                  
    73  121 L G  S <  S+     0   0   16  713   66  .G        K        K   Q  KK E K    K  G GE .      E                  
    74  122 L K  S    S+     0   0   71  687   76  .Q        K        K   K  KK K K    K  R KM .      K                  
    75  123 L A        -     0   0   22  685   66  .D        D        D   S  DD D D    D  S SD .      D                  
    76  124 L f  E     -V   69   0J  12  847    9  CC        C        C   C  CC C C    C  C CV C      C                  
    77  125 L I  E     -V   68   0J  78  846   80  QE        K        K   E  KK K K    K  S QD T      K                  
    78  126 L P  E     -V   67   0J  62  850   71  FP        D        D   P  DD D d    D  Q ID E      D                  
    79  127 L T  S    S+     0   0  103  652   80  L.        .        .   A  .. . d    .  T VC L      .                  
    80  128 L G  S    S-     0   0   32  788   69  l.        V        V   V  VV . e    V  A ES I      .                  
    81  129 L P  S    S+     0   0  116  601   75  pD        .        .   P  .. M e    .  T .P .      M                  
    82  130 L Y  S    S+     0   0   59  794   86  HN        D        D   F  DD D N    D  F .D D      D                  
    83  131 L P    >   -     0   0   17  799   62  PP        E        E   P  EE E M    E  P .P L      E                  
    84  132 L g  T 3  S+     0   0   16  800    5  QC        C        C   C  CC C C    C  C .C C      C                  
    85  133 L G  T 3  S+     0   0    0  712   37  GS        S        S   G  SS S A    S  G .  T      S                  
    86  134 L K    <   -     0   0   69  588   68  Q         V        I   R  VV   Q    V  T K  H                         
    87  135 L Q        -     0   0   37  477   65  P         M        M   V  MM   L    M  N T                            
    88  136 L T        +     0   0    4  428   78  G         P        P   S  PP   C    P  G T                            
    89  137 L L        +     0   0  105  372   61  L                              V       S P                            
    90  138 L E              0   0  104  274   69  G                              N       E D                            
    91  139 L R              0   0  231  199   47                                         H K                            
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2    IIIVIIII  IIIIIII III II  I I IIII II I  I III II IIIIIIIIIIIIIIIIII
    94   17 C V  B     -A  271   0A   7  590    9    VIVVVVIV  VVVVVVA VVI VI  V V VVVV VV V  V VVIIVV IVVVIIIIVVVVVVIIVV
    95   18 C G  S    S+     0   0   25  591    6    GGGGGGGG  GGGGGGG GGG GG  G G GGGG GG G  G GGGVGG GGGGGGGGGGGGGGGGGG
    96   19 C G  S    S-     0   0   26  592    0    GGGGGGGG  GGGGGGG GGG GG  G G GGGG GG G  G GGGGGG GGGGGGGGGGGGGGGGGG
    97   20 C Q  E     -B  237   0B  98  593   95    EQSVYEME YYYYWHNY MYA YY  Y Y YYYY YQ N  F KYQGTV YHDDKKKKYYYSYHQRTY
    98   21 C E  E     -B  236   0B  80  594   67    DYEQTDED TEESVTNS NTT EE  T E TTEE TD Y  E ETEEDA EPADNNNNETTNEDKPET
    99   22 C h        -     0   0    8  594   58    AAAACAAS CCCCAASC SCC CC  C C CCCC CA A  C ACCQAT CIAASSSSCCCACVACAC
   100   23 C K    >   -     0   0  123  593   78    PSYVAEET QTTAKAKA KQA AE  P P EEQR GP D  T SGEAST RGDELLLLIRRAQSKRRS
   101   24 C D  T 3  S+     0   0   60  594   85    PQPQALVD ERRRPPFR KKK HP  E R NNAA KA A  P FAPGLI PIVIRRRRPEEDAIMIPR
   102   25 C G  T 3  S+     0   0    0  595   74    GGGGNGGA HHHSYNGS GDN HN  H R SSHN NG N  Y GNHQGQ HEKTGGGGHSNGHEGDGN
   103   26 C E  S <  S+     0   0   36  595   66    AMSSSEEE SSSASSSA ESS SS  S S LLSS AF E  S KTSAED SQEEGGGGSSSDSDNQAS
   104   27 C h    >   +     0   0    4  595   92    WFWWVYFW VQQAFIWA WVV QR  V V PPQQ VW W  E WVRIFL QAYYWWWWQVVAQYFRWV
   105   28 C P  T 3   +     0   0    0  599    9    PPPPPPPP PAAPPKPP PPP PP  P P YYPP PP P  P PPPPPP PPPPPPPPPPPPPPPPPP
   106   29 C W  T 3  S+     0   0    5  600   26    WWWWYHWW YHHYWYWY WYY WY  Y Y QQHH YW W  H WYYYYW WYWYWWWWWYYYHYWFWY
   107   30 C Q  E <   -J  122   0C   7  601   26    MQQQQQQV QQQQtIqQ QQI QM  Q Q VVQQ QQ q  Q qQMQqq QqIQqqqqQQQQTQQQQQ
   108   31 C A  E     -JK 121 146C   1  593   49    VVVAVIVV VVVVsVtV IVV VA  V V ..VV VV r  V tVAAka AvVIllllVVVVVV.VAV
   109   32 C L  E     -JK 120 145C   3  598   68    SSDSSSSS SSSSGSSS SSS SS  S S SSSS SS W  S SSSRFI FQMARRRRYSSSSAVAIS
   110   33 C L  E     -JK 119 144C   0  601    9    LLVLLLII LLLLLLFL LLL LL  L L LLLL LL F  L FLLLLL LVLLLLLLFLLLLLFILL
   111   34 C I  E     -JK 117 143C   0  601   81    QQRKNRQQ NNNNLQFN NNN NN  N N NNNN NQ I  N FNNQGR TKLLKKKKTNNQNLTIYN
   112   35 C N  E >   - K   0 142C  30  601   88    HnRLSFAK ASSSYSGS YAA IY  S A SSSS ST Y  V GSYYFN DsYSssssQASRSNNKYS
   113   36 C E  T 3  S+     0   0   63  117   78    .a...... .....TF. ... ..  . . .... .. .  . F..... .s..hhhh..........
   114   37 C E  T 3  S-     0   0  136  242   77    PQRN.QRN .....KS. ... ..  . . .... .. .  . S..S.. .SR.GGGGN....N.R..
   115   38 C N  S <  S+     0   0   84  565   53    EGGGGGNG GGGG.GSG KGG GG  G G GGGG GS H  G SGGASG .QGGDDDDGGGTGG.GNG
   116   39 C E        -     0   0  100  589   94    LGGRYRET SYYC.QTC NYY YY  Y Y KKYY YS F  Y TYYGFA NRAGGGGGLYYSYYIQGY
   117   40 C G  E     +J  111   0C  14  600   57    GSHHHHHH HHHHEHHH EHH HH  H H HHHH HH Q  H HHHSHQ RHFSRRRRVHHHHFHIKH
   118   41 C F  E     +     0   0C  28  611   33    hhIFFTFH IFFFSFRF fFF FF  F F FFFF FF N  F RFFiFI iIYlllllFFFFFIgLfF
   119   42 C i  E     -J  110   0C   0  612    1    ccCCCCCC CCCCCCCC cCC CC  C C CCCC CC C  C CCCcCC cCCcccccCCCCCCgCcC
   120   43 C G  E     -J  109   0C   1  612    1    GGGGGGGA GGGGGGGG GGG GG  G G GGGG GG G  G GGGGGG GGGGGGGGGGGGGGGGGG
   121   44 C G  E     -J  108   0C   0  612    9    GGAGGGGG GGGGGGGG GGG GG  G G GGGG GG G  G GGGGAG GGGGAAAAGGDGGGGGGG
   122   45 C T  E     -JL 107 130C   0  612   45    TSAQSSST SSSSSSAS SSS SV  S S SSSS SS T  S ASVSSI STSSTTTTSSSSSSASSS
   123   46 C I  E     + L   0 129C   0  612   23    LLLILIIL LLLLLLLL LLL LL  L L LLLL LL L  L VLLLIL LILILLLLLLLILILLLL
   124   47 C L        -     0   0    6  612   27    IFIIILIL IVVIIVLI III II  I I IIVV II I  I LIIIYV ILIILLLLIIIIVLLILI
   125   48 C S  S    S-     0   0   22  612   56    SNHASHNT TSSSsHNS TNN NN  N S NNNN SN H  N NNSSNA NSNSSSSSTNNANNGSSN
   126   49 C E  S    S+     0   0   99  612   63    ENRPDSKS DKKSsRES DNN DR  S S EEEA SN S  Q ESTEEP EADSSSSSPDDDEEDDNS
   127   50 C F  S    S+     0   0   42  612   83    DEQNQLWR QDDQDYLQ SQQ RQ  Q Q QQNN QQ C  N NQQTNR RDRKCCCCRQQNNYRQRQ
   128   51 C Y  E     - M   0 185C   7  612   34    WWWWWYWW WWWWTWWW WWW WW  W W WWWW WW W  W WWWYYV WKYYWWWWWWWYWFWWWW
   129   52 C I  E     -LM 123 184C   0  612   14    VVVIVIIV VVVVIVVV VVV IV  V V VVVV VV V  V IVVVAV AVIVVVVVIVVIVVIVVV
   130   53 C L  E     +LM 122 183C   0  612   27    VILVVLVV LVVLLLIL MVV VL  L V VVVV VL L  V AVLLIL VLVVLLLLIVVLVLLLVV
   131   54 C T  E     - M   0 182C   0  612   43    TTSTSTTT SSSSTTTS ASS SS  S S SSSS ST T  S TSSCTT STTTTTTTSSSTSTTSSS
   132   55 C A    >>  -     0   0    0  613    2    AAAAAAAA AAAAAAAA AAA AV  A A AAAA AA A  A AAVAAA AAAAAAAAAAAAAAAAAA
   133   56 C A  G >4 S+     0   0    0  613    9    AGAAAAAA AAAASAGA AAA AA  A A AAAA AA A  A GAAAGA AAAGAAAAAAAAAEAAAA
   134   57 C H  G >4 S+     0   0    7  613    0    HHHHHHHH HHHHHHHH HHH HH  H H HHHH HH H  H HHHHHH HHHHHHHHHHHHHHHHHH
   135   58 C i  G X4 S+     0   0    0  613    1    CCCCCCCC CCCCCCCC CCC CC  C C CCCC CC C  C CCCCCC CCCCCCCCCCCCCCTCCC
   136   59 C L  G << S+     0   0   31  613   66    FVFFYVFF YYYYVNVY FYY WW  Y Y YYYY YF F  Y VYWQVV NIVTFFFFYYYIYTLKFY
   137   60 C Y  G <  S+     0   0  109  613   87    NDQDKYSK HKKKRIEK DKQ QY  K K KKKK KP S  Q DKYGYT FELDKKKKRKNQKGYQGK
   138   61 C Q  S <  S+     0   0   95  613   78    dgsgSgsg LSSSvGdS sSA NN  S T SSSS SS q  S dSNsgl QEsgrrrrAYSgSHpPaS
   139   61AC A        -     0   0   16  373   75    wplp.ipp ....aAv. v.. PP  . . .... .R t  . t.Pwpl QGaattttP..a..nIa.
   140   62 C K  S    S-     0   0  172  387   77    RASS.DTS ....NES. S.. FY  . . .... .S T  . S.YNSA DTKSRRRRK..S.GASG.
   141   63 C R  S    S-     0   0  162  602   78    TMMQRLDQ QRRSAHQS YRS AA  R R RRRR RQ S  R QGSTGT RKLSNNNNTRRSRNSSSR
   142   64 C F  E     -K  112   0C  36  609   54    LWYWIFLF LIIIIMII YII QM  I I MMVV IL Y  I IIMWLL LYYLYYYYLIILVLLIWI
   143   65 C K  E     -K  111   0C  67  609   79    YRTRQTSS QEEQTMRQ TQQ IQ  Q Q QQEQ QC W  E RQQKNN SADSAAAAVQQTEKDPTQ
   144   66 C V  E     -KN 110 161C   0  609   16    AVFVVVVV VVVVVIMV VVV AI  V V VVVV VV I  V IVIIIV VVVIVVVIAVVTVVVIVV
   145   67 C R  E     -KN 109 160C  40  609   55    VRISRVVL HRRKAVRK YRR IM  R R RRRR QI R  R RRFVVR RRERRRRRHRRRRRFRYR
   146   68 C V  E     +KN 108 159C   1  610   43    VMLLLALL LLLLAAML LLL LL  L L LLLL LF L  L VLLLAT LAHAVVVVLLLYLVLMLL
   147   69 C G  S    S+     0   0    9  610   15    GGGGGGGG GGGGGGGG GGG GG  G G GGGG GA G  G GGGGGG GGGGGGGGGGGNGGGGGG
   148   70 C D        +     0   0   11  611   58    ELKSESSA EEEEVDEE AEE EE  E E EEEE KR D  E EEELES RSESDDDDDEETESHDLE
   149   71 C R  S    S+     0   0   24  611   73    HAYYNVNW HHHYFYFY YYH HH  Y H HHHH HC H  H YDHYLT HNMTYYYYNHHLHSTHHY
   150   72 C N  B >   -P  234   0D  18  611   65    TSHRNLDQ NHHNNIDN QNN HD  N N NNHD NM Q  D DNDQDT NNVYHHHHDNNRHFNSSN
   151   73 C T  T 3  S+     0   0   56  611   80    LLERILLL IIILIVFL LII IV  I L IIII LC T  I FIVAMH LHTHTTTTLIIHISVLRI
   152   74 C E  T 3  S-     0   0  119  611   84    SQFTDSSG DRRAKNSA SEA WR  D A EERY ET S  S SNRSSN VGRDLLLLTNNNGEEKSA
   153   75 C Q  S <  S-     0   0  130  610   85    DYATVQSN EVVAKTSA AVL NV  V V VVVR TY K  V SVVNVA TRAKVVVVKVVSQRETNV
   154   76 C E        +     0   0  165  610   85    qYTTLGSP INNQlFvQ LVS NF  E N LLSN Tv I  N vAFaNG AGIGPPPPELLGNGlKlS
   155   77 C E        -     0   0   93  469   27    nEDDE... EEEDeEeD DEE GE  E E EEEE Eq D  E eEEeE. E...EEEEEEE.E.lEsE
   156   78 C G  S    S+     0   0   46  578   34    ENASGG.G GGGGPGPG NGG GG  D G GGGG SD G  G RGGAGG NG.GEEEEGGGGNGGGSG
   157   79 C G  S    S+     0   0   47  585   75    qGTTDDSp ATTSHTyS SNT TT  S T NNTS Th T  T lNTGST TQ.TFFFFTNNLTTNTTG
   158   80 C E        -     0   0   37  472   30    gEEQE.Ls EEEE.EfE TEE EE  E E EEEE Qn E  E yEEVE. E...EEEEEEE.E..EVE
   159   81 C A  E     -N  146   0C  27  487   57    TQQQQ.EQ QQQQ.QVQ VQQ QK  V Q QQQQ QV Q  Q VQQQQ. Q...EEEEQQQ.Q..QVQ
   160   82 C V  E     -N  145   0C  71  590   83    TEVDFVIE FFFT.YET SFF YL  V L FFFF LS D  F EFLTTR RL.VEEEEHFFTF..CAF
   161   83 C H  E     -N  144   0C  14  599   76    QFFLIHKV VIII.ARI RII MM  R I IIII IQ F  I RIMFIV IV.VIIIIIVIVI.HVRI
   162   84 C E        -     0   0   90  602   78    PTRSDEGG DSSS.KGS GNN PK  S D DDTD NT K  D GSKNAA EN.DGGGGQDDKD.PNNN
   163   85 C V  E     -O  186   0C  27  607   64    IVSVAIII ASSS.PVS VAS VT  S G AASS SV I  S IATVVV AV.VVVVVVSAAS.ISVA
   164   86 C E  E    S+     0   0C  70  608   73    GTAVAATA ASSS.HNS KAA DD  S A EESS AT Q  S TSDNSS ELVEQQQQEAASS.RASA
   165   87 C V  E     -O  185   0C  13  609   72    NKVRKKSW KSSKRRKK KKK AT  V K KKRR KT R  R KKTAKS KDKAQQQQNKNRR.RKRK
   166   88 C V  E     -O  184   0C  72  610   46    LVIIIIIV MVVVVVKV IIV II  I M IIVV VV L  V KSIQIR MYLIIIIIIIIIVIVAVI
   167   89 C I  E     +O  183   0C  27  610   43    QIIIITVQ IIIITVII III YI  V I IIII II I  I VIITII IRYTVVVVYIVIILSFII
   168   90 C K  E     -O  182   0C  68  610   82    EMKMRYLS PRRRSTVR KRR WW  R R LLRR RV R  R VVWPLL PVGVIIIIKRKGRNVVVR
   169   91 C H    >   -     0   0   19  611   13    NHHHHHHH HHHHKHHH NHH HH  H H HHNH HH H  H HHHNHH FHHHHHHHHHHHHVHHHH
   170   92 C N  T 3  S+     0   0  156  611   61    LPHEPKKP PPPSvPPS PPP QP  P P PPPP SP T  P PPPSEA PPEPRRRRFPPEPkPPEP
   171   93 C R  T 3  S+     0   0  150  608   73    QSDSKKDV DNNGaLKG NNS SS  K Q NNNN GN F  Q KSNDNQ KEREEEEESNKKQiDNRR
   172   94 C F    <   -     0   0   24  611    5    AYYYYYFY YYYYYYYY FYY YY  Y Y YYYY YY N  Y YYYYLY YFFYYYYYYYFYYYYYYY
   173   95 C T     >  -     0   0   56  611   68    atDDNIQs NSSNVNNN LNN ND  S N NNNN SN V  D NNDDDq NSSNRRRRKNKDStrdNN
   174   96 C K  T  4 S+     0   0  145  561   78    gaWRSARk S..SSRFS .SS YY  S S SSAS PS .  S FSYS.c D.LAPPPPDSKSSddsTA
   175   97 C E  T  4 S+     0   0  174  569   91    SMRIWAPE W..NDSFN .AR QQ  L Y PPYW YE D  W FNQA.E R.DNDDDDNWKNYNEHTN
   176   98 C T  T  4 S-     0   0   44  598   57    TGTRTFTG TSSTNTTT .TT TT  T N NNTN TT S  N TTTT.T PDTTSSSSGTTTNSSDST
   177   99 C Y    ><  +     0   0   60  604   65    WFSILKMS FYYLFNYL YIT LL  L L LLII LS N  I FLLTYC HYFVSSSSLLLIIYYSHI
   178  100 C D  T 3   +     0   0   25  609   37    GpDNDGNR DnnNDNEN eDD DD  N D NNDD DD D  D ENDDds NyNDDDDDDDDDDAndDD
   179  101 C F  T 3  S+     0   0   21  595   66    KnNNNYNA NnnNdAYN gNN YF  N N NNNN NN N  N YNYNny NnNNYYYYHNNNNYgnYN
   180  102 C D    <   +     0   0    1  609    0    DDDDDDDD DDDDdDDD DDD DD  D D DDDD DD D  D DDDDDD DDDDDDDDDDDDDDDdDD
   181  103 C I        +     0   0    0  611   13    IVIVIVII IIIIIILI III II  I I IIIV II I  I LIIVII IVIIIIIIIIIIVVIIVI
   182  104 C A  E     -MO 131 168C   0  611   60    AAAALAAA MMMMAMAM AMM MM  M M MMMM MA A  M AMMMSA MAASAAAAMMMAMPAMAM
   183  105 C V  E     -MO 130 167C   0  612   16    LLLLLILL LLLLVLLL LLL LM  L L LLLL LL L  L LLLLLV LMLILLLLLLLLLVLLLL
   184  106 C L  E     -MO 129 166C   0  613   30    LMIMILLV IIIILIVI MII MI  I I IIII IL I  I VIILLL ILVLVVVVVIIIILLLMI
   185  107 C R  E     -MO 128 165C  40  613   43    RKKKKKLR KKKKRKRK EKK KK  K K KKKK KQ E  Q RKKRKH KRKERRRRKKKQKKEKEK
   186  108 C L  E     - O   0 163C   0  613   16    LLLLLLLL LLLLLLLL LLL LL  L L LLLL LL L  L LLLLLL LLLLLLLLLLLTLLLLLL
   187  109 C K  S    S+     0   0  101  613   69    ANSSSKDE KSSSKRES ESA AF  A S KKSS AS K  S EKFDAA KEQAQQQQTASASSEQSS
   188  110 C T  S    S-     0   0   82  614   74    ARTGSTSH LKKKVAEK TSS HH  S R TTKR TS R  R TSHETA QRQEGGGGESSSTENKGS
   189  111 C P        -     0   0   48  614   39    PPPNPPPS PPPAEPPA PAP PP  A P PPPP PP i  P PAPSPN PHPEppppPPPkPKSPGP
   190  112 C I        -     0   0    4  562   63    AAAAAIIV AAAA.MIA VAA A.  V A AAAA AV a  A LAVALA AL.LaaaaAVVgAIVVVA
   191  113 C T        -     0   0   95  566   73    TTTQVTTR TTTT.VTT TTS I.  E T VVIT TN I  T SSETTN TF.QRRRRQTTTTETHST
   192  114 C F        +     0   0   56  612   34    IVLYLFFF LLLLILFL FIL LV  Y L LLLL LF I  L FLVLFI LFVFFFFFYLLTLFLFFL
   193  115 C R  B >   -Q  196   0E  52  613   63    NSTNNDSS NNNNqNQN TNN Ne  S N NNNN NT N  N ANTTNS NSeGSSSSNNNNNGGTTN
   194  116 C M  T 3  S+     0   0   29  594   77    RNPNSEGE SQQSeKPS PSS Da  A S SSQS KN E  S PSESN. R.gDSSSSQAA.QKPEDS
   195  117 C N  T 3  S+     0   0   13  602   90    RYYYRTLR KYYYYYNY YRY FA  D D RRYY AY V  Y HRASNP Y.SGHHHHYRR.YGNHYR
   196  118 C V  B <   +Q  193   0E   0  604   27    VVVVVKKI VVVVIVIV IVV VV  V V VVVV VI V  V IVVVVA V.FIVVVVVVVAVILVVV
   197  119 C A        -     0   0    1  606   80    ANQSSQEL SQQNSSAN LSK KA  Q Q GGQQ QT K  Q SAAAAA KRIKLLLLQAAQQGLQQS
   198  120 C P        -     0   0    8  608   54    PNPPTPPP TTTTPLPT PTA PP  P T TTPP TP P  A PSPLPT PSPAPPPPPSTAPPPPPA
   199  121 C A        -     0   0    2  609   39    LIVILIIV VVVVVAIV VIV VI  I V IIVV IV A  V IIIVII IVIIAAAAIVVIVVIVVI
   200  122 C g  B     -c  290   0B   1  610   66    CCCCAACC SAAPCPCP CSS AS  A S SSAA PC C  A CSSSAA PACDCCCCPPAKAKCACA
   201  123 C L        -     0   0   27  612    5    LLLLLLML LLLLLLLL LLL LL  L L LLLL LL L  L LLLLLL LLLLLLLLVLMLLLLLLL
   202  124 C P        -     0   0    7  613   30    PPPPPPPP PPPPPPPP PPP PP  P P PPPP PS P  P PPPPPW PIPPPPPPAPPPPPPPPP
   203  124AC E     >  -     0   0   92  612   75    DDQTSKRD QTTTKRAT SRS TT  S S KKTT TA T  R ATTTAD NGVSFFFLRSSESSDKAK
   204  125 C R  H  > S+     0   0  109  612   78    SRAKAEKA SEESQQMS QSS AW  A R TTSS ST S  S SSGQQD KMASWWWWSSSQRKNRPS
   205  126 C D  H  > S+     0   0  124  612   85    DDDDCDPS CCCCNGDC ECC CC  C C CCCC CN P  C DCCSGN CAGSRRRRCCCGCGDCFC
   206  127 C W  H  >>S+     0   0    4  612   88    LAPVATSV PAAVQTEV VAA AP  A P AAAA VS N  A EAPTHT PYRSEEEEPAASASTPQP
   207  128 C A  I  X>S+     0   0    0  612   75    SSKPPMPR SAATKGST QAA AI  K E PPPP AT Q  P LSMSTA SSSLRRRRRPLDSIFPRA
   208  129 C E  I  <5S+     0   0   75  613   82    LVAAAGSL ADDALVLA LTA PG  A A AAAA TF F  A LAGTAF AEFPPPPPEAAPAPYPFA
   209  130 C S  I  <5S+     0   0   70  614   66    PGGGGGVS GGGGPVIG AGG GG  G D GGGG GY P  G IGGSTA GYASQQQQGGGKGPdNPG
   210  131 C T  I  <5S+     0   0   18  108   73    ........ .....E.. ... ..  . . .... .. .  . ...... ..............g...
   211  131AC L  I ><  S-     0   0  119  503   80    VsT.sTEG f..srlSs gsa ..  s a SS.. SG q  . Sn.s.s RLAt.....sss.q.ss.
   227  146 C E  T 3  S+     0   0   47  527   75    EQQGSPDV G..SEGES ISS ..  N N FF.. SV S  . EP.S.E TYSE.....NSG.G.PD.
   228  147 C K  T 3  S+     0   0  169  548   68    PYGSGFKP F..GSGGG PGG ..  G G GG.. GS S  . GR.G.G ADEG.....GGA.D.EGG
   229  149 C G  S <  S-     0   0   29  559   66    TSTGVGTL E..SGGGS LTS ..  Y D AA.. SL T  . GA.G.G DSWG.....VVS.G.GGQ
   230  150 C R        -     0   0  213  584   86    GPGLNQSP SDALKQTL SNN FN  N N EET. NP P  . TSNT.A GSSN....KNNS.E.FDN
   231  151 C Q  B     -R  224   0F  79  599   93    PLGLYIMH PDDYPALY NYY NL  Y F YYDS YA Y  . LYMI.G ILLVYYYYFNNLST.FLY
   232  152 C S        -     0   0   14  607   51    SSDSPPKP SGGPSPPP PPP PP  P P PPGG PP T  . PPPSPS ASSSSSSSPPPPGAAPPP
   233  153 C T  S    S+     0   0   48  608   73    DADTEDTQ SDDDSFSD KDN FT  E D DDND DQ R  . SDTDDV SDQPRRRRDDDTDDHDND
   234  154 C R  B    S-P  150   0D 102  608   85    VTVYLHDT VKKVKTMV TLL NR  L R VVKQ QT L  . VVRYVT TRGNTTTTILLKKVDVVV
   235  155 C L        -     0   0    3  610    3    LLLLLLLL LLLLLLLL LLL LL  L L LLLL LL L  . LLLLLL LLLLLLLLLLLLLLLLLL
   236  156 C K  E     -BD  98 221B  31  610   51    QKKMQQMQ QQQQRRQQ QQQ QQ  Q Q QQQQ QQ K  . QQQMQR QQQQQQQQQQQQQQRQQQ
   237  157 C M  E     -BD  97 220B  18  611   94    EWQQCKKK CCCCQTQC MCC CC  C C CCCC CE E  . ECCKKR CGKYQQQQCCCKCAFCEC
   238  158 C L  E     - D   0 219B   4  612   44    ATVALMVL LLLLVVVL ALL VL  L L LLLL LV A  . VLLVVV LVAVAAAAVVLVLVVGAL
   239  159 C E  E     - D   0 218B 107  612   72    EYLRDMPE DNNNGTTN EKN DD  K R NNDE NQ T  . SKDETD KSIEAAAADDDTQERLAK
   240  160 C V  E     - D   0 217B   0  612   46    VALVAGMV ALLAIVVA VAA VV  A Q AALI AV V  . VAVVIV LIVVIIIIVAAVIVLVVA
   241  161 C P  E     - D   0 216B  34  612   28    PPPPPITP PPPPPPPP GPP PP  P P PPPP PP A  . PPPNPP PPPPPPPPPPPPPPPYAP
   242  162 C Y  E     -F  263   0B  36  613   46    IILILSII VIIVIIIV III II  I I LLII VI L  . IIIVLV VLIVLLLLVVLIIIVTII
   243  163 C V  E     -F  262   0B  24  614   37    VLVMLYMI LLLLLVVL ILL LL  L I LLLL LV I  M VLVVVI LVIVLLLLLLLVLVAILL
   244  164 C D     >  -     0   0   88  613   57    GDKESEDD SSSSRSSS SST SD  S D SSSS SG S  S SSDDSG SSSSPPPPSPPDSNNSSS
   245  165 C R  H  > S+     0   0   51  613   78    TPTWQSWS DHHSNTNS SDT HE  D D DDDT AN R  S NDDQDN EHNKKKKKDQQRDLPNHD
   246  166 C N  H  > S+     0   0  105  614   74    AGSNAREE SAASSADS STA KQ  Q R AASR AR T  T DSEDAV KEMSRRRRSAAKRKQECS
   247  167 C S  H  > S+     0   0   48  614   78    RYKKEIKI VDDQNRKQ SAQ ED  E I QQDD EQ D  A RSDEEQ VQQQFFFFSDDTDDAEVV
   248  168 C j  H  X S+     0   0    1  614    2    CCCCCCCC CCCCCCCC CCC CC  C C CCCC CC C  N CCCCCC CCCCCCCCCCCCCCCCLC
   249  169 C K  H >< S+     0   0   88  614   73    DsnnEqSs HDDSPnkS eRS DE  Q K TTQE Sk a  e kKEGrR KsrsEEEEKEEnDQeAPR
   250  170 C L  H 3< S+     0   0  150  574   89    EisqAv.g KNNR.maS sKS GN  E N SSNN Ds s  x aSN.dN TysyEEEEAAAgNEkK.N
   251  171 C S  H 3< S+     0   0   23  604   76    LWMYSSKA ASSA.SGA TAA SA  A A SSSS AY V  S GAANYV AAYSRRRRSSSASANLGA
   252  172 C S    <<  -     0   0   20  607   83    LGHMYRAG YYYY.FRY GYY YY  Y Y YYYY YG Y  Y RYYRGY YERGYYYYYYYVYYRYAY
   253  173 C S  S    S+     0   0   79  607   83    PSDNPQFQ PPPP.NHP GPP PP  P S PPPP PA G  P HPPYAG GFAFKKKKLPPGPGMPGP
   254  174 C F  S    S-     0   0  124  607   79    FEGGGNPG LGGGFGEG TGG GG  G N GGGG GS S  G EGGGDS SNSNGGGGGGGAGGDKAG
   255  175 C I        -     0   0  100  608   87    DMSAEDKA QMMRINYR FKQ MM  D L QQMM QS S  M FQMSEI INRERRRRMDKEMDVGYQ
   256  176 C I        -     0   0   13  609   18    IVIIIILI IIIIDIII III II  I F IIII II L  I IIILII IVIIFFFFIIIIIVFISI
   257  177 C T    >   -     0   0   16  614   35    TGTTTTTT TTTTATPT QTT TT  T T TTST TT T  T PTTTFT TTTTTTTTTTTTTDSTAS
   258  178 C Q  T 3  S+     0   0  133  614   68    TSEDSEKE SQQSDADS ETN DR  S E EEDD ND N  D ESRGDT REDAGGGGENNDDEQKDS
   259  179 C N  T 3  S+     0   0   24  614   60    QINKNTND NSSNDNIN DNN RR  N N NNAA NN N  S INRGSR NSNSRRRRNNNNASNNPN
   260  180 C M  E <   - G   0 311B   2  614   13    VMMMMMMM MMMMMMFM MMM MM  M M MMMM MM M  M FMMMMT MMMMMMMMMMMMMMMMRM
   261  181 C F  E     - G   0 310B   8  613   35    .VLIVLLL FFFIFIMI VIF VM  I V VVFF MV F  F LFVMII FFLFLLLLFIIFFIFLLM
   262  182 C j  E     +FG 243 309B   1  614    1    CCCCCCCC CCCCCCCC CCC CC  C C CCCC CC C  C CCCCCC CCCCCCCCCCCCCCCCSC
   263  183 C A  E     +FG 242 308B   0  614   26    AAAAAAAA LAAIAAAI ALA AA  V S AAAA VA A  A AAALAA AAAAAAAAAVVAAAAAVL
   264  184 C G  S    S-     0   0    3  614   10    GGGGGFGG GGGGGGGG GGG GG  G G GGGG GG G  G GGGAGG GGGGGGGGGGGGGgGGGG
   265  185 C Y        -     0   0   56  591   57    RYYYFRYY FYYY.YFY YFF YY  F F FFYY FL Y  Y YYYAVL FQYENNNNFFFIYyH.DY
   266  185AC D  S    S-     0   0   81  594   83    DDQDLKEL LLLL.REL QLL LL  L M LLLL ML M  L ELMSPA IVTELLLLLLLLLLP.DM
   267  185BC T  S    S+     0   0   76  614   61    EHEQELNE EEENdTEN EEE ED  E A EEEE EA R  E TEDGEQ ReEEhhhhEEEnEDSamE
   268  186 C K  S    S-     0   0  107  563   32    GGGGG.EG GGGGgGGG GGG GG  G G GGGG GG G  G GGG.GG GgGGkkkkGGGgGGLgaG
   269  187 C Q  S    S+     0   0  102  569   37    GQQGGGSQ GGGGGGGG QGG GG  G G GGGG GG G  G GGG.GG GGGGRRRRGGGGGGKGVG
   270  188 C E        +     0   0   33  613   55    IDQKKIFR KKKKKKRK IKK KR  K A KKKK KK V  K QKRKKR KKRKVVVVKKKKKKQTSK
   271  189 C D  B     -A   94   0A   7  614    4    DDDDDGDD DDDDDDDD DDD DD  D S DDDD DD D  D DDDDDD DDDDDDDDDDDDDDDDSD
   272  190 C A        -     0   0    7  614   42    AATASVAA SSSSSASS ASS AA  S S SSSS SS T  S SSASSS SSAGSSSSSSSASSASVS
   273  191 C k    >   -     0   0    7  614    3    CCCCCCCC CCCCCCCC CCC CC  C C CCCC CC C  C CCCCCC CCCCCCCCCCCCCCCCPC
   274  192 C Q  T 3  S+     0   0   90  614   25    QNDQQMQL QQQQQKQQ QQQ QN  Q Q QQQQ QQ Q  Q QQNQQQ QQQQQQQQQQQQQQQQQQ
   275  193 C G  T 3  S+     0   0    6  614    8    GGGAGGGG YGGGGGGG GGG GG  G G NNGG GG G  G GGGGGG GGGGGGGGVGGGGGGGGG
   276  194 C D    X   +     0   0    0  614    0    DDDsDDDD DDDDDDDD DDD DD  D D DDDD DD D  D DDDDDD DDDDDDDDDDDDDDDDDD
   277  195 C S  T 3  S+     0   0   14  614    1    SSSsSSSS SSSSSSSS SSS SS  S S SSSS SS S  S SSSSSS SSSSSSSSSSSSSSSSSS
   278  196 C G  T 3  S+     0   0    0  614    0    GGGGGGGG GGGSGGGS GGG GG  G G GGGG GG G  G GGGGGG GGGGGGGGGGDGGGGGGG
   279  197 C G    <   -     0   0    0  614    1    GGGGGGGG GGGGGGGG GGG GS  G G GGGG GG G  G GGSGGG GGGGGGGGGGGGGGGGGG
   280  198 C P  E     - H   0 294B   1  614    2    PPPPPPPP PPPPPPPP PPP PP  P P PPPP PP P  P PPPPPP PPPPPPPPPPPPPPVPPP
   281  199 C H  E     -EH 219 293B   0  614   49    LFLLVLLL VVVVLLLV LVV ML  V L VVVV VL L  V LVLALY VVLFLLLLMVVVVLFLMV
   282  200 C V  E     -EH 218 291B   3  614   26    MIVVAIVM VVVVVVQV VVV VV  A V VVVV VV L  V QVVVAV VVNAMMMMVVVAVVAVVV
   283  201 C T  E     - H   0 290B   0  614   66    CCYCCVCC CCCCCCIC CCC CC  C C CCCC CI C  C VCCCAI CMVACCCCCCCACIVCCC
   284  202 C R  E     + H   0 289B  99  614   70    EPPKNRNQ NNNNKWRN NNN ND  N N NNNN NK Q  N RSVNSQ KNGDEEEENNNNNNRRQN
   285  203 C F  E >  S- H   0 288B  22  614   71    asdYGEtV GGGGLGgG VGG GG  G G GGGG GQ a  G gGGGDN GGDGrrrrGGGGGGdEdG
   286  204 C K  T 3  S-     0   0   85  222   71    dgdS.PdE ....N.d. N.. ..  . . .... .N n  . d...T. ..S.gggg......t.n.
   287  205 C D  T 3  S+     0   0  108  223   55    GSQG.DKD ....G.G. N.. ..  . . .... .N G  . G...G. ..N.EEEE......D.S.
   288  206 C T  E <   - H   0 285B   3  233   75    HRTK.GIT ....T.K. V.. ..  . . .... .R R  . R...S. ..F.SSSS......R.R.
   289  207 C Y  E     - H   0 284B  21  242   51    WWWW.PWW ....Y.Y. W.. ..  . . .... .W Y  . Y...T. ..R.WWWW......W.W.
   290  208 C F  E     -cH 200 283B   0  613   91    FERTQVYL QVVQVRFQ LEQ EE  E Q EEEQ EI Y  E FKEVYR QYEVAAAVEEQVEVVEFE
   291  209 C V  E     + H   0 282B   1  613   38    LLLLLVQL VLLLQVLL QLL LV  L L LLLL LQ V  L LLVQLL LLLLVVVVLLLLLQALLL
   292  210 C T  E     +     0   0B   1  613   84    YNADQVVA QQQQMYGQ FQQ QH  Q Q QQQQ QA W  Q AQHYAA KVVIYYYYFQQVQYTQSQ
   293  211 C G  E     -IH 312 281B   0  613    0    GGGGGGGG GGGGGGGG GGG GG  G G GGGG GG G  G GGGGGG GGGGGGGGGGGGGGGGGG
   294  212 C I  E     -IH 311 280B   0  613   19    VILIIVII VVVIIVII IVI IL  I V IIVV IV I  I IILIII VVIIVVVVVIIAVIIIIV
   295  213 C V  E     +I  310   0B   7  613   14    TVTVVVII VVVVVVIV VVV VV  V V VVVV VV V  V IVVVVV VVVTTTTTVVVVVVVVTV
   296  214 C S  E     -     0   0B   1  612    0    SSSSSSSS SSSSSSSS SSS SS  S S SSSS SS S  S SSSSSS SSSSSSSSSSSSSSSSSS
   297  215 C W  E     -I  309   0B  45  613    7    FWWWWFWW WWWWFWWW WWW WW  W W WWWW WF W  W WWWWWF FWWWWWWWWWWWWWWWWW
   298  216 C G        -     0   0   26  613    0    GggGGGGG GGGGGGGG GGG GG  G G GGGG GG G  G GGGGGG GGGGGGGGGGGGGGGgGG
   299  217 C E  S    S-     0   0   25  609   90    RqvRY.KE VYYTDNIF YYI QR  I Y YYYY LE N  Y IYQAYA NYENYYYHRYYYYY.qEA
   300  218 C G  S    S-     0   0   19  612   13    GPPDGISG GGGGGGGG GGG GG  G D GGGG GG G  G GGGGGG GGGGGGGGGGGGGG.VSG
   301  220 C k  S    S-     0   0    7  613    2    CCCCCPCC CCCCCCCC CCC CC  C C CCCC CC C  C CCCCCC CCCCCCCCCCCCCCICCC
   302  221 C A  S    S+     0   0    4  612   16    AGAAACGA AAAAAGAA AAA AA  A A AAAA AA A  A AAAAAA AAAAGGGGAAAAAAGGAA
   303  222 C R    >   -     0   0  105  611   73    RAALQGQE LEEQRDEQ EQQ QQ  L M QQQE QL K  E EQQSRR KERRVVVVLQQQELCQRQ
   304  223 C K  T 3  S+     0   0  152  611   64    PQSAKTKR ERRKKAAK PKR PP  K Q KKRR EP P  R AKPVAA PPPAKKKKSPKARPSRAK
   305  223AC G  T 3  S+     0   0   26  613   58    MYMYNGND GDDGDKNG NNN NN  G G NNDD GN R  N NNNLGG KKNGDDDDDDDKDGRGNG
   306  224 C K    <   -     0   0   43  613   85    SKRKRVMR KHHYHFLY KRY YY  Y H KKHH YF A  H LKYSYL YYYYSSSSAANYHYGKKK
   307  225 C Y        -     0   0   33  613   50    PPPPPPPP PPPPPPPP PPP PP  P P PPPP PP P  P PPPPPP PPPPPPPPPPPPPPYPPP
   308  226 C G  E     -G  263   0B   4  611    2    GSGGGDGG GGGGGGGG GGG GG  G S GGGG GG G  G GGGGGG GGGGGGGGGGGGGGGGGG
   309  227 C I  E     -GI 262 297B   6  612   11    AAVIVVIV IVVVIVVV VVV VV  V V VVVV VV V  V VVVVVV VVVVVVVVVVVVVVFVVV
   310  228 C Y  E     -GI 261 295B   1  612    1    YYYYYYYY YYYYYYCY YYY YY  Y Y YYYY YY Y  Y CYYYYY YYYYYYYYYYYYYYYYYS
   311  229 C T  E     -GI 260 294B   2  612   39    VTTTTATI TAATTTTT TTA TV  T A TTAA TT T  T TTVTTA ASTSTTTTATTTAGTTGP
   312  230 C K  E >   - I   0 293B  21  612   42    NRRRKRLS KKKKKARK KKK KK  K R RRKK KR V  K RKKRES EKRSKKKKKKKRKSKRRK
   313  231 C V  G >  S+     0   0    1  611    8    VVVVVVLL VVVVVVIV VVV VL  V V VVVV VV V  V IVVVVI VVVPVVVVVVVVVVVVVV
   314  232 C T  G 3  S+     0   0    2  609   71    PTTTCYEA CCCCPSSC QCC CC  C C CCCC CS A  C SCCASP CYTASSSSCCCGCLLCTC
   315  233 C A  G <  S+     0   0   29  609   79    TARQNHNA NVVNHKKN YNN SE  N R NNII NQ N  I KNEVYG RSRYAAAANNNNIANQKK
   316  234 C F  S <> S+     0   0    7  605   35    MFYFYFYH YLLYYFFY YYY LF  Y Y YYFF YY Y  F FYFFHY YFYFFFFFYYYYFAYFFY
   317  235 C L  H  > S+     0   0   23  603   80    TKLVVLNR LSSVVRTV QVN LL  V N VVNT VQ V  N VVLRVR TRLRVVVVLVVITKVTLV
   318  236 C K  H  > S+     0   0  116  602   68    QSQSDDLS NGGSKRSS DKS PY  D S DDED ST E  D PSYTDA RENDPPPPDDDSDDDSES
   319  237 C W  H  > S+     0   0   26  602    1    WWWWWWWW WWWWWWWW WWW WW  W W WWWW WW W  W WWWWWW WWWFWWWWWWWWWFWWWW
   320  238 C I  H  X S+     0   0    1  599   12    IIIIIIIV IVVIIIII LII II  I I IILL II I  I IIIIII IIIIIIIIMIIILIIIII
   321  239 C D  H  < S+     0   0   66  570   71    LQQNQH   NRRK DLK KQQ NE  Q S EEEE QN S  Q LKEDKR KQKQKKKKQQQKQDKHRQ
   322  240 C R  H >< S+     0   0  136  556   71    QQENQK   QDDT QET TES DD  E T AANS ST R  Q KQDDAQ SSSQSSSSDNN SQKS Q
   323  241 C S  H >< S+     0   0    6  523   72    NTKKTN   TTTT TNT KTT IV  T T TTTT TQ N  T NTTNNN TLN VVVVITT TFET T
   324  242 C M  T 3< S+     0   0   25  479   41    IIMMIT   IMMM IVM VII LM  I M IIMM II    M VILM   ILT TTTTIII MVMM I
   325  243 C K  T <  S+     0   0  153  444   70    GQAAAD   AAAS  TS PAA SA  A R AAAA AS    A TAA    A R KKKKEAA A EK A
   326  244 C T    <         0   0   51  390   65    DSASAN   ENNS   S  AA SA  A N QQSN SS    S  SA    S D     NDA S EN A
   327  245 C R              0   0  197  273   47    SN NN    N  N   N  NN  N    N NN N HN       NN    N       NNN N E  N
## ALIGNMENTS  981 - 1050
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....9....:....0....:....1....:....2....:....3....:....4....:....5
     1   49 L Q              0   0  101  671   35       Q K QQQH E DE  E EQE    E  DHEDE    E E     EEEEEEE QQ  E QQ  E  
     2   50 L a    >   +     0   0   22  858    0       CCCCCCCC C CC  CCCCC    C  CCCCC   CC C  C CCCCCCCC CCC CCCC  CCC
     3   51 L E  T 3  S+     0   0  187  858   80       VLAVDSSD N SN  KSANL    W  EENAS   TS L  K DEMAAEEE SSD EQDD  ANA
     4   52 L T  T 3  S-     0   0  105  864   61       NSSSSPPS K AS  SSSSS    S  ATTPT   PD S  N SKEESNKK PPS RTNN  SPV
     5   53 L S    <   +     0   0   89  868   72       SDSSNSSN N KN  SSSSN    G  EVNNA   EN N  N SNEGHDEE SSS QNNN  NSN
     6   54 L P        +     0   0   10  878   31       GPPPPPPP P PP  PPPPP    P  PDNPN   PP P  P PNKRPYAA PPP PPMM  PPN
     7   55 L b        -     0   0   18  893   21       CCCCCCCC C CC  CCCCC    C  CCGCG   CC C  C CGCACYDD CCC CCCC  CCG
     8   56 L Q  S    S+     0   0   92  892   83       QQQARNNR Q RR  KQQVQ    Q  QQGQG   LG Q  L QGNRQNCC NNK GQVV  QEG
     9   57 L N  S    S-     0   0   63  893   51       HNNNNPPN N NN  NNNHN    N  NNCNC   NE N  H HCFCNGAA AAN NNNN  NNC
    10   58 L Q  S    S-     0   0  152  893   57       RGGGRRRR G GN  GGGGG    G  GGEGD   NN G  G GSEAGGHH RRG GGGG  GGD
    11   59 L G        -     0   0   16  893   40       CGGGGggG G GG  GGATG    G  GGGGH   GG G  G GEEHGcGG ggG TGTT  GGR
    12   60 L K  E     -S   23   0G 117  852   79       VTTIHrrH V ST  TST.T    T  KTTQV   TD T  T RIARTd.. rrT .RCC  TTT
    13   61 L a  E     -S   22   0G  45  882   10       NCCCCCCC C CC  CCCCC    C  CCCCC   CC C  C CCRCCCCC CCC CCVV  CCC
    14   62 L K  E     -S   21   0G 155  890   81       TTHtTEEV K IV  VaNkN    V  TVTQT   aI N  q EIEVTIRR EEe KTDD  VVK
    15   63 L X  E     +S   20   0G 120  768   39       .EEl.DD. N DD  DkDkD    D  DDNDN   dN D  n S..NH.NN DDr NV..  EPD
    16   64 L G        -     0   0   44  862   73       .TRPEKKE E NG  GGGFR    G  EDNGT   GT R  G GN.TGNTT KKG TEKK  GET
    17   65 L L  S    S-     0   0  152  871   64       .LRALKKL H EI  IGVLL    V  VVDVL   SL L  T GL.LVILL KKL LRYY  VTA
    18   66 L G  S    S+     0   0   67  883   63       gDGGdGGd G RN  NGNGN    A  GNGNG   SG N  V Gk.GNpGG GGG GGQQ  NGT
    19   67 L E        -     0   0  119  837   61       sDEKgEEg G FG  RLN.D    Y  RGSSS   .S D  . Aa.SSnSS DDS SAAA  QDG
    20   68 L Y  E     -S   15   0G  37  883   11       YIYFYFFY Y YF  YYYYY    Y  YYFYF   YF Y  Y YY.FFYYY FFY YSYY  YYV
    21   69 L T  E     -S   14   0G  71  886   82       FTSSMLLT S TT  SGTTT    N  TSETQ   EE T  S LR.TSRAA LLD NVAA  KSR
    22   70 L b  E     -S   13   0G  20  889    0       CCCCCCCC C CC  CCCCC    C  CCCCC   CC C  C CC.CCCCC CCC CCCC  CCC
    23   71 L T  E     -S   12   0G  85  890   86       ETKTTHHT T AR  TTSIV    T  QNSTS   TK V  N VE.AQTVV HHI LLSS  TNS
    24   72 L c        -     0   0   44  890    0       CCCCCCCC C CC  CCCCC    C  CCCCC   CC C  C CC.CCCCC CCC CCCC  CCC
    25   73 L L    >   -     0   0   62  890   88       FSKPLFFL K PL  VAIDA    P  TAPPV   PH A  G PG.NPFNN FFP YPNN  PLP
    26   74 L E  T 3  S+     0   0  177  890   75       NTTPPTTP A AE  ASPER    E  PPVAT   AA R  Q EK.PADAA TTK PPHH  QGV
    27   75 L G  T 3  S+     0   0   29  893   20       GGGGGGGG G GG  GGGGG    G  GGGGG   GG G  G GGVGGGAA GGG GQGG  RGG
    28   76 L F  E <   +T   36   0H  40  893    9       YFYYFWWF F YY  FYFFF    F  FYYYF   YF F  F FRFFFFYY WWY FYYY  WFF
    29   77 L E  E     +T   35   0H  74  893   73       tYEQEAAE T TI  TTTKA    S  VEaSi   Sa A  T FveeKmee AAI qGEE  SEt
    30   78 L G  S >  S-     0   0   32  889    5       gGGGGGGG G GG  GGGGG    G  GGgGg   Gs G  G GgegGggg GGG nGGG  GGg
    31   79 L K  T 3  S+     0   0  156  891   73       RPSDSAAT K KA  KATKF    S  YDLDL   VV F  E YKKKLHKK AAA GKRR  SKK
    32   80 L N  T 3  S-     0   0   33  892   62       TTNRHRRH N NH  NNRQN    N  NHNDS   NV N  N HTTQTNHH RRK DTYY  HNT
    33   81 L c  S <  S+     0   0    1  892    3       CCCCCCCC C CC  CCCCC    C  CCCCC   CC C  C CCTCCCCC CCC CCCC  CCC
    34   82 L E        +     0   0   87  891   44       NAELEEEE E EE  EEEEE    E  EEDED   EE E  E EEEYELYY DDG IEDD  QSK
    35   83 L L  E    S-T   29   0H  96  889   88       NIINHRRH Q TV  TTTKI    E  LTDTD   ID I  I TDFRSERR KKK DSQQ  HMD
    36   84 L F  E     -T   28   0H 139  889   83       IDEDSDDS D ED  DANLN    N  NDINI   TI N  D AIwiATii DDD VGPP  QGI
    37   85 L T        -     0   0   44  677   75       NVP.LVVL V VV  ...II    V  VT..D   P. I  . ..qm..mm VVI .Kll  tL.
    38   86 L R        +     0   0   57  408   92       ...T.... . ..  .....    .  .....   .. .  . ..dv..vv ... ..aa  v..
    39   87 L K        +     0   0   96  535   81       .D.D.NN. . ..  .....    .  ..N..   .D .  . .AVD..NN DDD D.TT  N.D
    40   88 L L        -     0   0   91  608   90       EE.E.EE. . ..  .....    .  ..E.E   .E .  . .GTS..SS EEE EQNN  E.E
    41   89 L d  S  > S+     0   0   15  617   29       CC.C.CC. . ..  .....    .  ..C.C   .C .  . .CCC.CCC CCC CTCC  C.C
    42   90 L S  T  4 S+     0   0   98  624   84       LD.A.DD. . ..  .....    .  ..D.T   .A .  . .QNQ.AEE SSQ SNSS  E.L
    43   91 L L  T >4 S-     0   0  120  627   87       TV.V.RR. . ..  .....    .  ..T.V   .E .  . .HIE.VNN KKV TTLL  V.S
    44   92 L D  G >4 S-     0   0  107  638   73       NH.T.RR. . ..  .D...    .  ..E.G   .E .  . .NKD.NNN RRG QSDD  Y.N
    45   93 L N  G >< S-     0   0    8  700   56       NL.P.NN. . ..  III..    .  ..NDN   .N .  I SNNNQNNN NNN RVNN  R.N
    46   94 L G  G <  S-     0   0    0  882   52       GDGALGGL N QN  DDDDN    D  NDGDG   .G N  D DGGGSGGG GGG GNGG  M.G
    47   95 L D  G <  S+     0   0   44  887   62       GSKVTNNT E EY  EGDPE    E  EDGDG   .G E  D PGRGPGGG GGG LANN  D.G
    48   96 L e    <   -     0   0    0  892    0       CCCCCCCC C CC  CCCCC    C  CCCCC   CC C  C CCCCCCCC CCC CCCC  QCC
    49   97 L D  S    S-     0   0   59  892   74       DDAQAEEA N QD  AAADE    M  AVAAQ   TD E  L FSKSDDSS DDQ RRDD  GDD
    50   98 L Q  S    S+     0   0    2  892   63       QtsndHHd k ss  ggges    s  sgQpQ   pH s  s sHQHnRHH HHD nhHH  gsH
    51   99 L F  E     -U   62   0I   4  892   80       NvtqkLLk v tt  tttet    l  yiTqN   tF t  t yMFGqTHH EEV nyEE  liF
    52  100 L d  E     +U   61   0I  10  893    1       CCCCCCCC C CC  CCCCC    C  CCCCC   CC C  C CCCCCCCC CCC CCCC  CCC
    53  101 L H  E     -U   60   0I  68  893   87       NTHVHSSH K TV  KATLV    R  EVTQS   AE V  I LVKEQKQQ NNV RSTT  ANR
    54  102 L E  E     -U   59   0I  92  893   68       DNENENNE N KD  DDDTD    D  DDNDN   EN D  D AENHADHH NNN NEDD  HHN
    55  103 L E  S    S-     0   0  100  893   82       NMRVKTTR E RE  GGGlg    R  knngI   Ds g  E SttteTss ttt iPgg  eAT
    56  104 L Q  S    S-     0   0  175  693   73       EPRPdPPd H FQ  IIIg.    N  n...I   .. .  I N.dt.... ... .pdd  nPV
    57  105 L N  S    S+     0   0  154  838   66       GGGGgGGg G ND  NNNkn    N  .ngnG   gg n  N GdNGnass ggg ggll  pDG
    58  106 L S  S    S-     0   0   58  853   65       STESsSSs G GG  GGGkS    G  SSSSS   sS S  S SSK.SgGG SSG SATT  sGS
    59  107 L V  E     -U   54   0I   7  890   79       FFYYYYYY Y YF  FFFFY    Y  YYFYF   YH Y  F HYVPAVPP YYF FVRR  YYF
    60  108 L V  E     -U   53   0I  45  891   88       TNSQSKKS S ET  TTTVV    T  QSQTW   IV V  V SQVRARVV RRY LARR  RQE
    61  109 L e  E     +U   52   0I   5  893    1       CCCCCCCC C CC  CCCCC    C  CCCCC   CC C  C CCCCCCCC CCC CCCC  CCC
    62  110 L S  E     -U   51   0I  24  893   75       SSKSDSSD T SI  EKTKH    S  HNSTS   TT H  L TQSSVSSS SSE VGGG  SNS
    63  111 L f        -     0   0   23  893    0       CCCCCCCC C CC  CCCCC    C  CCCCC   CC C  C CCCCCCCC CCC CCCC  CCC
    64  112 L A    >   -     0   0    8  893   75       RTKAPKKP K AA  PPPAK    Q  AADAG   PR K  L KPTHQPNN HHA NAVV  PAQ
    65  113 L R  T 3  S+     0   0  149  893   80       SATPRLLK A PP  VAAEP    A  PPAAT   AA P  P VREDAVHH QQD DDNN  SDK
    66  114 L G  T 3  S+     0   0   24  893    8       GGGGGGGG G TG  GGGGP    G  GGGGG   GG P  S GGGGGGGG GGP GGGG  GGG
    67  115 L Y  E <   -V   78   0J  20  893   11       FYYFYYYY F YY  YYYWY    Y  FYYYY   YF Y  Y YLYYYFYY YYE YYYY  YFY
    68  116 L T  E     -V   77   0J  72  891   85       SEGTTSST T TT  SNTTT    L  GETST   SE T  G TSRVTTRR VVL EENN  KVK
    69  117 L L  E     -V   76   0J  67  888   64       LLDGGLLG G GG  GGGGG    G  GGLGL   GI G  G GLLLGLLL LLS LLLL  LGL
    70  118 L A    >   -     0   0   23  889   78       QDSRLTTL K AP  SSNKK    D  TDNDH   AS K  S KSASAQDD VVL TEQQ  LDL
    71  119 L D  T 3  S+     0   0  175  889   77       SVNNNDDN N NT  TTTYH    H  HHGDT   NR H  V DDESTPDD EEa LPDD  PYT
    72  120 L N  T 3  S-     0   0   92  694   44       ND.C.... . C.  CCC..    .  ..D.D   .N .  C .NND.DDD ..d DDDD  D.D
    73  121 L G  S <  S+     0   0   16  713   66       GG.E.RR. . E.  EEG..    .  ..G.G   .G .  E .NQG.GLL RRN GGSS  G.E
    74  122 L K  S    S+     0   0   71  687   76       RR.S.HH. . K.   TT..    .  ..F.L   .R .  K .LKK.KKK HHR RRRR  RYR
    75  123 L A        -     0   0   22  685   66       TT.P.RR. . G.   DD..    .  ..A.T   .S .  D .TSA.TTT MMH VSTT  SLT
    76  124 L f  E     -V   69   0J  12  847    9       CCCYCCCC C LC   IICC    C  CCCCC   CC C    CCCCCCCC CCC CCCC  CCC
    77  125 L I  E     -V   68   0J  78  846   80       QNEVEAAE E ND   DDTL    E  EEDEE   EF L    AQETEKAA DDI TSRR  EA 
    78  126 L P  E     -V   67   0J  62  850   71       SDIPKDDK Q DG   EEEE    V  DTDtD   IN E    KVPDTDDD DDA DQPP  DS 
    79  127 L T  S    S+     0   0  103  652   80       N..CR..R D CD   CCLK    D  E...V   T. K    ..A.G... ..E .TKK  .. 
    80  128 L G  S    S-     0   0   32  788   69       DV.SVVVV V SI   AAIL    V  lDV.D   pI L    E.V.IIVV VVg IAGG  V. 
    81  129 L P  S    S+     0   0  116  601   75       ..EP.... . S.   SSD.    .  dT.d.   p. .    LPPLP... ..t . ..  .. 
    82  130 L Y  S    S+     0   0   59  794   86       .DYSDDDD N ND   NSFI    A  FDDD.   EN I    FVFDNNDD DDL N ..  DN 
    83  131 L P    >   -     0   0   17  799   62       QEIPKEEK E PE   PP P    V   DEDE   PE P    PLPEDEEE EED E ..  EP 
    84  132 L g  T 3  S+     0   0   16  800    5       CCACCCCC C CC   CC C    C   CCCC   CC C    PCCCCCCC CCC C ..  CC 
    85  133 L G  T 3  S+     0   0    0  712   37        DE TRR  S  A      A    E    AA     T A    TKGEE GG DDR A EE     
    86  134 L K    <   -     0   0   69  588   68         N TEE  K         S    T    T        S    APR      NNK   TT     
    87  135 L Q        -     0   0   37  477   65         F LII            Q    G    L        Q    LSV      PPN   LL     
    88  136 L T        +     0   0    4  428   78         S PPP            P    T             P    KTS      GGD   DD     
    89  137 L L        +     0   0  105  372   61         L                C    G             C    MIV      VVM   LL     
    90  138 L E              0   0  104  274   69         E                Q    A             Q    EES            TT     
    91  139 L R              0   0  231  199   47                          R    R             R    R Q            NN     
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2  IIIII        I I  II     IIII II     III  I IV I        I   I    II   
    94   17 C V  B     -A  271   0A   7  590    9  VVVVV        V V  MV     VVIV VV     AVV  V VV V        I   V    II   
    95   18 C G  S    S+     0   0   25  591    6  GGGGG        D G  GG     GGGG GG     DNG  G GN N        G   G    GG   
    96   19 C G  S    S-     0   0   26  592    0  GGGGG        G G  GG     GGGG GG     GGG  G GG G        G   G    GG   
    97   20 C Q  E     -B  237   0B  98  593   95  YYYYY        S T  AR     VTVV HG     HEQ  T YL R        Q   Q    QQ   
    98   21 C E  E     -B  236   0B  80  594   67  TSTTE        N E  NE     EDEQ LD     PPE  A VE Q        E   A    VV   
    99   22 C h        -     0   0    8  594   58  CCCCC        A A  AA     ALIV VT     AAA  A AA C        V   A    VV   
   100   23 C K    >   -     0   0  123  593   78  AARPP        A P  EP     TASS PS     KVA  A DA D        T   A    PP   
   101   24 C D  T 3  S+     0   0   60  594   85  EREEK        D I  HR     IIII MS     KIP  A VE P        A   A    RR   
   102   25 C G  T 3  S+     0   0    0  595   74  NSSHH        G N  GN     KHEK SY     AEH  G EG H        Y   G    FF   
   103   26 C E  S <  S+     0   0   36  595   66  SASSA        D G  ES     ENKD EY     DDE  E DQ S        S   A    SS   
   104   27 C h    >   +     0   0    4  595   92  VAVVA        A W  WW     YAAY VT     WHF  I LF Q        I   W    II   
   105   28 C P  T 3   +     0   0    0  599    9  PPPPP        P P  PP     PPPP PK     PPP  P PP P        K   P    KK   
   106   29 C W  T 3  S+     0   0    5  600   26  YYYYW        Y W  WW     YWWY WY     WYW  Y YW W        Y   W    YY   
   107   30 C Q  E <   -J  122   0C   7  601   26  QQQQT        Q q  qq     QqQQ qv     QQL  q Qq Q        Q   q    QQ   
   108   31 C A  E     -JK 121 146C   1  593   49  VVVVV        V m  mi     ViVI as     AVV  l Vp V        A   i    AA   
   109   32 C L  E     -JK 120 145C   3  598   68  SSSSS        S L  KI     SQSS LS     SSS  L SQ G        S   P    SS   
   110   33 C L  E     -JK 119 144C   0  601    9  LLLLL        L L  LL     LLLL LS     LLI  L LL L        L   V    LL   
   111   34 C I  E     -JK 117 143C   0  601   81  NNNNN        Q R  NK     QSEQ YS     QQT  G QD F        Q   S    QQ   
   112   35 C N  E >   - K   0 142C  30  601   88  ASASV        R S  St     RALR FS     MNR  N Rt L        T   G    SS   
   113   36 C E  T 3  S+     0   0   63  117   78  .....        . P  Sn     .... ..     .V.  . .g .        S   .    ..   
   114   37 C E  T 3  S-     0   0  136  242   77  .....        . N  SL     ..N. ..     DEK  . HN .        S   .    PP   
   115   38 C N  S <  S+     0   0   84  565   53  GGGGG        T G  LT     H.GS .A     GNG  . NQ G        G   G    RR   
   116   39 C E        -     0   0  100  589   94  YYYYY        S D  PT     YRYF GY     IKG  . SI T        Q   A    GG   
   117   40 C G  E     +J  111   0C  14  600   57  HHHHH        H Q  HH     HHNH IA     HHH  S HI N        H   A    HH   
   118   41 C F  E     +     0   0C  28  611   33  FFFFF        F F  IY     MIWM fq     FFF  L Ih l        Y   L    YY   
   119   42 C i  E     -J  110   0C   0  612    1  CCCCC        C C  CC     CCCC cc     CCC  C Cc c        C   C    CC   
   120   43 C G  E     -J  109   0C   1  612    1  GGGGG        G G  GG     GGGG GG     GGG  G GG G        G   G    GG   
   121   44 C G  E     -J  108   0C   0  612    9  GGGGG        G G  GG     GGGG AG     AGG  G GG G        G   G    AA   
   122   45 C T  E     -JL 107 130C   0  612   45  SSSSS        S S  NS     SSVS VC     SSA  T ST V        T   S    TT   
   123   46 C I  E     + L   0 129C   0  612   23  LLLLL        I L  VL     LIIL VI     LII  L VL L        L   L    LL   
   124   47 C L        -     0   0    6  612   27  IIIII        I I  II     IYYI YL     ILL  I LI I        V   I    VV   
   125   48 C S  S    S-     0   0   22  612   56  NSNNA        A D  SD     ASSG SD     SSN  A SD D        H   N    HH   
   126   49 C E  S    S+     0   0   99  612   63  DSDSP        D P  PP     EKKV EE     EED  P DE R        P   S    PP   
   127   50 C F  S    S+     0   0   42  612   83  QQQQG        N G  WY     GDNG KV     EDR  S RC R        Q   Q    QQ   
   128   51 C Y  E     - M   0 185C   7  612   34  WWWWW        Y W  WW     WIIW IT     WIF  I WW W        W   W    WW   
   129   52 C I  E     -LM 123 184C   0  612   14  VVVVV        I V  VI     VIIA VI     LVV  I VV V        V   I    VV   
   130   53 C L  E     +LM 122 183C   0  612   27  VLVLV        L L  LL     LLIL IA     LLL  L ML L        V   L    VV   
   131   54 C T  E     - M   0 182C   0  612   43  SSSSS        T T  TT     TTTT TT     TTT  T TT T        S   S    SS   
   132   55 C A    >>  -     0   0    0  613    2  AAAAA        A A  AS     AAAA AA     AAA  A AA A        A   A    AA   
   133   56 C A  G >4 S+     0   0    0  613    9  AAAAA        A A  AS     AAAA AA     AAA  A AA A        A   A    AA   
   134   57 C H  G >4 S+     0   0    7  613    0  HHHHH        H H  HH     HHHH HH     HHH  H HH H        H   H    HH   
   135   58 C i  G X4 S+     0   0    0  613    1  CCCCC        C C  CC     CCCC CC     CCC  C CC C        C   C    CC   
   136   59 C L  G << S+     0   0   31  613   66  YYYYY        I L  VF     VVAV TV     FLL  L TF S        W   F    WW   
   137   60 C Y  G <  S+     0   0  109  613   87  QKKKQ        Q V  QW     EKYE DY     DEC  A SI S        R   S    II   
   138   61 C Q  S <  S+     0   0   95  613   78  YSYSR        g g  dt     sdds nn     igs  g gd S        P   s    PP   
   139   61AC A        -     0   0   16  373   75  .....        a p  as     vvpv da     mpv  v aa .        K   t    SS   
   140   62 C K  S    S-     0   0  172  387   77  .....        S D  ST     DTNE AE     AEG  S GS .        N   A    SS   
   141   63 C R  S    S-     0   0  162  602   78  HSRRR        S S  NQ     ALDS LN     SDQ  T SI R        M   G    LL   
   142   64 C F  E     -K  112   0C  36  609   54  IIIII        L V  IF     LLLL YF     FVL  F QF Y        M   V    MM   
   143   65 C K  E     -K  111   0C  67  609   79  QQQQQ        T V  KE     RQSK SL     GKR  T AT W        K   V    KK   
   144   66 C V  E     -KN 110 161C   0  609   16  VVVVV        I V  LI     VVVV VV     TVV  V VV V        V   V    VV   
   145   67 C R  E     -KN 109 160C  40  609   55  RKRRR        R R  TR     RRRR RV     TRT  R RR R        V   Y    VV   
   146   68 C V  E     +KN 108 159C   1  610   43  LLLLL        Y L  ML     IVAV VA     LLL  V VL L        L   L    LL   
   147   69 C G  S    S+     0   0    9  610   15  GGGGG        N G  GG     GGGG GG     SGG  N KG G        S   G    SS   
   148   70 C D        +     0   0   11  611   58  EEEEE        T A  EE     ASAA SD     PSE  T SD E        E   E    EE   
   149   71 C R  S    S+     0   0   24  611   73  YYHYH        L H  WH     TNTT VD     PTH  L SL H        H   T    HH   
   150   72 C N  B >   -P  234   0D  18  611   65  NNNND        R Y  RD     RRTR WS     LMN  A YN S        N   E    NN   
   151   73 C T  T 3  S+     0   0   56  611   80  ILIII        H R  LV     KHHK KR     MYL  L HN L        L   I    LL   
   152   74 C E  T 3  S-     0   0  119  611   84  DANDS        N S  FR     ENNE NG     RAK  N AR S        N   N    EE   
   153   75 C Q  S <  S-     0   0  130  610   85  VAVVA        S N  NK     IALK FG     RSA  G KV R        L   N    VV   
   154   76 C E        +     0   0  165  610   85  LQLQN        G k  VY     DGGD GM     NGP  a GS L        E   s    DD   
   155   77 C E        -     0   0   93  469   27  EDEEE        . v  DE     .... .N     ..E  a .D D        E   n    EE   
   156   78 C G  S    S+     0   0   46  578   34  GGGDG        G G  GG     GGGG GG     .GV  G .D W        G   S    GG   
   157   79 C G  S    S+     0   0   47  585   75  GSNSD        L T  TF     ITSL QV     .Lp  S .T T        f   V    FF   
   158   80 C E        -     0   0   37  472   30  EEEEE        . E  EE     .... ..     ..a  . GE E        q   .    EE   
   159   81 C A  E     -N  146   0C  27  487   57  QQQVT        . K  QE     .... ..     ..R  V EQ Q        E   .    QQ   
   160   82 C V  E     -N  145   0C  71  590   83  FTFVY        T D  VI     LLVI HV     .LH  S LD I        F   S    VV   
   161   83 C H  E     -N  144   0C  14  599   76  IIVRI        V I  II     VIVV VV     .VE  R VF R        D   K    LL   
   162   84 C E        -     0   0   90  602   78  DSDSD        K K  PQ     KPGN RR     .DS  G MA R        V   T    NN   
   163   85 C V  E     -O  186   0C  27  607   64  ASSSS        A V  VG     IVVI VV     IVV  V VI S        A   V    VV   
   164   86 C E  E    S+     0   0C  70  608   73  SSASS        S A  ED     RASR AS     QKI  S KE G        W   S    SS   
   165   87 C V  E     -O  185   0C  13  609   72  KKKVM        R Q  RQ     TTAR VK     SSN  N RR F        S   Q    QQ   
   166   88 C V  E     -O  184   0C  72  610   46  IVIIV        I I  IL     VYII IL     IFA  F YL S        F   I    II   
   167   89 C I  E     +O  183   0C  27  610   43  IIIII        I I  IY     HKSH WI     IKV  V VI V        F   I    YY   
   168   90 C K  E     -O  182   0C  68  610   82  RRRRR        G P  SI     RLLR RP     ISL  I MI T        N   V    MM   
   169   91 C H    >   -     0   0   19  611   13  HHHHH        H H  HH     HHHH HH     HHH  H HH H        N   H    NN   
   170   92 C N  T 3  S+     0   0  156  611   61  PSPPP        E K  AP     PEEP EE     EEP  P PE P        F   E    nN   
   171   93 C R  T 3  S+     0   0  150  608   73  KGNKN        K N  NG     KHQD GL     NKG  S KE G        N   N    k.   
   172   94 C F    <   -     0   0   24  611    5  YYYYY        Y Y  YL     YFYY YY     YFH  Y YF Y        Y   Y    YF   
   173   95 C T     >  -     0   0   56  611   68  SNNSS        D H  Sv     DDDN vN     Anr  T Ds q        R   N    WK   
   174   96 C K  T  4 S+     0   0  145  561   78  SASSG        S .  Yd     APNS pS     Aeg  S Hy g        .   K    .Y   
   175   97 C E  T  4 S+     0   0  174  569   91  WNWIY        N S  NL     RYIR AS     HTK  S RP Q        .   Q    .W   
   176   98 C T  T  4 S-     0   0   44  598   57  TTTTD        T P  TI     ILIT WT     KRY  T TS S        T   T    TT   
   177   99 C Y    ><  +     0   0   60  604   65  LLLLL        I I  VS     ILAI FM     HVV  N VA H        F   Q    FF   
   178  100 C D  T 3   +     0   0   25  609   37  DNDND        D e  Dp     DHTD ND     DND  D DR D        N   D    DD   
   179  101 C F  T 3  S+     0   0   21  595   66  NNNNN        N n  Yy     YYNY .N     D..  N YH H        N   N    NN   
   180  102 C D    <   +     0   0    1  609    0  DDDDD        D D  DD     DDDD DD     DDD  D DD D        D   D    DD   
   181  103 C I        +     0   0    0  611   13  IIIII        I I  YV     FIIY II     IVI  L FV L        I   V    II   
   182  104 C A  E     -MO 131 168C   0  611   60  LMMMM        A A  AA     AAAA AA     AAA  A SA R        L   S    MM   
   183  105 C V  E     -MO 130 167C   0  612   16  LLLLL        L L  LL     VLLL VL     VIL  L LL L        L   L    LL   
   184  106 C L  E     -MO 129 166C   0  613   30  IIIII        I L  LI     LLLL IV     VML  M LL L        I   L    II   
   185  107 C R  E     -MO 128 165C  40  613   43  KKKKK        Q K  KK     QRLE RV     KKE  K EK R        K   K    KK   
   186  108 C L  E     - O   0 163C   0  613   16  LLLLL        T L  LL     LLLL VV     LLL  L LL L        L   L    LL   
   187  109 C K  S    S+     0   0  101  613   69  SSAAS        A E  TK     AASA AD     SAA  V EA G        D   T    SS   
   188  110 C T  S    S-     0   0   82  614   74  TKSSK        S N  RR     ETSP DP     TQR  S KK S        R   S    EE   
   189  111 C P        -     0   0   48  614   39  PAPAP        k P  PP     yQPy Sp     PPP  p Pv P        P   P    PP   
   190  112 C I        -     0   0    4  562   63  AAVVA        g A  LA     tILt La     V.I  v La V        A   V    AA   
   191  113 C T        -     0   0   95  566   73  VTTEA        T N  NV     NSRD IS     L.T  K QR V        T   T    RR   
   192  114 C F        +     0   0   56  612   34  ILLYL        T L  FF     VFLV FF     FVW  L FY L        L   F    LL   
   193  115 C R  B >   -Q  196   0E  52  613   63  NNNSN        N V  TH     tSST NS     SkS  A GT T        N   N    NN   
   194  116 C M  T 3  S+     0   0   29  594   77  ASAAR        . N  QK     aLKQ S.     KsE  . ED K        A   D    AA   
   195  117 C N  T 3  S+     0   0   13  602   90  RYRDN        . G  YR     FSFA DT     DAS  . AA S        N   Y    NN   
   196  118 C V  B <   +Q  193   0E   0  604   27  VVVIV        A V  VV     VVVF VM     VIV  . CV V        V   I    VV   
   197  119 C A        -     0   0    1  606   80  SNAQD        Q G  QY     KKQA RE     GRK  . QQ Q        Q   S    QQ   
   198  120 C P        -     0   0    8  608   54  TTSPL        A T  PS     LPVQ PA     RYP  . PP P        P   P    PP   
   199  121 C A        -     0   0    2  609   39  LVVII        I V  VV     PIIL II     VIA  . VA L        A   V    AA   
   200  122 C g  B     -c  290   0B   1  610   66  LPPAS        K C  CC     KAPP PE     CKC  T RC P        E   C    AA   
   201  123 C L        -     0   0   27  612    5  LLLLL        L L  LL     LLLE LI     LLL  L LL L        L   L    LL   
   202  124 C P        -     0   0    7  613   30  PPPPP        P A  PP     NAAQ AA     PAP  P PP P        P   A    PP   
   203  124AC E     >  -     0   0   92  612   75  STSST        E N  DS     EATN DS     DDV  A ED T        D   E    DD   
   204  125 C R  H  > S+     0   0  109  612   78  ASSSG        Q N  SV     DTEE VE     AKA  A QE T        A   Q    AA   
   205  126 C D  H  > S+     0   0  124  612   85  CCCCC        G N  DT     ISED AQ     TKT  A DS C        D   G    AA   
   206  127 C W  H  >>S+     0   0    4  612   88  AVAAA        S T  FA     APPL PP     FPG  T EF A        T   S    TT   
   207  128 C A  I  X>S+     0   0    0  612   75  STPKY        D H  PN     DSSP AA     EVK  S DP A        P   N    PP   
   208  129 C E  I  <5S+     0   0   75  613   82  AAAAA        P L  AL     GGID AD     VTP  C VI A        L   F    PP   
   209  130 C S  I  <5S+     0   0   70  614   66  GGGGG        K P  GT     TGGG GG     LGg  s EK G        G   P    LL   
   210  131 C T  I  <5S+     0   0   18  108   73  .....        . .  ..     ...T ..     ..s  a .. .        .   .    ..   
   211  131AC L  I ><  S-     0   0  119  503   80  SsssM        s s  yA     .i.Q gk     .F.  s LL .        .   S    ..   
   227  146 C E  T 3  S+     0   0   47  527   75  SSNND        G S  RE     .G.N IE     .L.  S NG .        Y   S    YY   
   228  147 C K  T 3  S+     0   0  169  548   68  GGGGG        A G  GG     .T.A PN     NIR  G NQ W        S   G    SS   
   229  149 C G  S <  S-     0   0   29  559   66  VSVYA        S G  SS     HG.E GG     GCY  G QS S        S   G    SS   
   230  150 C R        -     0   0  213  584   86  NLNNV        S A  PP     EK.E LL     PDK  S ES P        Y   S    YY   
   231  151 C Q  B     -R  224   0F  79  599   93  YYNYS        L A  SY     SY.S ES     FLR  I SA F        L   T    LL   
   232  152 C S        -     0   0   14  607   51  PPPPG        P P  PS     TSSS SS     PST  S RA P        S   S    SS   
   233  153 C T  S    S+     0   0   48  608   73  DDDED        T D  NP     ESND ID     NPD  Q DA D        P   S    PP   
   234  154 C R  B    S-P  150   0D 102  608   85  LVLLQ        K R  YV     VSRV VQ     TNV  T KN Q        V   S    VV   
   235  155 C L        -     0   0    3  610    3  LLLLL        L L  LL     LLLL LL     LLL  L LL L        L   L    LL   
   236  156 C K  E     -BD  98 221B  31  610   51  QQQQQ        Q M  QN     RQRR LQ     RMQ  L RM Q        R   Q    RR   
   237  157 C M  E     -BD  97 220B  18  611   94  CCCCC        K Q  EE     ALSA QQ     QSK  K AW C        S   E    AA   
   238  158 C L  E     - D   0 219B   4  612   44  LLVLL        V A  VV     VVVV AV     VVV  A AV L        V   V    VV   
   239  159 C E  E     - D   0 218B 107  612   72  VNDND        T S  GE     TQNT SK     EEE  N VT N        D   S    DD   
   240  160 C V  E     - D   0 217B   0  612   46  AAAAA        V V  LV     VLVV VV     VVV  V VL V        V   V    VV   
   241  161 C P  E     - D   0 216B  34  612   28  PPPPP        P P  PD     PQDP KP     EER  Q PP S        T   P    QQ   
   242  162 C Y  E     -F  263   0B  36  613   46  LVVIV        I L  LI     TIIT IV     IFV  V KT I        L   I    II   
   243  163 C V  E     -F  262   0B  24  614   37  LLLLL        V V  VV     VIVV VV     IVV  L SK V        I   V    II   
   244  164 C D     >  -     0   0   88  613   57  SSPSS        D S  NS     NEAN DD     SDA  D NS S        .   S    SS   
   245  165 C R  H  > S+     0   0   51  613   78  HSQDD        R K  HK     QRRQ PS     NTN  N QN S        .   N    NN   
   246  166 C N  H  > S+     0   0  105  614   74  ASAQA        K S  SE     TDAT NE     DKT  T EK A        P   S    CC   
   247  167 C S  H  > S+     0   0   48  614   78  DQDEE        T R  QV     QDEQ DK     IDV  A YY A        Y   Q    RR   
   248  168 C j  H  X S+     0   0    1  614    2  CCCCC        C C  CC     CCCC CC     CCC  C CC C        C   C    RR   
   249  169 C K  H >< S+     0   0   88  614   73  ESEQK        n d  hn     qslt Rq     nas  K nk R        Y   S    YY   
   250  170 C L  H 3< S+     0   0  150  574   89  ASAEG        g g  ld     ygvy .a     nyq  . yk A        Y   .    ..   
   251  171 C S  H 3< S+     0   0   23  604   76  SASAA        A N  TS     DYYE RY     VGG  L AR V        Y   .    YY   
   252  172 C S    <<  -     0   0   20  607   83  YYYYY        V Y  AY     SGGH AY     YYK  Q AT F        Y   S    YY   
   253  173 C S  S    S+     0   0   79  607   83  PPPPP        G T  SN     FWEF YW     GGS  Y YE P        W   S    WW   
   254  174 C F  S    S-     0   0  124  607   79  GGGGG        A G  RG     GDKG PR     GMT  S GL G        Q   Y    GG   
   255  175 C I        -     0   0  100  608   87  QRDDM        D K  KT     SFVN YP     AER  T GF R        M   S    MM   
   256  176 C I        -     0   0   13  609   18  IIIII        I I  II     IVFI LI     IIV  L VI I        I   L    II   
   257  177 C T    >   -     0   0   16  614   35  TTTTT        T H  TN     TGIT TS     SKG  T TD T        T   T    TT   
   258  178 C Q  T 3  S+     0   0  133  614   68  NSNSN        D E  PD     DQRD EE     SES  N PD D        P   S    PP   
   259  179 C N  T 3  S+     0   0   24  614   60  NNNNN        N S  RR     RETR VG     GTT  N RI N        N   N    NN   
   260  180 C M  E <   - G   0 311B   2  614   13  MMMMM        M M  MY     MMSM MM     MMQ  M MM M        M   M    MM   
   261  181 C F  E     - G   0 310B   8  613   35  IIIIM        F L  RF     MIIL IL     IVM  I VI V        L   M    LL   
   262  182 C j  E     +FG 243 309B   1  614    1  CCCCC        C C  CC     CCCC CC     CCC  C CC C        C   C    CC   
   263  183 C A  E     +FG 242 308B   0  614   26  AIVVV        A A  AA     AAAA AA     AAA  A AA A        A   A    AA   
   264  184 C G  S    S-     0   0    3  614   10  GGGGG        G G  GG     GASG AG     GTG  A GG G        G   G    GG   
   265  185 C Y        -     0   0   56  591   57  FYFFY        I L  TF     LTAL A.     FGY  A FL G        S   L    SS   
   266  185AC D  S    S-     0   0   81  594   83  LLLLM        L E  ET     RDPT LL     LKE  P EK I        R   T    RR   
   267  185BC T  S    S+     0   0   76  614   61  ENEEE        n Q  GQ     ANGE Ls     TEE  G ET P        F   Q    LL   
   268  186 C K  S    S-     0   0  107  563   32  GGGGG        g G  VG     G..G .g     G.G  . GG .        G   G    GG   
   269  187 C Q  S    S+     0   0  102  569   37  GGGGG        G G  AG     G..G .G     K.G  . GG G        G   G    GG   
   270  188 C E        +     0   0   33  613   55  KKKKK        K V  KR     KKKK KK     LKR  K KS E        K   K    KK   
   271  189 C D  B     -A   94   0A   7  614    4  DDDDD        D D  AD     DDDD DD     DSD  D DD D        D   D    DD   
   272  190 C A        -     0   0    7  614   42  SSSSS        A S  VS     AAAA SA     ASS  T AA A        S   S    SS   
   273  191 C k    >   -     0   0    7  614    3  CCCCC        C C  CC     CCCC CC     CCC  C CC C        C   C    CC   
   274  192 C Q  T 3  S+     0   0   90  614   25  QQQQQ        Q Q  SG     QTVQ QQ     EQW  Q QT Q        Q   Q    QQ   
   275  193 C G  T 3  S+     0   0    6  614    8  GGGGG        G G  GG     GGGG GG     GGA  G GG G        G   G    GG   
   276  194 C D    X   +     0   0    0  614    0  DDDDD        D D  DD     DDDD DD     DDD  D DD D        D   D    DD   
   277  195 C S  T 3  S+     0   0   14  614    1  SSSSS        S S  SS     SSSS SS     SSS  S SS S        S   S    SS   
   278  196 C G  T 3  S+     0   0    0  614    0  GGGGG        G G  GG     GGGG GG     GGG  G GG G        G   G    GG   
   279  197 C G    <   -     0   0    0  614    1  GGGGG        G G  GG     GGGG GG     GGG  G GG G        G   G    GG   
   280  198 C P  E     - H   0 294B   1  614    2  PPPPP        P P  PP     PPPP PP     PPP  P PP P        P   P    PP   
   281  199 C H  E     -EH 219 293B   0  614   49  VVVVV        V L  LL     LLLL LL     LLL  M LY L        L   L    LL   
   282  200 C V  E     -EH 218 291B   3  614   26  AVVVV        A V  VV     VVVA VV     VVM  M VV V        I   V    VV   
   283  201 C T  E     - H   0 290B   0  614   66  CCCCC        A C  CC     ASYV SV     IAV  V HC C        C   S    CC   
   284  202 C R  E     + H   0 289B  99  614   70  NNNNN        N E  EP     HAQN GA     ADG  G DR G        N   K    NN   
   285  203 C F  E >  S- H   0 288B  22  614   71  GGGGG        G d  Rn     GSGG GN     rGs  G Gn G        G   n    GG   
   286  204 C K  T 3  S-     0   0   85  222   71  .....        . n  Gd     .... ..     r.g  . .e .        .   d    ..   
   287  205 C D  T 3  S+     0   0  108  223   55  .....        . G  GG     .... ..     N.G  . .G .        .   T    ..   
   288  206 C T  E <   - H   0 285B   3  233   75  .....        . R  RQ     .... ..     I.S  . .K .        .   R    ..   
   289  207 C Y  E     - H   0 284B  21  242   51  .....        . W  WY     .... ..     W.A  . .Y .        .   W    ..   
   290  208 C F  E     -cH 200 283B   0  613   91  QQEEM        V H  FV     KLQK QK     YHM  V VA V        K   I    HH   
   291  209 C V  E     + H   0 282B   1  613   38  LLLLL        L L  LL     LLLL LL     LVV  Q LV L        F   Q    FF   
   292  210 C T  E     +     0   0B   1  613   84  QQQQQ        V E  MR     WAVW VA     VVV  V VV Q        E   A    EE   
   293  211 C G  E     -IH 312 281B   0  613    0  GGGGG        G G  GG     GGGG GG     GGG  G GG G        G   G    GG   
   294  212 C I  E     -IH 311 280B   0  613   19  IFIII        A V  LV     VIIV II     IIV  I VV L        I   V    II   
   295  213 C V  E     +I  310   0B   7  613   14  VVVVV        V T  SV     VVVV VV     VVV  T VV V        V   V    VV   
   296  214 C S  E     -     0   0B   1  612    0  SSSSS        S S  SS     SSSS SS     SSS  S SS S        S   S    SS   
   297  215 C W  E     -I  309   0B  45  613    7  WWWWW        W W  WW     WWHW HW     WWT  F WF W        W   F    WW   
   298  216 C G        -     0   0   26  613    0  GGGGG        G G  GG     GGGG GG     GSG  G GG g        G   G    GG   
   299  217 C E  S    S-     0   0   25  609   90  YIYIY        Y Y  .E     FHKF ME     IAI  N YI e        I   D    II   
   300  218 C G  S    S-     0   0   19  612   13  GGGGG        G G  WG     GGGG LG     DGG  G GG P        S   G    GG   
   301  220 C k  S    S-     0   0    7  613    2  CCCCC        C C  VC     CCCC CC     CCC  C CC C        C   C    CC   
   302  221 C A  S    S+     0   0    4  612   16  AAAAA        A A  CA     AAAA AA     GAS  A AA G        A   A    AA   
   303  222 C R    >   -     0   0  105  611   73  QQQLE        Q A  PR     KQLK IR     KVR  L VR Q        N   K    HH   
   304  223 C K  T 3  S+     0   0  152  611   64  KKPKR        A P  QP     PPSP PP     KEP  P KA K        P   P    PP   
   305  223AC G  T 3  S+     0   0   26  613   58  GGDGD        K R  AK     ENTK FN     NDR  N GK G        Y   N    YY   
   306  224 C K    <   -     0   0   43  613   85  KYAYH        Y M  RK     YYYY YY     KYL  F YY I        Y   T    FF   
   307  225 C Y        -     0   0   33  613   50  PPPPP        P Y  PY     PPPP PP     PPP  A PP P        P   P    PP   
   308  226 C G  E     -G  263   0B   4  611    2  GGGGG        G G  KG     GGGG GG     GGG  G GG G        G   G    GG   
   309  227 C I  E     -GI 262 297B   6  612   11  VVVVV        V V  VV     VVVV VV     IVI  V VV V        V   V    VV   
   310  228 C Y  E     -GI 261 295B   1  612    1  YYYYY        Y Y  FY     YYYY YY     YYY  Y YY Y        Y   Y    YY   
   311  229 C T  E     -GI 260 294B   2  612   39  TTTTT        T A  SL     SVAS TA     TST  T ST T        T   A    TT   
   312  230 C K  E >   - I   0 293B  21  612   42  KKKKR        R S  DD     RNNK NN     KDR  R RN N        K   R    RR   
   313  231 C V  G >  S+     0   0    1  611    8  VVVVV        V V  VV     VVVV VV     VVT  V VV I        V   V    II   
   314  232 C T  G 3  S+     0   0    2  609   71  CCCCC        G R  LR     AAPS AA     TVS  T AA C        R   S    RR   
   315  233 C A  G <  S+     0   0   29  609   79  NNNNH        N Y  AR     AVTA VY     RAD  Q AH K        N   E    NN   
   316  234 C F  S <> S+     0   0    7  605   35  YYYYY        Y L  AI     VMLV LF     YLY  Y VF Y        Y   Y    YY   
   317  235 C L  H  > S+     0   0   23  603   80  VVVVV        I R  ML     RRNR KK     RRI  L RI V        I   Q    VV   
   318  236 C K  H  > S+     0   0  116  602   68  DSDDS        S D  DP     DSKN PD     DSS  G DP D        G   T    GG   
   319  237 C W  H  > S+     0   0   26  602    1  WWWWW        W W  WF     WWWW WW     WWW  W WW W        W   W    WW   
   320  238 C I  H  X S+     0   0    1  599   12  IIIII        I I  II     IIII II     III  I VI I        I   I    II   
   321  239 C D  H  < S+     0   0   66  570   71  QKQQH        K N  RE     DIL  LA     KET  S RN R        A   S    EE   
   322  240 C R  H >< S+     0   0  136  556   71  ETNEE          G  EG     SKR  SK      ER  S KS T        E   S    DD   
   323  241 C S  H >< S+     0   0    6  523   72  TTTTT          V   T      TT  AQ      AE  T  N V        T   R    II   
   324  242 C M  T 3< S+     0   0   25  479   41  IMIII          M   I          IR      IV  S  I M        I   V    II   
   325  243 C K  T <  S+     0   0  153  444   70  ASAAA          K   E          EA      NQ  A  N S        K   S    KK   
   326  244 C T    <         0   0   51  390   65  ASDAS              G           S      SS  S    N        T        NN   
   327  245 C R              0   0  197  273   47  NNN                R                   R       N                 KK   
## ALIGNMENTS 1051 - 1120
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....6....:....7....:....8....:....9....:....0....:....1....:....2
     1   49 L Q              0   0  101  671   35    E   EEQ E       E E E    E E       E  E  EED D EK R NE  E E EE D EEE
     2   50 L a    >   +     0   0   22  858    0  C C CCCCC CC      C C C C  C C     C C CC CCCCCCCCC CCCCC C C CC C CCC
     3   51 L E  T 3  S+     0   0  187  858   80  A N AAEEN KT      A W A A  A S     L E DD DADVSASKE LHSFS A I AW E LDA
     4   52 L T  T 3  S-     0   0  105  864   61  T T SSTTL TP      S S S T  V T     T S NS SSDNPSSSS EPPSS D K SS A NSN
     5   53 L S    <   +     0   0   89  868   72  S G SSEES SS      Q N D S  L D     K S SS SSDDSSASS ANNND E N QG Q SDG
     6   54 L P        +     0   0   10  878   31  P N PPEEP PP     PP P P P  N P P   P P PP PPPPPPPPP PPPPP P P PP P PPN
     7   55 L b        -     0   0   18  893   21  C N CCAAC CC     CC C C C  G C C  CC C CC CCCCCCCCC CCCCC C C CC C CCG
     8   56 L Q  S    S+     0   0   92  892   83  E C SSNNV KL     LY R Q E  G Q H  QA L GK QVDQQAQKK QKQM. L N YQ Q NQG
     9   57 L N  S    S-     0   0   63  893   51  Q S NNCCH NN     NN N N Q  C N N  NN N IN NNMNNHNNN NNNNV N H NN N NNC
    10   58 L Q  S    S-     0   0  152  893   57  Q Q GGAAG GN     GG G G Q  S G N  GG S GG DGDEGGGGG NGGAG G N GG G GGE
    11   59 L G        -     0   0   16  893   40  C L GGHHT GG     GG G A C  Q G G  GG A GG GDAGGGGGG GGGGG G A GG G GGH
    12   60 L K  E     -S   23   0G 117  852   79  T . TTGG. TV     TT T S T  L T S  HK V QS T.QATTTTN TTVTT Q S QT K VTT
    13   61 L a  E     -S   22   0G  45  882   10  D C CCCCC CC     CC C C D  C C C  CC C CC CCCCCCCCC CCCCC C C CC C CCC
    14   62 L K  E     -S   21   0G 155  890   81  N N VVHHk VQ     eK I H N  V D s  AI L ST SVELKRTVT VtTVe E Q KV T ANN
    15   63 L X  E     +S   20   0G 120  768   39  . N GGNNk DQ     t. D D .  N E d  .. N .. GDNDQDVDD DsEDt D N .D D DD.
    16   64 L G        -     0   0   44  862   73  . N GGTTF GR     AD G Y .  R T G  .N G TD DGTGSGVGQ TDTGP G T DG E LVN
    17   65 L L  S    S-     0   0  152  871   64  F I GGLLL HL     PL I V F  D G S  FL I IL ALNLTVSIV VTAVL I Y LV V PVI
    18   66 L G  S    S+     0   0   67  883   63  G G DDGGG KG     Dp A N G  G G G  Pn N gg NNGNkNGNN TeTNG G G pA G DNa
    19   67 L E        -     0   0  119  837   61  Q S TTSS. DG     Ng T S Q  G S G  .d Q se GSSSsEGRN GgGSE S S gY R GGs
    20   68 L Y  E     -S   15   0G  37  883   11  V Y FFYYY YY     YY Y Y V  Y Y F  GY Y YY YFFYYYYYY YFYYF Y Y YY Y YYY
    21   69 L T  E     -S   14   0G  71  886   82  V T TTVVT SN     LK N T V  R S T  RR T QK TTVTESSSI TVTTR S A RN T LNH
    22   70 L b  E     -S   13   0G  20  889    0  C C CCCCC CC     CC C C C  C C C  CC C CC CCCCCCCCC CCCCC C C CC C CCC
    23   71 L T  E     -S   12   0G  85  890   86  T D IIVVI ET     TT T T T  G E T  ST N KT QDSQKTATT TVQTI T H ET Q IDT
    24   72 L c        -     0   0   44  890    0  C C CCCCC CC     CC C C C  C C C  CC C CC CCCCCCCCC CCCCC C C CC C CCC
    25   73 L L    >   -     0   0   62  890   88  F N KKNND LP     PA R Q F  H L A  PR V YL PANTPPLVQ TKLAP A Q PP T QVD
    26   74 L E  T 3  S+     0   0  177  890   75  L E EEAAE ST     EQ D L L  P P D  PP S TP ASEDPPPAP EEEEP E A KE P APD
    27   75 L G  T 3  S+     0   0   29  893   20  G G GGAAG GG     GG G G G  G G G  GG G GG GGGGGGGGG AGGGG G G GG G GGG
    28   76 L F  E <   +T   36   0H  40  893    9  Y C WWYYF FF     FY F F Y  Y Y F  WF F YY FFFWFYFFY WFFWW F F YF F WYY
    29   77 L E  E     +T   35   0H  74  893   73  r t EEeeK TR     SS I S r  t G T  TS T TD DEqEQTTTT QTSTT E T TS V TEa
    30   78 L G  S >  S-     0   0   32  889    5  d g GGggG GG     GG G G d  g G G  GG G GG GGgGGGGGG GGGGG G G GG G GGe
    31   79 L K  T 3  S+     0   0  156  891   73  R F PPKKK KT     AI L V R  K K S  LK K TI VAFSKRNKR KEVSK D K IS Y QDH
    32   80 L N  T 3  S-     0   0   33  892   62  E S TTQQQ DN     NN N N E  A D R  SD Q NN NNANNNDNN NHNRR D K NN N NDT
    33   81 L c  S <  S+     0   0    1  892    3  R C CCCCC CC     CC C C R  C C C  CC C CC CCCCCCCCC CCCCC C C CC C CCC
    34   82 L E        +     0   0   87  891   44  H D GGYYE EE     EQ E D H  E Q E  QS E EE EEEEES.EE EEEEE E E QE E .ED
    35   83 L L  E    S-T   29   0H  96  889   88  R D QQRRE EI     VE E I R  V Y E  TI V VH NFDNEA.TK KDLS. I T EE L .ND
    36   84 L F  E     -T   28   0H 139  889   83  S I NNiiL NN     VE N N S  S N R  DD D RT TNIDNP.DE DTAF. N N EN N .gV
    37   85 L T        -     0   0   44  677   75  H . TTmmI ..     .K . . H  . T .  VV I .T VI.ITI.I. L..D. I I .V V .d.
    38   86 L R        +     0   0   57  408   92  K . ..vv. ..     .. . . K  . . A  .. . .. ......... ..... . . .. . .F.
    39   87 L K        +     0   0   96  535   81  S N ..NN. ..     .. . . S  N . G  D. . .. ..D...... D.... . . .. . .LD
    40   88 L L        -     0   0   91  608   90  P E ..SS. ..     .. . . P  P . P  E. . .. ..E...... E..Y. . . .. . .HE
    41   89 L d  S  > S+     0   0   15  617   29  Y C ..CC. ..     .. . . Y  C . C  C. . .. ..C...... C..C. . . .. . .IC
    42   90 L S  T  4 S+     0   0   98  624   84  C D ..EE. ..     .. . . C  A . H  A. . .. ..T...E.. S.DK. . . .. . QIA
    43   91 L L  T >4 S-     0   0  120  627   87  L T ..NN. ..     .. . . L  L . Q  S. . .. ..L...N.. G.GAF . . .. . TTT
    44   92 L D  G >4 S-     0   0  107  638   73  D N ..NN. ..     .. . . D  R . Q  R. . .. ..G...D.. I.KST . . .. . DED
    45   93 L N  G >< S-     0   0    8  700   56  I N ..NN. RH     D. F D I  N . G  S. . F. ..T...I.H T.TGV . . A. . TIN
    46   94 L G  G <  S-     0   0    0  882   52  D G NNGGD ND     NS N S D  G . Y  HD N DL LDHDDSDDN TRDDS D N SD N DDG
    47   95 L D  G <  S+     0   0   44  887   62  E G DDGGP DD     PD E D E  G V P  SE E AT AEDEDREED PQPPD D D DE E EEG
    48   96 L e    <   -     0   0    0  892    0  C C CCCCC CC     CC C C C  C C C  CC C CC CCCCCCCCC CCCCC C C CC C CCC
    49   97 L D  S    S-     0   0   59  892   74  D S DDSSD PG     AG L T D  Q D K  SN G SL DAQSPETAE AFLLS E V GM A DDD
    50   98 L Q  S    S+     0   0    2  892   63  q q ppHHe gs     pn s s q  H a n  Qs s le ssQsghngs hvpns n n ns s ssQ
    51   99 L F  E     -U   62   0I   4  892   80  m f iiHHe yt     tm s s m  Y s a  Lt t pt tvSittsts tttsr t t ml y ttN
    52  100 L d  E     +U   61   0I  10  893    1  C C CCCCC TC     CC C C C  C C C  CC C CC CCCCCCCCC CCCCC C C CC C CCC
    53  101 L H  E     -U   60   0I  68  893   87  D T VVQQR EE     MK F I D  S E M  VV L VL SVIQVHTKT IHATC V V KR E KNH
    54  102 L E  E     -U   59   0I  92  893   68  H D DDHHT RD     ED D D H  L A D  NN E NE GDNDDENDD NENNN D D ND D DDN
    55  103 L E  S    S-     0   0  100  893   82  e G ggssl tg     Te Q e e  k G e  Tr p gK dgdEgRLGR ESEgE g l eR k GVT
    56  104 L Q  S    S-     0   0  175  693   73  n . ....g da     Gg D i n  . N g  A. p qe ..pE..QIF YeE.N n a gN n IVD
    57  105 L N  S    S+     0   0  154  838   66  g . nnssk d.     Gn N . g  g G h  Gn N gg nnGNnaGNN G.GsG . . kN . DNG
    58  106 L S  S    S-     0   0   58  853   65  S R WWGGk ES     SN A S S  Q T V  SS I ss SS.GArDGD GgKNG S S NG S SGS
    59  107 L V  E     -U   54   0I   7  890   79  F F FFPPF CY     FF F Y F  P Y L  FF Y YY YFFYYYYFY FYAYY Y Y VY Y FYY
    60  108 L V  E     -U   53   0I  45  891   88  L S RRVVV ER     NT V R L  V T V  RQ S VA TTNTHLRTT RETIS T Q TT L INS
    61  109 L e  E     +U   52   0I   5  893    1  C C CCCCC CC     CC C C C  C C C  CC C CC CCCCCCCCC CCCCC C C CC C CCC
    62  110 L S  E     -U   51   0I  24  893   75  R S EETTK IQ     DL S A R  S N L  AV T NL QHSASESEK LSQTQ A D LT H SDS
    63  111 L f        -     0   0   23  893    0  C C CCCCC CC     CC C C C  C C C  CC C CC CCCCCCCCC CCCCC C C CC C CCC
    64  112 L A    >   -     0   0    8  893   75  H E AANNA IM     TR A S H  R D P  RA L NP PAFESAVAQ TRPRL V A RQ A LVD
    65  113 L R  T 3  S+     0   0  149  893   80  S S PPHHK AL     AS P A S  E A R  DG L TM AESDSRSVP PHEPA P R SP P PPA
    66  114 L G  T 3  S+     0   0   24  893    8  G G GGGGG GG     GG G G G  G G G  GG G GG GGGGSGGGG QGDGG G G GG G GGG
    67  115 L Y  E <   -V   78   0J  20  893   11  Y Y FFYYW YF     WY Y Y Y  Y Y F  FY Y YF FYFWFYYYY WYFYF Y Y YY F YYY
    68  116 L T  E     -V   77   0J  72  891   85  L E AATTT TT     TT V T L  T T S  SK T TT DEITTGCNT QTSRT T T TL G T T
    69  117 L L  E     -V   76   0J  67  888   64  L L GGLLG GG     GG G G L  L G G  LG G GG GGLGGPGGG GNGG  G G GG G G L
    70  118 L A    >   -     0   0   23  889   78  A H PPDDK IE     PE V A A  N T P  AT I TS VATTETKSK PAPN  I A DD T D N
    71  119 L D  T 3  S+     0   0  175  889   77  P S DDEEY NQ     TE F N P  k D L  AT N NN NNNHFPYTN TNTR  F R QH H V E
    72  120 L N  T 3  S-     0   0   92  694   44  D D ..DD. C.     C. . . D  n . C  D. . .. ..D...CCC C.C.  . . .. . C D
    73  121 L G  S <  S+     0   0   16  713   66  G G ..LL. M.     N. . . G  Q . E  H. . .. ..N...QEE Q.E.  . . .. . Q G
    74  122 L K  S    S+     0   0   71  687   76  H F ..KK. E.      . . . H  A . V  K. . .. ..K...SII E. .  . . .. . T H
    75  123 L A        -     0   0   22  685   66  S T ..TT. E.      . . . S  S . P  A. . .. ..T...TDD D. .  . . .. . D S
    76  124 L f  E     -V   69   0J  12  847    9  C C CCCCC IC      C C C C  C C P  CC C CC CCCCC.GII VC C  C C CC C I C
    77  125 L I  E     -V   68   0J  78  846   80  V I RRIIT DE      D E Q V  I D D  QA E DE EEMEE.TDD DE E  D D DE E D D
    78  126 L P  E     -V   67   0J  62  850   71  P D IIDDE EV      I T H P  D E P  PE T sK NIVTNpPEE EV a  E k VL D L D
    79  127 L T  S    S+     0   0  103  652   80  V . NN..L CD      T D R V  . E C  A. N dK TETDDtCCC CH d  D d TD . C .
    80  128 L G  S    S-     0   0   32  788   69  h I IIVVI AI      I V I h  . I A  GE I nV VIeIVGSAA Lv y  I q IV . N .
    81  129 L P  S    S+     0   0  116  601   75  l . ....D S.      . . . l  H . S  .S . p. .Nd...SSG Dp g  . s .. . P D
    82  130 L Y  S    S+     0   0   59  794   86  R D NNDDF YD      D A N R  N N    LY N ND LFLAD.NGN SN S  D S DA . N D
    83  131 L P    >   -     0   0   17  799   62  S E EEEE  PD      P V P S  E E    GS D PR P EEELPPP PP P  E P PV . P E
    84  132 L g  T 3  S+     0   0   16  800    5  T C CCCC  CC      C C C T  C C    P  C CC C CCCCCCC CC C  C C CC . C C
    85  133 L G  T 3  S+     0   0    0  712   37  G A   GG   S      T E D G    D    G    GS E GSAA Q  Q     E   TD G   A
    86  134 L K    <   -     0   0   69  588   68  K                     S K         P     N S SS   N  N     P    T L    
    87  135 L Q        -     0   0   37  477   65                                    G       S  Q            V    G I    
    88  136 L T        +     0   0    4  428   78                                    T       P  P            P    T S    
    89  137 L L        +     0   0  105  372   61                                    F                            G      
    90  138 L E              0   0  104  274   69                                    S                            A      
    91  139 L R              0   0  231  199   47                                    Q                            R      
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2   I I     I  IIIII  I I I II I I II  I I  V         I     V I I  I I   
    94   17 C V  B     -A  271   0A   7  590    9   I V     V  VFIVV  V V I VV I V VV  V V  V         V     V V V  V M   
    95   18 C G  S    S+     0   0   25  591    6   G G     G  GNGGG  G G G GG G G GN  G G  G         G     G G G  G G   
    96   19 C G  S    S-     0   0   26  592    0   G G     G  GGGGG  G G G GG G G GG  G G  G         G     G G G  G G   
    97   20 C Q  E     -B  237   0B  98  593   95   Q R     T  VRESD  H H Q YY K W SV  T V  E         I     N D V  E V   
    98   21 C E  E     -B  236   0B  80  594   67   E P     Q  EPEQE  E P K HN P E ED  N D  D         E     E S E  A E   
    99   22 C h        -     0   0    8  594   58   V T     A  AACVA  A I A CC C A CT  T T  A         S     S I A  T A   
   100   23 C K    >   -     0   0  123  593   78   P T     S  SQVEE  E G N SP S L AT  S E  P         A     T S K  T V   
   101   24 C D  T 3  S+     0   0   60  594   85   R I     P  IKPKV  I I P VA I P AI  E K  S         N     P I K  A Q   
   102   25 C G  T 3  S+     0   0    0  595   74   F Q     N  GGHGA  G E G PH T H HE  C C  G         G     H Q H  E G   
   103   26 C E  S <  S+     0   0   36  595   66   S N     E  ETSSS  R Q N YS Q E SQ  E E  R         A     V S S  E S   
   104   27 C h    >   +     0   0    4  595   92   I H     F  FTQYA  Y A F QV R F QH  L Y  W         W     W V I  Y W   
   105   28 C P  T 3   +     0   0    0  599    9   K P     P  PPPPP  P P P VP P P PP  P P  P         P     P P P  P P   
   106   29 C W  T 3  S+     0   0    5  600   26   Y Y     Y  YWWWW  W Y W SY F Y WY  W W  W         W     W W W  Y W   
   107   30 C Q  E <   -J  122   0C   7  601   26   Q Q     Q  IIQQQ  M q Q LQ Q Q QQ  V M  m         q     T q Q  V Q   
   108   31 C A  E     -JK 121 146C   1  593   49   V V     I  VAVVV  V v . .V V V VV  V V  i         l     V s V  V V   
   109   32 C L  E     -JK 120 145C   3  598   68   S S     S  SMASM  A Q A .S A T SS  G R  F         F     Q I M  S S   
   110   33 C L  E     -JK 119 144C   0  601    9   L L     L  LLLLL  L V F .L L L LL  I L  L         L     L L V  L L   
   111   34 C I  E     -JK 117 143C   0  601   81   Q Q     R  QSYKY  Y K T .N I K NQ  R Q  H         N     I W S  R K   
   112   35 C N  E >   - K   0 142C  30  601   88   S Y     R  SHYRK  Y s N .A K S IT  R V  G         G     y F K  F L   
   113   36 C E  T 3  S+     0   0   63  117   78   . .     .  .L..R  . s . N. . A .N  . .  F         .     e . .  . .   
   114   37 C E  T 3  S-     0   0  136  242   77   T N     L  .S.RS  . S . A. R L .S  . .  R         .     T . .  R Y   
   115   38 C N  S <  S+     0   0   84  565   53   R G     G  SGFQP  N Q . GG G D GG  N G  R         T     K G G  D G   
   116   39 C E        -     0   0  100  589   94   G K     S  SQSKQ  N R I YY Q S YS  G N  T         H     I E N  K G   
   117   40 C G  E     +J  111   0C  14  600   57   H H     H  HPDHE  R H H HH I L HH  V S  E         H     H H S  H H   
   118   41 C F  E     +     0   0C  28  611   33   Y I     I  FFfIl  f I g FF L L FF  f L  f         R     R F L  I V   
   119   42 C i  E     -J  110   0C   0  612    1   C C     C  CCcCc  c C g CC C C CC  c C  c         C     C C C  C C   
   120   43 C G  E     -J  109   0C   1  612    1   G G     G  GGGGG  G G G GG G G GG  G G  G         G     G G G  G G   
   121   44 C G  E     -J  108   0C   0  612    9   G G     G  GGGGA  G G G GG G G GG  G G  G         G     A A G  G G   
   122   45 C T  E     -JL 107 130C   0  612   45   T T     S  SSVTS  S T A SS S S SS  A T  S         S     A A S  T T   
   123   46 C I  E     + L   0 129C   0  612   23   L L     I  LLLIL  L I L LL L I LI  I I  L         V     L I L  I L   
   124   47 C L        -     0   0    6  612   27   V V     Y  ILIII  I L L II I I II  V I  I         I     L Y L  V L   
   125   48 C S  S    S-     0   0   22  612   56   H K     K  KGNSS  N S G NN D S SS  S D  G         K     S S N  S A   
   126   49 C E  S    S+     0   0   99  612   63   P P     S  KSKAD  D A D ES A S SE  K E  P         S     D E K  N R   
   127   50 C F  S    S+     0   0   42  612   83   Q D     N  NNWQE  R D R HQ Q R ED  Y T  R         Q     D D F  R D   
   128   51 C Y  E     - M   0 185C   7  612   34   W R     W  WWWWW  Y K W WW W H WV  H H  H         W     I I W  Y W   
   129   52 C I  E     -LM 123 184C   0  612   14   V V     I  VIVVI  V V I VV V V VV  I I  I         V     I V V  I V   
   130   53 C L  E     +LM 122 183C   0  612   27   V V     I  LVLIL  L L L VL L L VV  I L  L         V     I I V  L V   
   131   54 C T  E     - M   0 182C   0  612   43   S T     T  TTTTT  T T T SS T T ST  T T  T         T     T T T  S T   
   132   55 C A    >>  -     0   0    0  613    2   A A     A  AAAAA  A A A AA A A AA  A A  A         A     A A A  A A   
   133   56 C A  G >4 S+     0   0    0  613    9   A A     A  AAAAA  A A A AA A A AA  A G  A         A     A A A  A A   
   134   57 C H  G >4 S+     0   0    7  613    0   H H     H  HHHHH  H H H HH H H HH  H H  H         H     H H H  H H   
   135   58 C i  G X4 S+     0   0    0  613    1   C C     C  CCCCC  C C T CC C C CC  C C  C         C     C C C  C C   
   136   59 C L  G << S+     0   0   31  613   66   W T     T  VLNIV  V I I YY K T YM  V I  T         F     F L L  L V   
   137   60 C Y  G <  S+     0   0  109  613   87   I D     D  RHQAL  F E Y QK Q Y MQ  S G  L         S     S T P  V A   
   138   61 C Q  S <  S+     0   0   95  613   78   P g     g  ghSny  g E p SS P g ps  S s  d         k     r k s  q D   
   139   61AC A        -     0   0   16  373   75   S v     v  vp.av  r G n .. G a aa  E p  a         p     p s a  p .   
   140   62 C K  S    S-     0   0  172  387   77   S S     G  KS.SD  S T V .. R G SS  N S  R         R     A E N  F .   
   141   63 C R  S    S-     0   0  162  602   78   F D     S  KDNTD  R K S KS D S RQ  T D  Q         H     R Y T  L .   
   142   64 C F  E     -K  112   0C  36  609   54   M L     M  VFLLI  F Y K MI L I IF  Y I  F         W     Y L V  L .   
   143   65 C K  E     -K  111   0C  67  609   79   K G     S  VKQNL  S A D EQ R I SK  S T  T         Q     T S T  T .   
   144   66 C V  E     -KN 110 161C   0  609   16   V I     I  IIVVV  V V V LV V V VV  V V  V         V     V V V  I .   
   145   67 C R  E     -KN 109 160C  40  609   55   V R     V  GILTR  K R F RR L G RR  E H  R         R     L R R  I .   
   146   68 C V  E     +KN 108 159C   1  610   43   L A     A  LVLAL  F A L IL I L IL  I A  L         L     I V L  A .   
   147   69 C G  S    S+     0   0    9  610   15   S G     G  HGGGG  L G G GG G G GG  S G  G         G     G G G  G .   
   148   70 C D        +     0   0   11  611   58   E S     E  DKAEK  M S H EE T E ES  K E  D         E     G S K  T H   
   149   71 C R  S    S+     0   0   24  611   73   H S     H  RHHYH  H N T NY D H HT  W Y  I         H     H S H  S H   
   150   72 C N  B >   -P  234   0D  18  611   65   N Y     S  TWNDN  D N N NN T N NN  G D  D         S     E Y K  S R   
   151   73 C T  T 3  S+     0   0   56  611   80   L H     L  NRRLR  R H V II L R IY  T Y  L         F     I T L  K T   
   152   74 C E  T 3  S-     0   0  119  611   84   E S     S  ALTSA  T G E ED R L FS  N N  E         H     G R I  Q E   
   153   75 C Q  S <  S-     0   0  130  610   85   V S     I  LRKHK  V R E LV D N AK  S V  N         K     S Y S  E K   
   154   76 C E        +     0   0  165  610   85   T G     D  nSPIf  p G i LR G t SG  V R  d         N     G G E  I D   
   155   77 C E        -     0   0   93  469   27   E .     S  eDTEr  e . l EE T e E.  Q D  e         D     . . .  . .   
   156   78 C G  S    S+     0   0   46  578   34   G G     G  SDGPG  D G G GD G E GG  D G  P         R     . G P  G S   
   157   79 C G  S    S+     0   0   47  585   75   F P     D  ITHGI  S Q H TS E F TD  r Q  s         T     . Q N  D P   
   158   80 C E        -     0   0   37  472   30   . .     E  .EKEE  . . . EE . . E.  w D  p         E     . . Q  . Q   
   159   81 C A  E     -N  146   0C  27  487   57   E .     Q  .QQQK  . . . QV . I Q.  Q V  A         K     E . Q  . Q   
   160   82 C V  E     -N  145   0C  71  590   83   Q L     Y  .HYTI  F L . FV V D WL  L T  T         I     S V D  . D   
   161   83 C H  E     -N  144   0C  14  599   76   V C     S  .LTLV  E V H IR R T IV  I H  Y         L     Y V I  V I   
   162   84 C E        -     0   0   90  602   78   F R     D  ARYTA  R N P QS M A QA  P T  A         K     R R V  Y G   
   163   85 C V  E     -O  186   0C  27  607   64   N V     I  PVAII  K V V SS I V AV  V V  V         V     I V A  F V   
   164   86 C E  E    S+     0   0C  70  608   73   V G     L  KQAED  V L R AA S A SK  T K  K         A     R A A  V T   
   165   87 C V  E     -O  185   0C  13  609   72   S E     S  RHKTE  S D R KA R E KS  K A  Q         Q     N R A  Q K   
   166   88 C V  E     -O  184   0C  72  610   46   M V     K  IIIII  Y Y V IV S I AF  K I  I         I     I F I  F A   
   167   89 C I  E     +O  183   0C  27  610   43   I V     T  IFCII  I R I II I R IK  V D  H         K     S L Y  P I   
   168   90 C K  E     -O  182   0C  68  610   82   Y Q     E  ALPIV  M V I RR V Q PF  I V  A         I     I I I  V V   
   169   91 C H    >   -     0   0   19  611   13   I H     H  HHHHH  T H H HH H H HH  F H  H         H     H H H  L H   
   170   92 C N  T 3  S+     0   0  156  611   61   N P     E  PPEPP  N P P PP P P PE  P E  R         P     P E P  H E   
   171   93 C R  T 3  S+     0   0  150  608   73   K Q     A  NMEYK  W E D QK A D QG  A E  K         R     L K Q  T G   
   172   94 C F    <   -     0   0   24  611    5   F Y     Y  YYFFY  F F Y YY Y Y YY  F Y  F         Y     F Y Y  F Y   
   173   95 C T     >  -     0   0   56  611   68   N D     S  NDDsn  l S R NS N R LN  d A  S         i     N H S  N d   
   174   96 C K  T  4 S+     0   0  145  561   78   Y R     S  APWkr  v D . SS P P SP  i .  R         n     . . .  . t   
   175   97 C E  T  4 S+     0   0  174  569   91   W W     R  RKSKE  L Y . WR R L AK  R .  A         N     . R .  . S   
   176   98 C T  T  4 S-     0   0   44  598   57   T T     T  TTTPN  V Y . TS K T TT  L E  N         S     V T .  A S   
   177   99 C Y    ><  +     0   0   60  604   65   F T     Q  MFYML  F L . IL N I TM  L F  F         H     F M .  N N   
   178  100 C D  T 3   +     0   0   25  609   37   D D     E  EENDN  i T Q DD D Q DV  N p  H         p     m S t  d N   
   179  101 C F  T 3  S+     0   0   21  595   66   N F     N  NNNYR  n N d NN N N NN  . n  N         y     f N k  n .   
   180  102 C D    <   +     0   0    1  609    0   D D     D  DDDDD  D D d DD D D DD  D D  D         D     D D D  D D   
   181  103 C I        +     0   0    0  611   13   I V     I  FVIIV  V V I II F V II  I V  I         I     V I I  I I   
   182  104 C A  E     -MO 131 168C   0  611   60   M S     C  AAMAA  A A A MM M S MA  A A  A         A     A A G  A A   
   183  105 C V  E     -MO 130 167C   0  612   16   L I     L  LLLLL  L M L LL L I LV  V V  V         L     I V L  L L   
   184  106 C L  E     -MO 129 166C   0  613   30   I V     L  IVLLL  L L L II L L II  L L  L         V     A M I  L L   
   185  107 C R  E     -MO 128 165C  40  613   43   K K     R  EEKKH  K R E QK R V KK  T T  E         R     R R K  R R   
   186  108 C L  E     - O   0 163C   0  613   16   L I     L  LLLML  L L L LL L L LL  L L  L         L     L L L  T L   
   187  109 C K  S    S+     0   0  101  613   69   S N     S  SSADR  S E E QA N A SA  Q D  T         S     H Q S  S S   
   188  110 C T  S    S-     0   0   82  614   74   Q S     S  QQSGR  E R N ES R E ST  R E  S         R     G S R  S S   
   189  111 C P        -     0   0   48  614   39   P R     P  dDQAP  P H S PP P E PP  P P  L         S     K K A  N S   
   190  112 C I        -     0   0    4  562   63   A .     L  aPAFV  V L V AV V I A.  V L  .         V     L . A  I A   
   191  113 C T        -     0   0   95  566   73   Q .     S  PVDHT  P F T QA Q S T.  S V  .         K     N . T  R T   
   192  114 C F        +     0   0   56  612   34   L .     L  VLIFF  L F L LY F F LV  F Y  V         L     F I L  Y Y   
   193  115 C R  B >   -Q  196   0E  52  613   63   N .     N  ANNGS  G S G NS S S Nr  G N  r         G     S S S  H T   
   194  116 C M  T 3  S+     0   0   29  594   77   A C     T  LDTQD  E . P NA N D Qa  Q D  p         R     E . D  N .   
   195  117 C N  T 3  S+     0   0   13  602   90   N T     K  NFRFQ  T . N ED N G YH  C C  Y         H     N . Q  K .   
   196  118 C V  B <   +Q  193   0E   0  604   27   V G     V  PVVVI  I . L VV I R AV  V V  V         V     V . V  V .   
   197  119 C A        -     0   0    1  606   80   Q R     N  AMAGH  I R L QQ K R QR  Q Q  I         S     L . T  Q .   
   198  120 C P        -     0   0    8  608   54   P P     V  EPPPP  P S P PP K M AY  P P  P         P     P . S  P .   
   199  121 C A        -     0   0    2  609   39   A A     V  IIIVI  V V I II I V VV  I I  I         I     I . I  A N   
   200  122 C g  B     -c  290   0B   1  610   66   V P     R  TCPCC  C A C PA R C PQ  C C  C         C     C . C  E Y   
   201  123 C L        -     0   0   27  612    5   L L     L  LLLLL  L L L LL L P LL  V L  L         T     L . L  L V   
   202  124 C P        -     0   0    7  613   30   P A     P  PPAPP  P I P PP A P PA  P P  P         P     P . P  T S   
   203  124AC E     >  -     0   0   92  612   75   D E     A  TESES  P G D TS T S SN  E S  R         D     M . K  D P   
   204  125 C R  H  > S+     0   0  109  612   78   P R     Q  DRYPK  E M N ES R R SK  S A  F         N     L . S  R A   
   205  126 C D  H  > S+     0   0  124  612   85   T E     G  GPLKE  G A E CC C V CT  F G  R         F     E . T  D C   
   206  127 C W  H  >>S+     0   0    4  612   88   A P     A  SPVEV  N Y T PV P D VP  E D  G         K     P . D  I L   
   207  128 C A  I  X>S+     0   0    0  612   75   P A     E  EGAEA  T S F PK M S GA  T G  D         F     S . N  N P   
   208  129 C E  I  <5S+     0   0   75  613   82   P T     T  IEDFK  Y E Y VA D G TT  P A  L         F     T . F  T A   
   209  130 C S  I  <5S+     0   0   70  614   66   L G     A  LGNET  A Y d GG G n GG  Q A  L         K     A G P  D R   
   210  131 C T  I  <5S+     0   0   18  108   73   . S     .  .A...  . F d .. . d ..  . .  .         .     . . .  K .   
   211  131AC L  I ><  S-     0   0  119  503   80   . s     s  ...A.  . L . SS S s nL  . s  t         A     e g a  K .   
   227  146 C E  T 3  S+     0   0   47  527   75   Y E     G  G..E.  G Y . NS P S VT  . S  A         W     E Y F  Y .   
   228  147 C K  T 3  S+     0   0  169  548   68   N G     G  S..D.  D D . GG G G GC  G G  G         N     S E G  T .   
   229  149 C G  S <  S-     0   0   29  559   66   S G     S  Y..G.  G S . VS G G VS  G G  G         G     G K G  G .   
   230  150 C R        -     0   0  213  584   86   Y P     T  S..V.  T S . NS Y V RS  S Q  K         S     S E N  P .   
   231  151 C Q  B     -R  224   0F  79  599   93   L S     I  L.YV.  F L . YF F I RL  Q T  D         A     F L L  T .   
   232  152 C S        -     0   0   14  607   51   S P     P  PPPS.  P S A PP P A NP  P S  S         S     S A P  A .   
   233  153 C T  S    S+     0   0   48  608   73   P D     D  TEDQ.  M D F DE D D GT  E N  S         P     S K T  E .   
   234  154 C R  B    S-P  150   0D 102  608   85   V Q     I  KTNV.  K R N LI V I CT  V I  V         V     K S A  Y .   
   235  155 C L        -     0   0    3  610    3   L L     L  LLLLL  L L L LL L L RL  L L  L         L     L L L  L .   
   236  156 C K  E     -BD  98 221B  31  610   51   R Q     R  QMKQQ  Q Q R QQ Q R LQ  Q K  Q         R     R L Q  Q .   
   237  157 C M  E     -BD  97 220B  18  611   94   A E     K  KECDQ  E G F CC C A CE  K E  Q         E     E G K  K .   
   238  158 C L  E     - D   0 219B   4  612   44   V V     V  VIVVI  V V V IL G V VV  V V  A         A     T V V  T .   
   239  159 C E  E     - D   0 218B 107  612   72   D T     T  DENNH  H S R EQ V D YE  D T  V         W     H S V  E .   
   240  160 C V  E     - D   0 217B   0  612   46   V V     V  VIILL  V I L AA V V IV  L V  L         V     V V V  L .   
   241  161 C P  E     - D   0 216B  34  612   28   Q D     P  PPTPP  P P P PP Y I TD  K P  P         D     P D P  N .   
   242  162 C Y  E     -F  263   0B  36  613   46   I V     I  LITII  I L I IV T G VI  V T  V         L     I I I  I I   
   243  163 C V  E     -F  262   0B  24  614   37   I I     V  VVVLV  L V A LL I L LV  Y Y  W         S     I V V  V M   
   244  164 C D     >  -     0   0   88  613   57   S S     S  SDSTE  S S D SS S T GD  L S  K         V     P D S  D N   
   245  165 C R  H  > S+     0   0   51  613   78   N R     D  THNQQ  N H R DD N I KE  S G  N         F     I Q N  Y R   
   246  166 C N  H  > S+     0   0  105  614   74   C E     A  ARSED  E E E QR E Q HK  A A  E         D     V H P  N D   
   247  167 C S  H  > S+     0   0   48  614   78   R A     T  ATVEI  Q Q A EE E E SA  V D  D         V     V Q I  T K   
   248  168 C j  H  X S+     0   0    1  614    2   R C     C  CCCCC  C C C CC C C CC  C C  C         C     C C C  C C   
   249  169 C K  H >< S+     0   0   88  614   73   Y r     r  Ngqvr  h s q RR S r Ra  a a  n         f     n R n  K n   
   250  170 C L  H 3< S+     0   0  150  574   89   . v     s  Kactr  q y k QN R s Nf  n s  .         r     h R e  . k   
   251  171 C S  H 3< S+     0   0   23  604   76   Y Y     Y  APYL.  Y A N SA L Y SK  E Q  a         S     Y S S  R Y   
   252  172 C S    <<  -     0   0   20  607   83   Y G     G  YLPK.  F E S YY Y N YY  A T  Y         Y     F Y Y  E M   
   253  173 C S  S    S+     0   0   79  607   83   W S     A  NKSK.  R F N PP P S PG  S T  L         A     G G N  W N   
   254  174 C F  S    S-     0   0  124  607   79   G Y     T  NKDP.  F N D GG N S GS  T P  Q         G     R K G  T G   
   255  175 C I        -     0   0  100  608   87   M A     S  GKII.  Q N V SE G S DL  V S  P         K     V R G  F Q   
   256  176 C I        -     0   0   13  609   18   V V     I  IIISI  I V F II I I II  V N  I         I     D I V  I V   
   257  177 C T    >   -     0   0   16  614   35   T T     T  TTTGT  N T S TS T H TQ  T S  T         G     P T A  N S   
   258  178 C Q  T 3  S+     0   0  133  614   68   P G     N  DRDQD  D E Q DS R D NE  P D  N         K     L K S  Q P   
   259  179 C N  T 3  S+     0   0   24  614   60   N N     S  SDNTN  R S N NN N G NT  A L  N         R     S D H  G N   
   260  180 C M  E <   - G   0 311B   2  614   13   M M     M  MMMFM  M M M MM M M MM  V Q  F         F     M M M  H M   
   261  181 C F  E     - G   0 310B   8  613   35   L I     I  IILLF  M F F II L N IV  M L  L         I     I I L  I L   
   262  182 C j  E     +FG 243 309B   1  614    1   C C     C  CCCCC  C C C CC C C CC  C C  C         C     C C C  C C   
   263  183 C A  E     +FG 242 308B   0  614   26   A A     A  AAATA  A A S VV A A LA  A A  A         A     A A A  V A   
   264  184 C G  S    S-     0   0    3  614   10   G G     G  GGGGG  G G G GG G G GY  D G  G         G     G A G  G G   
   265  185 C Y        -     0   0   56  591   57   S G     F  Y.NFY  I Q . YF L I YA  N R  Y         Y     . A F  S Y   
   266  185AC D  S    S-     0   0   81  594   83   R G     R  E.MPK  P V . LL S E LV  D P  K         R     . P G  T D   
   267  185BC T  S    S+     0   0   76  614   61   L Q     L  GeADp  E e d EE S A EK  g v  Q         E     S G N  V E   
   268  186 C K  S    S-     0   0  107  563   32   G D     G  GgGGk  G g l GG G G G.  g g  G         G     G . G  . G   
   269  187 C Q  S    S+     0   0  102  569   37   G G     G  GGGGR  G G K GG G G G.  G G  G         G     G . G  Q G   
   270  188 C E        +     0   0   33  613   55   K K     A  KKERG  K K H IK T K KK  K A  K         I     A K K  Q R   
   271  189 C D  B     -A   94   0A   7  614    4   D D     D  DDDDD  D D D DD D D DD  D D  D         D     D D D  G D   
   272  190 C A        -     0   0    7  614   42   A A     S  SATAA  S S A SS S S AA  A S  A         A     A A A  S A   
   273  191 C k    >   -     0   0    7  614    3   C C     C  CCCCC  C C C CC C C CC  C C  C         C     C C C  C C   
   274  192 C Q  T 3  S+     0   0   90  614   25   Q Q     Q  QAVQE  Q Q Q QQ Q L KQ  Q Q  Q         A     Q T Q  L Q   
   275  193 C G  T 3  S+     0   0    6  614    8   G G     G  GGGGG  G G G GG G G YG  G G  G         Y     G G G  G G   
   276  194 C D    X   +     0   0    0  614    0   D D     D  DDDDD  D D D DD D D DD  D D  D         D     D D D  D D   
   277  195 C S  T 3  S+     0   0   14  614    1   S S     S  SSSSS  S S S SS S S SS  S S  S         S     S S S  S S   
   278  196 C G  T 3  S+     0   0    0  614    0   G G     G  GGGGG  G G G GG G G GG  G G  G         G     G G G  G G   
   279  197 C G    <   -     0   0    0  614    1   G G     G  GGGGG  G G G GG G G GG  G G  G         G     G G G  G G   
   280  198 C P  E     - H   0 294B   1  614    2   P P     P  PPPSP  P P V PP P P PP  P P  P         P     P P P  P P   
   281  199 C H  E     -EH 219 293B   0  614   49   L L     L  LMLLF  M V F VV L L VL  L L  L         L     L L L  L L   
   282  200 C V  E     -EH 218 291B   3  614   26   V V     V  VVVMV  H V A VV V V VV  M F  M         M     M V F  I V   
   283  201 C T  E     - H   0 290B   0  614   66   C Q     D  ATCCM  V M V CC C F CS  C C  L         C     C S C  A C   
   284  202 C R  E     + H   0 289B  99  614   70   N N     E  QLNRK  F N R DD K K NG  V P  R         P     Y G K  N N   
   285  203 C F  E >  S- H   0 288B  22  614   71   G G     G  ddGny  d G d GG D N GG  V V  I         g     s G t  D Y   
   286  204 C K  T 3  S-     0   0   85  222   71   . .     .  nt.ke  a . r .. . G ..  N N  K         d     r . h  . S   
   287  205 C D  T 3  S+     0   0  108  223   55   . .     .  NS.GN  N . D .. . E ..  G G  D         N     Q . N  . G   
   288  206 C T  E <   - H   0 285B   3  233   75   . .     T  QQ.AR  R . I .. . A ..  K Q  R         R     R . Q  . K   
   289  207 C Y  E     - H   0 284B  21  242   51   . .     N  TW.WW  F . W .. . F ..  Y Y  W         W     W . W  . W   
   290  208 C F  E     -cH 200 283B   0  613   91   R V     L  YYETY  V Y V ET E E QK  S V  T         L     E Q S  R T   
   291  209 C V  E     + H   0 282B   1  613   38   F L     L  LLLLQ  I L A LL L E LL  L Q  Q         L     L L L  L L   
   292  210 C T  E     +     0   0B   1  613   84   E Y     I  VVHAI  A V T QQ Q V QV  M Y  I         A     Q V V  I D   
   293  211 C G  E     -IH 312 281B   0  613    0   G G     G  GGGGG  G G G GG G G GG  G G  G         G     G G G  G G   
   294  212 C I  E     -IH 311 280B   0  613   19   I I     V  VIIVI  V V I VI I I IV  I I  I         I     V I L  I I   
   295  213 C V  E     +I  310   0B   7  613   14   V V     V  VVTTV  V V V VV V V VV  V V  V         V     V V V  I V   
   296  214 C S  E     -     0   0B   1  612    0   S S     S  SSSSS  S S S SS S S SS  S S  S         S     S S S  S S   
   297  215 C W  E     -I  309   0B  45  613    7   W W     W  WWWWW  W W W WW W W WW  S Y  F         W     W F W  F W   
   298  216 C G        -     0   0   26  613    0   G G     G  GGgGG  G G G GG g G GG  G G  G         G     G G G  G G   
   299  217 C E  S    S-     0   0   25  609   90   I S     I  QDyLE  F Y I RI q Q RI  R A  N         E     H A D  . Y   
   300  218 C G  S    S-     0   0   19  612   13   G G     G  GDVGG  G G G GG V G GG  G G  K         K     G E G  K G   
   301  220 C k  S    S-     0   0    7  613    2   C C     C  CCCCC  C C C CC C C CC  C C  C         C     C C C  M C   
   302  221 C A  S    S+     0   0    4  612   16   A G     A  AGGgD  A A G AA G A AG  A A  G         A     G A A  C A   
   303  222 C R    >   -     0   0  105  611   73   L R     D  RKCnR  Q E . LQ R Q LK  D D  E         M     R L K  A Q   
   304  223 C K  T 3  S+     0   0  152  611   64   P P     P  AKPQD  P P . PK R E PE  A A  P         P     N P P  A A   
   305  223AC G  T 3  S+     0   0   26  613   58   H G     G  NDNGG  R K E GG G G NG  G G  G         Y     N Q N  G Y   
   306  224 C K    <   -     0   0   43  613   85   F Y     Y  YRKSK  F Y G YY K Y SY  Q A  Y         K     I F K  K K   
   307  225 C Y        -     0   0   33  613   50   P P     Y  YYPPY  P P Y PP P P PP  A A  P         Y     P P Y  P P   
   308  226 C G  E     -G  263   0B   4  611    2   G G     G  GGGGG  G G G GG G G GG  G G  G         G     G G G  D G   
   309  227 C I  E     -GI 262 297B   6  612   11   V V     V  VVIIF  I V F VV V V VV  F I  V         V     V V V  V I   
   310  228 C Y  E     -GI 261 295B   1  612    1   Y Y     Y  YYFFY  Y Y Y YY Y Y YY  Y Y  Y         Y     Y Y Y  G Y   
   311  229 C T  E     -GI 260 294B   2  612   39   T S     T  ASATT  A S T TT T A TA  T A  T         T     A A T  T T   
   312  230 C K  E >   - I   0 293B  21  612   42   K N     Q  KYKDH  R K K KK R D KD  F D  R         N     K N R  R R   
   313  231 C V  G >  S+     0   0    1  611    8   V V     V  VVVLL  V V L VV V T VV  V T  V         V     I V V  V V   
   314  232 C T  G 3  S+     0   0    2  609   71   R A     S  SYFRF  N Y L CC C I CP  P S  S         N     R A T  F T   
   315  233 C A  G <  S+     0   0   29  609   79   N A     Y  NQNKR  R S N NN E Y NS  Y A  E         E     A E D  Y Q   
   316  234 C F  S <> S+     0   0    7  605   35   Y L     F  ANYVM  F F Y YY Y Y YL  F M  Y         F     V L F  Y F   
   317  235 C L  H  > S+     0   0   23  603   80   V R     H  IKLLG  I R V LV T L NR  R L  I         M     T K V  S V   
   318  236 C K  H  > S+     0   0  116  602   68   S P     N  EDNPR  S E D SS A D SS  D D  D         P     S P D  D S   
   319  237 C W  H  > S+     0   0   26  602    1   W F     W  WWWWW  W W W WW W W WW  W F  W         W     W W W  W W   
   320  238 C I  H  X S+     0   0    1  599   12   I I     V  IIIIM  I I I II I I IV  L I  I         I     V I I  I I   
   321  239 C D  H  < S+     0   0   66  570   71   E D        NQSHK  N Q K RQ H T TE  N N  K         R     N L G  R N   
   322  240 C R  H >< S+     0   0  136  556   71   G S        NRDKK    S K DE D E SK  A R  D         G     S S Q  S N   
   323  241 C S  H >< S+     0   0    6  523   72   I N        TVIHV    L E TT T N TT  Q V  N         S     Q A T  Y K   
   324  242 C M  T 3< S+     0   0   25  479   41   I L         TIII    L I II M M MA  I T  I         L     M I I  M M   
   325  243 C K  T <  S+     0   0  153  444   70   Q           KQQE      G AA R Q AK    G  K         K     K Q A    A   
   326  244 C T    <         0   0   51  390   65   S           VN K      D NA R   AA    A                      A    A   
   327  245 C R              0   0  197  273   47   N           RE S      E N  K   N                            N    N   
## ALIGNMENTS 1121 - 1190
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....3....:....4....:....5....:....6....:....7....:....8....:....9
     1   49 L Q              0   0  101  671   35  E E EE E    E E EEE EE EEE DEEE E E   E EDE   EQE EED      EEEQENE  EE
     2   50 L a    >   +     0   0   22  858    0  C C CCCCC   CCCCCCC CC CCC CCCC C C   C CCCC  CCC CCC    CCCCCCCCCC CC
     3   51 L E  T 3  S+     0   0  187  858   80  Q S LALDS   SKITASA II EQA AQKE T E   R LALE  ASE EEA    AFDEEALTIE QQ
     4   52 L T  T 3  S-     0   0  105  864   61  S T TSTPS   SSPPTDT DD HVT TVST R S   R PDPR  LPR SSS    PLSTTELAEP TT
     5   53 L S    <   +     0   0   89  868   72  Q D NNSDS   QYNDGNGHCC MHS FHSV N N   Y SSSS  NSQ NNS    SSNKKKNCEN EE
     6   54 L P        +     0   0   10  878   31  P P NPPPP   PPPPRPREPP NNN PNPP P P   P PPPPP NPP PPP    PPPEEPNSIP TT
     7   55 L b        -     0   0   18  893   21  CCC GCCCC   CCCCHCHCCC GGG CGCE C C  CGCCCCCC GCCCCCC    CCCDDCGCCC SS
     8   56 L Q  S    S+     0   0   92  892   83  QYK GRVQE   YQVLKGKSGG HGG KGHI H V  RRRHCHQL HNGQVVA    SERDDKPEDV NN
     9   57 L N  S    S-     0   0   63  893   51  NNN CNHNN   NNNNCECEAA CCC NCNC F N  NLNNQNNN CANNNNN    PNNCCNCNFN CC
    10   58 L Q  S    S-     0   0  152  893   57  GGG QGGGG   GGNNQNQYNN VQN GQNG E G  GCGGQGGQ QRGGGGG    FGGAAGEQEG AA
    11   59 L G        -     0   0   16  893   40  GGA HGSAa   GGGGHGHATT QHQ GHGl A G  GgGGVGGG HgTGGGG    AAGHHAHGEA HH
    12   60 L K  E     -S   23   0G 117  852   79  NQT TA.Tc   TTTTQDQTWW IRT TRVn V T  SkST.TTI Nr.STTT    VTSGGMNRAS GG
    13   61 L a  E     -S   22   0G  45  882   10  CCC CCCCC   CCCCCCCCCC CCC CCCC C C  CCCCCCCC CCCCCCC    CCCCCCCCKC CC
    14   62 L K  E     -S   21   0G 155  890   81  TDH VRMFE   VLTsRIRntt AVS LVKT E K  VEVHTHtV SEKvKKH    kEKRRLTDEM HH
    15   63 L X  E     +S   20   0G 120  768   39  DHD N.NDD   ..DdNNNadd NNN DNDN D .  .N.NNNvR NDN...D    l.DNNDND.D NN
    16   64 L G        -     0   0   44  862   73  LNG TDDEP   DNYGITIPEE TTS GTGY T D  .T.LNLPP GKT.DDG    GDLSSSEG.G TT
    17   65 L L  S    S-     0   0  152  871   64  VTL ALIVE   LTVAILILPP IRV IRIV D M  .P.VPVSE AKV.MMV    SLLPPVPM.L LL
    18   66 L G  S    S+     0   0   67  883   63  NGN GtGDG   pgNSGGGGGG GGG GGGG G t  QGQGGGGQ GGG.ttN    RgNGGGGe.G GG
    19   67 L E        -     0   0  119  837   61  A.S SsGSG   ghS.SSS... SSS ESTG S g  PSPGGGG. GDSpggD    TgDSSGGt.S SS
    20   68 L Y  E     -S   15   0G  37  883   11  Y.Y YYYYW   YYYYYFYYFF FYY YYFY Y Y  GYGFYFY. YFYGYYY    YYYYYYYG.Y YY
    21   69 L T  E     -S   14   0G  71  886   82  SET YRTTY   RTQQEEETTT KYS TYVY T V  HYHSESQ. SLNRVVS    EASTTDST.T VV
    22   70 L b  E     -S   13   0G  20  889    0  CCC CCCCC   CCCCCCCCCC CCC CCCC C C  CCCCCCCC CCCCCCC    CCCCCCCC.C CC
    23   71 L T  E     -S   12   0G  85  890   86  STA TDTED   QITTSKSATT SES LEHN T T  RSRSGSSE LHLNTTT    TTAIIVQV.R VV
    24   72 L c        -     0   0   44  890    0  CCC CCCCC   CCCCCCCCCC CCC CCCC C C  CCCCCCCC CCCCCCC    CCCCCCCC.C CC
    25   73 L L    >   -     0   0   62  890   88  PAV RRESP   AKLPRHRDLL YNL VNKL N R  PTPPYPLA DFYPRRP    KSPNNKAS.L NN
    26   74 L E  T 3  S+     0   0  177  890   75  APA TPNSL   PETAVAVAPP VPT DPPS S E  SVSDADSP STPAEEP    EAQAASTP.P AA
    27   75 L G  T 3  S+     0   0   29  893   20  GGG GGGGG   GGGGGGGGGG GGG GGGG G G  GGGGGGQG GGGGGGG    GGGAAGGGIG AA
    28   76 L F  E <   +T   36   0H  40  893    9  FFW YWWFF   YYFYFFFFFF FFY FFYF F F  WFWFYFFW YWFWFFY    FYFYYFFWFF YY
    29   77 L E  E     +T   35   0H  74  893   73  EME lREEH   AETSaaasvv qrt GrSI t S  QkQTrTTG qAqQSST    qVYeeSqEQN ee
    30   78 L G  S >  S-     0   0   32  889    5  GGG gGGGG   GGGGgsgggg qgg GgGS g G  GgGGgGGG gGnGGGG    gGGggGgG.G gg
    31   79 L K  T 3  S+     0   0  156  891   73  DDN HTTVP   IQKVVVVYLL KRD KRLN K P  DRDRCRRK LAGHPPR    KKKKKQHK.T KK
    32   80 L N  T 3  S-     0   0   33  892   62  NNN DNNNT   NNHNSVSVDD NTG HTLG T N  TSTASANH NRDTNNN    IHNQQNNNNR QQ
    33   81 L c  S <  S+     0   0    1  892    3  CCC CCCCC   CCCCCCCCCC CCT CCCT C C  CCCCCCCC CCCCCCC    CCCCCCCCVC CC
    34   82 L E        +     0   0   87  891   44  EED EQDEA   QQEEEQEEEE LIG EIEE T Q  QEQEEEEH TDIQQQS    QQEYYQTQDE YY
    35   83 L L  E    S-T   29   0H  96  889   88  VII DLQSL   EHIIDDDDDD DAA AAKQ D T  SASRDRSL DKDTTTA    PFVRREDKDT RR
    36   84 L F  E     -T   28   0H 139  889   83  DGE IDENF   EDNTVIVEII IVt DVDF t N  DLDDVDED VDVDNNP    IEsiiDVKTD ii
    37   85 L T        -     0   0   44  677   75  IcT ..IVT   .V.P...... .Lc MLIq i I  V.VI.IIV DV.VIIV    .ImmmLDLvv mm
    38   86 L R        +     0   0   57  408   92  .n. .N...   .......... ..n ...d . .  ........ .......    ...vvT..fc vv
    39   87 L K        +     0   0   96  535   81  .R. NN...   ....NDNDNN D.N ...G N .  D.D.D..D .DDD...    N..NNL..LA NN
    40   88 L L        -     0   0   91  608   90  .F. EE..N   ....EEEEEE ESE .S.T E .  E.E.E..E EEEE...    P..SSCE.NL SS
    41   89 L d  S  > S+     0   0   15  617   29  .G. CC..P   ....CCCCCC CCC .C.S C .  C.C.C..C CCCC...    C..CCVC.CG CC
    42   90 L S  T  4 S+     0   0   98  624   84  .R. SS..C   ....YAYFDD KSS .S.C I .  S.S.A..R LSSS...    V..EEMSGSP EE
    43   91 L L  T >4 S-     0   0  120  627   87  .D. VN..V   ....DEDDDD TVT .V.N T .  A.A.S..G TKTW...    D..NNEGSLL SS
    44   92 L D  G >4 S-     0   0  107  638   73  .C. GN..D   ....QEQENN DNA .N.D N .  GDG.S..G PRQG...    S..NNKPIDP NN
    45   93 L N  G >< S-     0   0    8  700   56  .S. NN..E   R.E.NNNSSS NNN .N.I T .  RLR.R..I DNRR...    N..NNDSPNE NN
    46   94 L G  G <  S-     0   0    0  882   52  DFD GGDNN   SDD.GGGDHH GGG DGNN H N  GNGNGNTT GGGGNNR    GD.GGKGKGV GG
    47   95 L D  G <  S+     0   0   44  887   62  EQE GGDDP   DDD.GGGWNN YGG EGEE D E  HEHEGEAL TGMDEER    GETGGGPEGS GG
    48   96 L e    <   -     0   0    0  892    0  CCC CCCCC   CCCCCCCCCC CCC CCCC C C  CCCCCCCC CCCCCCC    CCCCCCCCCS CC
    49   97 L D  S    S-     0   0   59  892   74  ADS QEAEM   RSETDDDDGG EEQ AETE V A  PDPLELFS QDRPAAE    PQASSSEQTG LL
    50   98 L Q  S    S+     0   0    2  892   63  sas HHspe   ntdpQHQrdd HHH sHse d s  QsQqHqpH HHnQssh    esdHHQHQHg HH
    51   99 L F  E     -U   62   0I   4  892   80  tat NNtlt   mrttIFIvvv YEI tEhk d t  RpRvHvsH IEqHttt    iqtHHFI.Yf HH
    52  100 L d  E     +U   61   0I  10  893    1  CCC CCCCC   CCCCCCCCCC CCC CCCC C C  CCCCCCCC CCCCCCC    CCCCCCCCCP CC
    53  101 L H  E     -U   60   0I  68  893   87  EAH IVTIV   KIVANENVTT VVN RVVG H I  ISIQTQDV INVVIIH    VKMQQKIHLF QQ
    54  102 L E  E     -U   59   0I  92  893   68  DGD NNDDP   DDDDNNNNNN NQN DQDP N D  NQNNNNPN NNNNDDE    YDEHHPNAER HH
    55  103 L E  S    S-     0   0  100  893   82  Ere TtgdP   egqDAsAeEE tlL ylEn t d  TeTFlFIt TtaTddR    rREssgTqeS ss
    56  104 L Q  S    S-     0   0  175  693   73  Qc. E.m.d   g...Q.Q.PP .pP .pRc . a  AnAP.P.. Q..Aaa.    pVg..vQd.v ..
    57  105 L N  S    S+     0   0  154  838   66  Ndn Gg.ns   nnngGgGgGG ghG nhNn g G  GgGGgGgg GggGGGg    GSgss.Gpgn gg
    58  106 L S  S    S-     0   0   58  853   65  GPS SSNSy   NWSsTSTTSS S.S S.Gs S .  SSSSSSaS SSSS..r    ESGGGSSVW. GG
    59  107 L V  E     -U   54   0I   7  890   79  YQY YYYYA   YFFYYHYFFF YFY YFYF H Y  YYYFFFFF FYFYYYY    AFYPPYFTR. PP
    60  108 L V  E     -U   53   0I  45  891   88  SGT SQTTY   TLRLTVTSTT YQA TQHI K K  WQWNQNIT RRLRKKV    TLSVVERGR. VV
    61  109 L e  E     +U   52   0I   5  893    1  CCC CCCCC   CCCCCCCCCC CCC CCCC C C  CCCCCCCC CCCCCCC    CCCCCCCCCY CC
    62  110 L S  E     -U   51   0I  24  893   75  LSA STSEL   LEQSATANPP SRS TRTS T N  QYQVSVSS SSVQNNE    VLHTTSSQST TT
    63  111 L f        -     0   0   23  893    0  CCC CCCCC   CCCCCCCCCC CCC CCCC C C  CCCCCCCC CCCCCCC    CCCCCCCCCC CC
    64  112 L A    >   -     0   0    8  893   75  AAV RREAP   RAVPGRGNAA ERN PRAL K L  WRWKEKKP RHNQLLA    KEPNNARKAM NN
    65  113 L R  T 3  S+     0   0  149  893   80  VTD TDNTR   SPPAGAGSDD RRS LRKR H L  ERETATSQ PQDELLR    SPAHHPPPPE HH
    66  114 L G  T 3  S+     0   0   24  893    8  GGG GGGGG   GGGGGGGGGG GGG GGGG G P  GGGGGGGG GGGGPPG    GGGGGGGGGG GG
    67  115 L Y  E <   -V   78   0J  20  893   11  FFW YYWFF   YFYYFFFYYY FYY FYFY Y Y  HYHYYYLL YYYHYYY    MYYYYWYFYF YY
    68  116 L T  E     -V   77   0J  72  891   85  ITE QQTDT   TAVSVEVVSS VQQ SQTT T T  SQSTRTTV QVERTTG    STTRRKQQKT RR
    69  117 L L  E     -V   76   0J  67  888   64  GGG QIGGG   GGGGLILTKK LLL SLGS G G  LLLGLGGL LLLLGGG    RGGLLLLGLL LL
    70  118 L A    >   -     0   0   23  889   78  TII AIKVK   VPQDDSDVSS ATQ TTAP D A  SSSVHVVG HVTSAAP    RYSDDSHNGK DD
    71  119 L D  T 3  S+     0   0  175  889   77  NDH EGDNV   DDLNRRRDtt AAP NAHA G T  AdAFEFTP IELATTN    THNDDtIGDr DD
    72  120 L N  T 3  S-     0   0   92  694   44  .C. .....   ....DND.gg DDD .D.. . .  DdD.D..D DRDD...    PC.DDdD.Dg DD
    73  121 L G  S <  S+     0   0   16  713   66  .T. .S...   ....GGGADD GGA .G.G K .  GGGGRG.G GHGG...    SE.LLRG.LS LL
    74  122 L K  S    S+     0   0   71  687   76  .E. RR...   ....RRRKDD FKK .K.P D .  TVTKRK.H HIRT...    SL.KKNYTLV KK
    75  123 L A        -     0   0   22  685   66  .A. SY...   ....SSSRTT SRS .R.W L .  FTFHGH.T TYTL...    EA.TTTTFQS TT
    76  124 L f  E     -V   69   0J  12  847    9  CCC CCCCC   CCCCCCCCCC CCC CCCF C C  CCCCCCCC CCCCCCC    CSCCCCCCCC CC
    77  125 L I  E     -V   68   0J  78  846   80  ESD YTDEE   DRQESFSRVV IRI QREM T E  VEVESEEA VVTLEEQ    SDELLMVIQL II
    78  126 L P  E     -V   67   0J  62  850   71  qPi DeQTT   IMDIRNRdDD LLN tLSp N E  PDPlPlEE DDDPEEF    aPKDDPDPPA DD
    79  127 L T  S    S+     0   0  103  652   80  p.. .dGTT   TNKTI.IdTT K.. ..Eh . .  K.K...DG ...M...    .CR..A.EA. ..
    80  128 L G  S    S-     0   0   32  788   69  sg. IevVV   IVVpdIdenn k.I ..VG V V  GIG...Iv IiIRVVl    .FLVVgVpV. VV
    81  129 L P  S    S+     0   0  116  601   75  dgt .sg.P   ..Dpe.edcc sR. dR.. . L  ...s.s.e .v..LLp    pS...l.pK. ..
    82  130 L Y  S    S+     0   0   59  794   86  YAD DNG.T   DNYEYNYYII QNN ENNT N A  .D.Y.YNP DDN.AAE    SSGDDFNDF. DD
    83  131 L P    >   -     0   0   17  799   62   GE EPE.D   PE PSESPPP IPE DPED E P  .E.G.GEP EEE.PPP    DPREESELP. EE
    84  132 L g  T 3  S+     0   0   16  800    5   CC CCCCC   CC CSCSCCC CCC CCCC C C  .C. . CP CCC.CCP    CCCCCYCCCS CC
    85  133 L G  T 3  S+     0   0    0  712   37   AS SH DT   SA   T DDD D T T    S A  GAG . EG  DAGAAG     GSGGS SGG GG
    86  134 L K    <   -     0   0   69  588   68   QS SN N     S      SS Q          K  P P . KA  N PKKP     SS  S  RK   
    87  135 L Q        -     0   0   37  477   65       N                 L             P P .  S  P P  V         I       
    88  136 L T        +     0   0    4  428   78       G                               R R .  I  G M  V         K       
    89  137 L L        +     0   0  105  372   61       I                               L L L  L  V V  V         A       
    90  138 L E              0   0  104  274   69       C                               A A E  S    A  D         G       
    91  139 L R              0   0  231  199   47       R                                                        K       
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2     I     III          I   I    I I II        I       IIIM          I  
    94   17 C V  B     -A  271   0A   7  590    9     V     VVV          V   V    V V KI        K       KVKV          V  
    95   18 C G  S    S+     0   0   25  591    6     G     NNN          R   G    G G GG        G       GGGG          G  
    96   19 C G  S    S-     0   0   26  592    0     G     GGG          G   G    G G GG        G       GGGG          G  
    97   20 C Q  E     -B  237   0B  98  593   95     T     KVV          S   V    Q I LD        L       LKLQ          Q  
    98   21 C E  E     -B  236   0B  80  594   67     E     QEE          V   P    D E FK        F       FEFD          D  
    99   22 C h        -     0   0    8  594   58     A     STT          V   A    A A AA        A       AAAA          A  
   100   23 C K    >   -     0   0  123  593   78     D     TTT          R   D    T E DQ        D       DPDM          P  
   101   24 C D  T 3  S+     0   0   60  594   85     P     III          P   W    P E IP        I       IRIE          P  
   102   25 C G  T 3  S+     0   0    0  595   74     G     EEE          H   G    R E AG        A       ASAG          G  
   103   26 C E  S <  S+     0   0   36  595   66     T     AKN          S   Q    E E SN        S       SKSE          H  
   104   27 C h    >   +     0   0    4  595   92     I     RRR          L   L    F W HF        H       HWHW          W  
   105   28 C P  T 3   +     0   0    0  599    9     P     PPP          P   P    P P PP        P       PPPP          P  
   106   29 C W  T 3  S+     0   0    5  600   26     W     YYY          W   F    W W WW        W       WWWW          W  
   107   30 C Q  E <   -J  122   0C   7  601   26     q     QQQ          q   V    M q qq        q       qqqQ          m  
   108   31 C A  E     -JK 121 146C   1  593   49     w     VVV          i   V    V r ri        k       rlrV          l  
   109   32 C L  E     -JK 120 145C   3  598   68     D     SSS          D   A    S I RR        R       RRRS          N  
   110   33 C L  E     -JK 119 144C   0  601    9     V     LLL          N   L    I M LV        L       LLLI          I  
   111   34 C I  E     -JK 117 143C   0  601   81     R     QQQ          K   E    T R PQ        P       PHPQ          T  
   112   35 C N  E >   - K   0 142C  30  601   88     P     kdK          s   S    R R Gg        G       GDGR          S  
   113   36 C E  T 3  S+     0   0   63  117   78     T     anE          d   P    . G ..        .       .Q..          D  
   114   37 C E  T 3  S-     0   0  136  242   77     R     GSR          D   R    K S ..        .       .Y.N          G  
   115   38 C N  S <  S+     0   0   84  565   53     N     GGG          A   G    G W ..        .       .W.G          V  
   116   39 C E        -     0   0  100  589   94     R     RNS          E   Q    G K E.        E       EMES          E  
   117   40 C G  E     +J  111   0C  14  600   57     H     HHH          D   Q    H H R.        R       RHRH          K  
   118   41 C F  E     +     0   0C  28  611   33     F     FFF          t   L    F L f.        f       fFfF          w  
   119   42 C i  E     -J  110   0C   0  612    1     C     CCC          c   C    C C cs        c       cCcC          c  
   120   43 C G  E     -J  109   0C   1  612    1     G     GGG          G   G    G G GG        G       GGGG          G  
   121   44 C G  E     -J  108   0C   0  612    9     G     GGG          G   A    G A GG        G       GGGG          G  
   122   45 C T  E     -JL 107 130C   0  612   45     A     SSS          S   A    T S IA        I       ISIS          T  
   123   46 C I  E     + L   0 129C   0  612   23     L     III          L   I    I L LL        L       LLLL          I  
   124   47 C L        -     0   0    6  612   27     V     III          L   L    L I IL        I       IIII          L  
   125   48 C S  S    S-     0   0   22  612   56     N     SSS          k   N    N H SG        S       SHST          N  
   126   49 C E  S    S+     0   0   99  612   63     S     EEE          s   E    D P SD        S       SPSE          S  
   127   50 C F  S    S+     0   0   42  612   83     Q     DDD          N   R    K N CR        C       CQCQ          E  
   128   51 C Y  E     - M   0 185C   7  612   34     W     III          I   W    F W WW        W       WWWW          W  
   129   52 C I  E     -LM 123 184C   0  612   14     V     VIV          V   L    I I IV        I       IVIV          V  
   130   53 C L  E     +LM 122 183C   0  612   27     V     VVV          L   A    L L LL        L       LLLL          L  
   131   54 C T  E     - M   0 182C   0  612   43     T     TTT          T   T    T T ST        S       STST          T  
   132   55 C A    >>  -     0   0    0  613    2     A     AAA          A   A    A A AA        A       AAAA          A  
   133   56 C A  G >4 S+     0   0    0  613    9     A     AAA          A   A    G G AA        A       AAAA          A  
   134   57 C H  G >4 S+     0   0    7  613    0     H     HHH          H   H    H H HH        H       HHHH          H  
   135   58 C i  G X4 S+     0   0    0  613    1     C     CCC          C   S    C C CI        C       CCCC          C  
   136   59 C L  G << S+     0   0   31  613   66     I     LVV          L   H    L F FF        F       FVFF          W  
   137   60 C Y  G <  S+     0   0  109  613   87     V     QTA          Y   Q    C G QR        Q       QGQY          V  
   138   61 C Q  S <  S+     0   0   95  613   78     E     rgy          a   I    s l ep        e       epen          t  
   139   61AC A        -     0   0   16  373   75     .     ppl          k   .    i p pl        p       plpt          i  
   140   62 C K  S    S-     0   0  172  387   77     .     SSS          S   V    G S HE        H       HAHS          R  
   141   63 C R  S    S-     0   0  162  602   78     .     DQE          N   A    Q N HQ        H       HNHL          R  
   142   64 C F  E     -K  112   0C  36  609   54     .     LLL          I   I    L Y LV        L       LLLY          S  
   143   65 C K  E     -K  111   0C  67  609   79     .     QKQ          T   A    R M TD        T       TRTR          M  
   144   66 C V  E     -KN 110 161C   0  609   16     .     VVV          V   G    V I VV        V       VVVV          V  
   145   67 C R  E     -KN 109 160C  40  609   55     .     RRR          V   S    T Q IF        I       IQIL          W  
   146   68 C V  E     +KN 108 159C   1  610   43     .     LLL          L   L    L L LL        L       LLLL          I  
   147   69 C G  S    S+     0   0    9  610   15     .     GGG          G   D    G R GG        G       GRGG          G  
   148   70 C D        +     0   0   11  611   58     .     SSS          V   P    E Q RH        R       RERA          S  
   149   71 C R  S    S+     0   0   24  611   73     .     TTT          H   S    H Q TT        T       TQTR          Y  
   150   72 C N  B >   -P  234   0D  18  611   65     .     YYY          N   S    N N YD        Y       YHYQ          S  
   151   73 C T  T 3  S+     0   0   56  611   80     .     HNN          R   S    L L RL        R       RLRL          L  
   152   74 C E  T 3  S-     0   0  119  611   84     .     DNN          L   A    R Y VE        V       VYVL          R  
   153   75 C Q  S <  S-     0   0  130  610   85     .     EEE          I   S    A E VE        V       VYVQ          K  
   154   76 C E        +     0   0  165  610   85     .     GGG          K   s    P G Pi        P       PQPP          A  
   155   77 C E        -     0   0   93  469   27     .     ...          E   n    E . .l        .       ....          .  
   156   78 C G  S    S+     0   0   46  578   34     .     GGG          S   A    V . GG        G       G.GG          .  
   157   79 C G  S    S+     0   0   47  585   75     .     MII          N   s    p . eA        e       e.ep          S  
   158   80 C E        -     0   0   37  472   30     .     ...          Q   r    a D e.        e       eDes          A  
   159   81 C A  E     -N  146   0C  27  487   57     .     ...          M   Q    R N Q.        Q       QQQI          R  
   160   82 C V  E     -N  145   0C  71  590   83     .     LVV          V   V    H L K.        K       KLKY          Y  
   161   83 C H  E     -N  144   0C  14  599   76     .     AVV          R   S    E L FH        F       FLFA          M  
   162   84 C E        -     0   0   90  602   78     .     GGG          K   E    S P EP        E       EPEH          A  
   163   85 C V  E     -O  186   0C  27  607   64     .     VVV          V   G    V L VV        V       VVVV          V  
   164   86 C E  E    S+     0   0C  70  608   73     .     KKK          A   A    I E ER        E       ESEK          L  
   165   87 C V  E     -O  185   0C  13  609   72     .     SAA          D   E    N Q KR        K       KRKR          Y  
   166   88 C V  E     -O  184   0C  72  610   46     .     FLM          V   V    A I YV        Y       YIYV          V  
   167   89 C I  E     +O  183   0C  27  610   43     .     KKK          K   R    V I IV        I       IIIE          I  
   168   90 C K  E     -O  182   0C  68  610   82     .     YYY          I   L    L V VI        V       VVVS          T  
   169   91 C H    >   -     0   0   19  611   13     .     HHH          H   A    H H HH        H       HHHN          H  
   170   92 C N  T 3  S+     0   0  156  611   61     .     EEE          S   P    P P KP        K       KPKP          P  
   171   93 C R  T 3  S+     0   0  150  608   73     .     KKK          S   G    G . ED        E       EQEL          D  
   172   94 C F    <   -     0   0   24  611    5     .     FYF          F   Y    H Y FY        F       FFFY          F  
   173   95 C T     >  -     0   0   56  611   68     .     GDD          S   a    k F DR        D       DYDQ          k  
   174   96 C K  T  4 S+     0   0  145  561   78     .     .RG          .   g    g . DP        D       D.D.          h  
   175   97 C E  T  4 S+     0   0  174  569   91     .     MDD          .   T    K A DD        D       D.D.          N  
   176   98 C T  T  4 S-     0   0   44  598   57     .     RLI          .   Q    Y D TD        T       TAT.          G  
   177   99 C Y    ><  +     0   0   60  604   65     .     LLL          L   L    V V YP        Y       YVY.          Y  
   178  100 C D  T 3   +     0   0   25  609   37     .     MWW          d   D    D r Dd        D       DqDg          V  
   179  101 C F  T 3  S+     0   0   21  595   66     .     YYY          y   .    . f Nf        N       NaN.          N  
   180  102 C D    <   +     0   0    1  609    0     .     DDD          D   .    D D Dd        D       DDDd          D  
   181  103 C I        +     0   0    0  611   13     .     III          I   L    I L II        I       IIIV          L  
   182  104 C A  E     -MO 131 168C   0  611   60     .     AAA          A   A    A A AA        A       AAAA          A  
   183  105 C V  E     -MO 130 167C   0  612   16     .     VVI          I   L    L L LL        L       LLLL          L  
   184  106 C L  E     -MO 129 166C   0  613   30     .     ILL          L   I    L L LL        L       LLLV          V  
   185  107 C R  E     -MO 128 165C  40  613   43     .     KKK          L   R    E K QE        Q       QEQE          R  
   186  108 C L  E     - O   0 163C   0  613   16     .     LLL          L   L    F L LL        L       LLLL          L  
   187  109 C K  S    S+     0   0  101  613   69     .     DED          N   K    A E KE        K       KEKE          K  
   188  110 C T  S    S-     0   0   82  614   74     A     QKK          E   R    R S SD        S       SESA          K  
   189  111 C P        -     0   0   48  614   39     E     APP          P   P    P P dG        d       dPdP          K  
   190  112 C I        -     0   0    4  562   63     V     V..          V   F    I A cV        c       cVcV          I  
   191  113 C T        -     0   0   95  566   73     L     K..          E   K    S Q AK        A       ANAT          T  
   192  114 C F        +     0   0   56  612   34     Y     QVV          F   W    W L QL        Q       QVQF          F  
   193  115 C R  B >   -Q  196   0E  52  613   63     T     Skk          N   r    S T eG        e       eSeT          S  
   194  116 C M  T 3  S+     0   0   29  594   77     D     Sss          D   g    E E sP        s       sSsN          R  
   195  117 C N  T 3  S+     0   0   13  602   90     Y     TTT          Y   I    S N VD        V       VHVY          G  
   196  118 C V  B <   +Q  193   0E   0  604   27     I     VII          V   V    V I VL        V       VVVI          V  
   197  119 C A        -     0   0    1  606   80     L     RRR          R   E    K Q RL        R       RHRL          A  
   198  120 C P        -     0   0    8  608   54     P     YYY          P   P    P P TP        A       TTTP          P  
   199  121 C A        -     0   0    2  609   39     V     III          V   V    A V VI        V       VVVV          V  
   200  122 C g  B     -c  290   0B   1  610   66     C     EEE          C   C    C T CC        C       CTCC          R  
   201  123 C L        -     0   0   27  612    5     L     LMM          I   L    L L LL        L       LLLM          L  
   202  124 C P        -     0   0    7  613   30     P     TAA          P   P    P P PP        P       PPPP          P  
   203  124AC E     >  -     0   0   92  612   75     S     KKK          S   K    V S PD        P       PPPD          N  
   204  125 C R  H  > S+     0   0  109  612   78     V     EKK          K   D    A S AP        A       AAAP          P  
   205  126 C D  H  > S+     0   0  124  612   85     G     TVV          T   R    T S DA        D       DLDS          T  
   206  127 C W  H  >>S+     0   0    4  612   88     R     PPP          T   A    G Q LN        L       LELV          N  
   207  128 C A  I  X>S+     0   0    0  612   75     A     KKK          Y   A    K I QV        Q       QTQV          T  
   208  129 C E  I  <5S+     0   0   75  613   82     R     TTT          N   M    P F LS        L       LFLF          F  
   209  130 C S  I  <5S+     0   0   70  614   66     R     GGG          E   D    g T PY        P       PPPE          S  
   210  131 C T  I  <5S+     0   0   18  108   73     L     ...          R   .    s . ..        .       ...T          .  
   211  131AC L  I ><  S-     0   0  119  503   80     V     FFF          s   e    . g A.        A       AdA.          .  
   227  146 C E  T 3  S+     0   0   47  527   75     E     TVS          E   E    . V L.        L       LVL.          .  
   228  147 C K  T 3  S+     0   0  169  548   68     G     NSV          N   G    K H S.        S       SRS.          P  
   229  149 C G  S <  S-     0   0   29  559   66     G     CCC          A   V    Y L P.        P       PLP.          L  
   230  150 C R        -     0   0  213  584   86     P     HPP          E   N    K Y FR        F       FPFP          P  
   231  151 C Q  B     -R  224   0F  79  599   93     Y     ALL          L   M    R P YL        Y       YPYN          N  
   232  152 C S        -     0   0   14  607   51     S     SSS          S   S    A P SS        S       SPSP          P  
   233  153 C T  S    S+     0   0   48  608   73     N     RPP          S   N    D Y ED        E       EYER          E  
   234  154 C R  B    S-P  150   0D 102  608   85     V     VVV          V   K    V T RQ        R       RPRI          T  
   235  155 C L        -     0   0    3  610    3     L     LLL          L   L    L L LL        L       LLLL          L  
   236  156 C K  E     -BD  98 221B  31  610   51     K     MMM          Q   H    Q R KK        K       KQKQ          Q  
   237  157 C M  E     -BD  97 220B  18  611   94     K     EEE          Q   R    K K EY        E       EEEK          Q  
   238  158 C L  E     - D   0 219B   4  612   44     V     VVV          A   V    V V AV        A       AVAL          L  
   239  159 C E  E     - D   0 218B 107  612   72     L     EEE          T   Q    E Q HR        H       HEHA          Q  
   240  160 C V  E     - D   0 217B   0  612   46     I     LVV          V   V    V V VL        V       VVVV          L  
   241  161 C P  E     - D   0 216B  34  612   28     P     GTT          P   P    R P RP        R       RPRP          P  
   242  162 C Y  E     -F  263   0B  36  613   46     R     FFF          I   L    V V LV        L       LILI          I  
   243  163 C V  E     -F  262   0B  24  614   37     V     LLL          M   M    V M YA        Y       YVYI          V  
   244  164 C D     >  -     0   0   88  613   57     S     EEE          S   S    T D PA        P       PEPD          L  
   245  165 C R  H  > S+     0   0   51  613   78     Q     RRR          D   R    N A SR        S       SNST          Q  
   246  166 C N  H  > S+     0   0  105  614   74     G     QEE          K   A    A L SD        S       SQSP          S  
   247  167 C S  H  > S+     0   0   48  614   78     R     DDD          E   E    V T RT        R       RLRK          V  
   248  168 C j  H  X S+     0   0    1  614    2     C     CCC          C   C    C C CC        C       CCCC          C  
   249  169 C K  H >< S+     0   0   88  614   73     r     aaa          s   e    d d tq        t       tdtn          K  
   250  170 C L  H 3< S+     0   0  150  574   89     a     yyy          s   a    q d vh        v       vgvs          .  
   251  171 C S  H 3< S+     0   0   23  604   76     H     FLL          N   G    G S .R        .       .D.F          E  
   252  172 C S    <<  -     0   0   20  607   83     P     YYY          R   Y    K S .R        .       .S.Q          K  
   253  173 C S  S    S+     0   0   79  607   83     Q     GGG          I   A    S E .A        .       .F.P          Y  
   254  174 C F  S    S-     0   0  124  607   79     Y     DEE          L   I    F R .D        .       .R.K          P  
   255  175 C I        -     0   0  100  608   87     D     DQQ          Y   P    S I .V        .       .I.A          E  
   256  176 C I        -     0   0   13  609   18     V     III          S   I    V I .F        .       .V.I          L  
   257  177 C T    >   -     0   0   16  614   35     T     KKK          P   D    E L TS        T       TRTK          T  
   258  178 C Q  T 3  S+     0   0  133  614   68     R     EEE          I   K    T D DQ        D       DDDD          D  
   259  179 C N  T 3  S+     0   0   24  614   60     N     TTT          T   T    K N NN        N       NDND          N  
   260  180 C M  E <   - G   0 311B   2  614   13     M     MMM          M   K    Q M MM        M       MMMM          M  
   261  181 C F  E     - G   0 310B   8  613   35     F     VVV          L   I    M L LF        L       LLLL          L  
   262  182 C j  E     +FG 243 309B   1  614    1     C     CCC          C   C    C C CC        C       CCCC          C  
   263  183 C A  E     +FG 242 308B   0  614   26     A     AGG          A   A    A A AA        A       AAAA          A  
   264  184 C G  S    S-     0   0    3  614   10     G     YYY          G   G    G G GG        G       GGGG          G  
   265  185 C Y        -     0   0   56  591   57     R     AAA          .   W    W . ..        .       .S.F          .  
   266  185AC D  S    S-     0   0   81  594   83     P     KKK          .   P    E . ..        .       .E.A          .  
   267  185BC T  S    S+     0   0   76  614   61     G     EEE          k   Q    E T dd        d       dKdE          d  
   268  186 C K  S    S-     0   0  107  563   32     G     ...          g   G    G I gq        g       g.gG          g  
   269  187 C Q  S    S+     0   0  102  569   37     G     ...          S   G    G Y GR        G       G.GK          G  
   270  188 C E        +     0   0   33  613   55     E     KKK          S   Q    K R PQ        P       PHPK          K  
   271  189 C D  B     -A   94   0A   7  614    4     D     DDD          D   D    D D QD        Q       QDQD          G  
   272  190 C A        -     0   0    7  614   42     A     SAA          S   A    S A AA        A       ASAA          P  
   273  191 C k    >   -     0   0    7  614    3     C     CCC          C   C    C C NC        N       NCNC          C  
   274  192 C Q  T 3  S+     0   0   90  614   25     D     QQQ          Q   Q    W Q LQ        L       LQLK          K  
   275  193 C G  T 3  S+     0   0    6  614    8     G     GGG          G   G    A G HG        H       HGHG          G  
   276  194 C D    X   +     0   0    0  614    0     D     DDD          D   D    D D dD        d       dDdD          D  
   277  195 C S  T 3  S+     0   0   14  614    1     S     SSS          S   S    S S sS        s       sSsS          Y  
   278  196 C G  T 3  S+     0   0    0  614    0     G     GGG          G   G    G G GG        G       GGGG          G  
   279  197 C G    <   -     0   0    0  614    1     G     GGG          G   G    G G GG        G       GGGG          G  
   280  198 C P  E     - H   0 294B   1  614    2     P     PPP          P   P    P P PV        P       PPPP          P  
   281  199 C H  E     -EH 219 293B   0  614   49     F     LFF          L   L    L L LF        L       LLLL          L  
   282  200 C V  E     -EH 218 291B   3  614   26     T     VVV          I   V    M V VA        V       VVVV          L  
   283  201 C T  E     - H   0 290B   0  614   66     V     GAA          C   V    V C CV        C       CCCC          C  
   284  202 C R  E     + H   0 289B  99  614   70     F     EDE          K   S    G N LQ        L       LKLF          Y  
   285  203 C F  E >  S- H   0 288B  22  614   71     D     GGG          a   Q    s V Nd        N       NVNM          G  
   286  204 C K  T 3  S-     0   0   85  222   71     E     ...          t   D    a Q Gs        D       GNGN          D  
   287  205 C D  T 3  S+     0   0  108  223   55     D     ...          G   G    G D GD        G       GGGQ          S  
   288  206 C T  E <   - H   0 285B   3  233   75     R     ...          Q   V    P F RR        R       RTRT          G  
   289  207 C Y  E     - H   0 284B  21  242   51     E     ...          W   F    L W MW        M       MWMW          F  
   290  208 C F  E     -cH 200 283B   0  613   91     Y     KKK          V   V    M L TV        T       TLTV          V  
   291  209 C V  E     + H   0 282B   1  613   38     L     LLL          Q   L    V Q LA        L       LQLQ          Q  
   292  210 C T  E     +     0   0B   1  613   84     L     VVV          F   T    I A VS        V       VAVA          V  
   293  211 C G  E     -IH 312 281B   0  613    0     G     GGG          G   G    G G GG        G       GGGG          G  
   294  212 C I  E     -IH 311 280B   0  613   19     V     VAV          I   V    V I II        I       IVIV          I  
   295  213 C V  E     +I  310   0B   7  613   14     V     VVV          T   V    V V IV        I       IVII          M  
   296  214 C S  E     -     0   0B   1  612    0     S     SSS          S   S    S S SS        S       SSSS          S  
   297  215 C W  E     -I  309   0B  45  613    7     W     WWW          F   G    T F WW        W       WWWW          Y  
   298  216 C G        -     0   0   26  613    0     G     GGG          G   G    G G GG        G       GGGG          g  
   299  217 C E  S    S-     0   0   25  609   90     D     ELE          I   I    I E LI        L       LELE          g  
   300  218 C G  S    S-     0   0   19  612   13     G     GGR          G   G    G N GG        G       GGGG          G  
   301  220 C k  S    S-     0   0    7  613    2     C     CCC          C   C    C C CC        C       CCCC          C  
   302  221 C A  S    S+     0   0    4  612   16     A     AAA          G   A    S G GG        G       GAGA          A  
   303  222 C R    >   -     0   0  105  611   73     L     QML          R   R    R A Q.        Q       QLQR          L  
   304  223 C K  T 3  S+     0   0  152  611   64     A     RDD          M   P    S P K.        K       KPKQ          P  
   305  223AC G  T 3  S+     0   0   26  613   58     G     GGG          F   G    R H DK        D       DNDN          G  
   306  224 C K    <   -     0   0   43  613   85     K     YYY          Y   L    L R VG        V       VRVR          Q  
   307  225 C Y        -     0   0   33  613   50     F     PPP          P   P    P P PY        P       PPPP          P  
   308  226 C G  E     -G  263   0B   4  611    2     G     GGG          G   G    G G GG        G       GGGG          G  
   309  227 C I  E     -GI 262 297B   6  612   11     V     VVV          I   L    I I VF        V       VIVV          V  
   310  228 C Y  E     -GI 261 295B   1  612    1     Y     YYY          Y   Y    Y Y YY        Y       YYYY          Y  
   311  229 C T  E     -GI 260 294B   2  612   39     T     AAA          T   T    V T TT        T       TTTI          T  
   312  230 C K  E >   - I   0 293B  21  612   42     R     DDD          R   N    R S KN        K       KRKR          Q  
   313  231 C V  G >  S+     0   0    1  611    8     L     VVV          V   V    V V VV        V       VVVV          V  
   314  232 C T  G 3  S+     0   0    2  609   71     H     AAA          S   A    S P TL        T       TTTT          S  
   315  233 C A  G <  S+     0   0   29  609   79     K     AAA          V   H    D A NK        N       NYNS          K  
   316  234 C F  S <> S+     0   0    7  605   35     F     LLL          F   F    Y F YY        F       YYYH          Y  
   317  235 C L  H  > S+     0   0   23  603   80     F     ARR          Y   L    V V LV        L       LLLH          L  
   318  236 C K  H  > S+     0   0  116  602   68     A     DDN          T   P    P D DA        D       DDDD          R  
   319  237 C W  H  > S+     0   0   26  602    1     W     WWW          W   W    W W WW        W       WWWW          Y  
   320  238 C I  H  X S+     0   0    1  599   12     I     IIV          I   I    I I II        I       IIII          I  
   321  239 C D  H  < S+     0   0   66  570   71                        D   L    T Q QQ        H       QHQH          N  
   322  240 C R  H >< S+     0   0  136  556   71                        K   D    Q S DE        D       DRDR          D  
   323  241 C S  H >< S+     0   0    6  523   72                        A   I    E Q NV        N       NYNI          Y  
   324  242 C M  T 3< S+     0   0   25  479   41                        V   I    V I MV        M       MVMI          I  
   325  243 C K  T <  S+     0   0  153  444   70                        S   K    Q   QG        R       QPQP             
   326  244 C T    <         0   0   51  390   65                        E   K    S   PE        P       PEPE             
   327  245 C R              0   0  197  273   47                            R    R                      K               
## ALIGNMENTS 1191 - 1260
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....0....:....1....:....2....:....3....:....4....:....5....:....6
     1   49 L Q              0   0  101  671   35  E      ED N HD  E E D EE EQQQQQQE   EE N E  E    E H  DEEEEE  EEEEE KD
     2   50 L a    >   +     0   0   22  858    0  CCCC CCCC CCCC  CCCCC CCCCCCCCCCC   CC CCC  CCCC C C  CCCCCCCCCCCCC CC
     3   51 L E  T 3  S+     0   0  187  858   80  QTNQ VVEA NVLA  LQANS DDAEAAAAAAD   SS RFA  AAEA Q C  FASATAESAASSE KS
     4   52 L T  T 3  S-     0   0  105  864   61  TSPP SSTD TSRD  PDTDS SSTTSSPPSPP   PP GQS  EPLS S D  SLSSSSNSSSSSNSSA
     5   53 L S    <   +     0   0   89  868   72  ESSS SSES DSGS  SMGQN SSSVTTTTTTN   NN SGS  GSQK K Q  NESNMSSSQDGGDHSK
     6   54 L P        +     0   0   10  878   31  TCPA PPNP PPPP  PSQSP PPPPTTTTTTP   PP VLP  RPPP P Y  PPPPPPPPPPLLYTPP
     7   55 L b        -     0   0   18  893   21  SCCC CCGC DCCC  CCAGC CCCECCCCCCC  CCC CCC  ACCC C C  CCCCCCCCCCAAYCCC
     8   56 L Q  S    S+     0   0   92  892   83  NDEQ QQGC AQLC  HSRSV KKRIAAAAAAL  QQQ GRF  RSQQ L N  EMMEQMQLYQQQNAKR
     9   57 L N  S    S-     0   0   63  893   51  CINN NNCQ CNNQ  NNCCN NNNCNNNNNNN  NNN QNN  CPNN N N  NHNNNNNNNHCCGTNN
    10   58 L Q  S    S-     0   0  152  893   57  ALGG QQSQ QQGQ  GQAVD GGGGGGGGGGG  GGG AKG  AFNE N N  GGGGGGGGGGSSGTAG
    11   59 L G        -     0   0   16  893   40  HsGG GGHV QGGV  GGHNG GGGlGGGGGGG  GGG PGG  HAGG G P  GGGGGVgGGAHHcAGG
    12   60 L K  E     -S   23   0G 117  852   79  GnTT VVR. IIN.  TEGVT LLTnIIIIIII  TRR .KS  RVSE S .  STNEI.cVTTRRdRTS
    13   61 L a  E     -S   22   0G  45  882   10  CCCC CCCC CCCC  CCCCC CCCCCCCCCCC  CCC .CC  CCCC C .  CCCCCCSCCCCCCCCC
    14   62 L K  E     -S   21   0G 155  890   81  HvVN KKVT nkTA  HILSV TTtTSSSSSST  SII KIK  Vkvl V .  ETVNTVatKEVVIHVI
    15   63 L X  E     +S   20   0G 120  768   39  NvP. DDNN dhPN  NEN.D DDvNVVVVVVD  .DD .D.  Nlql . .  DDDDNDaf.ENN.PDD
    16   64 L G        -     0   0   44  862   73  TCEK DDTN GHNS  LTTRG HHSYGGGGGGG  FGG .LD  TGTG T .  GGGDGGGTDGIINAGN
    17   65 L L  S    S-     0   0  152  871   64  LSTL HHEP DTVP  VIRLI DDGVTTTTTTV  LAA .KL  LPKY L .  NVVGVLVNLTMMITIE
    18   66 L G  S    S+     0   0   67  883   63  GtGp ttGG SQRG  GGGeN KKgGRRRRRRN  NAA .Dp  GRHR t G  NNGGDNcgpKGGpgNR
    19   67 L E        -     0   0  119  837   61  SrDn llGG .QGG  GSSqE SSsGSSSSSSS  .SS SGg  STDG d G  TSSSGAgegESSndQF
    20   68 L Y  E     -S   15   0G  37  883   11  YGYY FFHY FYFY  FYYGY YYYYLLLLLLY  .YY YYY  FYFY Y Y  YYFYYFYYYYFFYYYY
    21   69 L T  E     -S   14   0G  71  886   82  VTSS TTHE NTTE  STKVT TTKYSSSSSST  MTT LRR  TETK R T  TTTTITQTETSSRTST
    22   70 L b  E     -S   13   0G  20  889    0  CCCC CCCC CCCC  CCCCC CCCCCCCCCCC  CCC CCC  CCCC C C  CCCCCCCCCCCCCCCC
    23   71 L T  E     -S   12   0G  85  890   86  VRNY TTDG SVSG  SSVQM TTINSSSSSSS  SDD TEH  ATRK D S  QATTANTSVTVVTETA
    24   72 L c        -     0   0   44  890    0  CCCC CCCC CCCC  CCCCC CCCCCCCCCCC  CCC CCC  CCCC C C  CCCCCCCCCCCCCCCC
    25   73 L L    >   -     0   0   62  890   88  NTLL KKPY YKNY  PYHSH LLPLPPPPPPP  TAA AQK  NKPN I S  LVATAAQVAWNNFAVP
    26   74 L E  T 3  S+     0   0  177  890   75  AEEP PPSA PSAA  EPPEE PPTSLLLLLLP  PQQ EEP  PESN T R  PLVSAENSRPPPDSAA
    27   75 L G  T 3  S+     0   0   29  893   20  AGGG GGGG GGPG  GGGGG DDGGGGGGGGG  GGG GGG  GGGG G G  GGGGGGGGGGGGGGGG
    28   76 L F  E <   +T   36   0H  40  893    9  YFFY FFLY YFYY  FFYFY FFFFFFFFFFF  WFF YFY  FFFY F F  WYFFYYFFYYFFFYFY
    29   77 L E  E     +T   35   0H  74  893   73  eaGS TTvr rTYr  TYeaR EEKISSSSSST  TTT aST  eqET T l  ETTMEEATSEeemqTT
    30   78 L G  S >  S-     0   0   32  889    5  ggGG GGgg eGGg  GGggG GGGSGGGGGGG  GGG gGG  ggGG G g  GGGGGGGGGGggggGG
    31   79 L K  T 3  S+     0   0  156  891   73  KTKR KKIC RKPC  RPRTL TTNNEEEEEET  RKK KKI  KKVE K C  TSDVDAVEIQKKHRKK
    32   80 L N  T 3  S-     0   0   33  892   62  QHNN HHKG NHVS  AEQHN HHTGYYYYYYN  FRR HTN  QIKN K G  NSTNNNNNNNQQNNNN
    33   81 L c  S <  S+     0   0    1  892    3  CCCC CCCC CCCC  CCCCC CCCTCCCCCCC  CCC CCC  CCCC C C  CCCCCCCCCCCCCCCC
    34   82 L E        +     0   0   87  891   44  YESE EEAE QEEE  EEYEE EEIEEEEEEEM  QEE EKQ  YQEE E E  EEAEEEEEQEYYLVEE
    35   83 L L  E    S-T   29   0H  96  889   88  RDIT TTED MTFD  RYRDE HHDQVVVVVVD  TTT DIE  RPII K D  ITEQLFDSEVRRDDTT
    36   84 L F  E     -T   28   0H 139  889   83  iVDD PPSV IPKV  DviVD SSDFRRRRRRD  DDD VEE  iINS D I  NDIVDNvRADiiVVDE
    37   85 L T        -     0   0   44  677   75  m.L. VVN. TVv.  Iem.I LL.q......I  V.I ...  m.KP I .  TT.ITIiVKImm...V
    38   86 L R        +     0   0   57  408   92  v... .... ..e.  .vv.. ...d.......  ... ...  v... . .  ..........vv....
    39   87 L K        +     0   0   96  535   81  NN.. ...D ..KD  .NNN. ...G.......  D.. N..  DN.. . D  ..........NNDN..
    40   88 L L        -     0   0   91  608   90  SE.. ..TE L.CE  .ISE. ...T.......  E.. E..  SP.. . E  ..........SSEE..
    41   89 L d  S  > S+     0   0   15  617   29  CC.. ..CC C.PC  .PCC. ...S.......  C.. C..  CC.. . C  ..........CCCC..
    42   90 L S  T  4 S+     0   0   98  624   84  EA.. ..AA S.TA  .QEA. ...C.......  A.. A..  QV.. . L  ..........EEQA..
    43   91 L L  T >4 S-     0   0  120  627   87  SL.. ..AS E.ES  .HAH. ...N.......  G.. L..  ND.. . N  ......V...KKDT..
    44   92 L D  G >4 S-     0   0  107  638   73  NW.. ..DS S.SG  .VGW. ...DDDDDDD.  G.. W..  DR.. . D  .D....N...DDNG..
    45   93 L N  G >< S-     0   0    8  700   56  NN.. ..NR V.PH  .LNN. ..VIGGGGGG.  TI. N.R  NN.. . N  .I....T...NNNFI.
    46   94 L G  G <  S-     0   0    0  882   52  GH.. DDGG ADTG  NMGHD LLENLLLLLLN  HDD HDS  GGD. D G  DDDGNDNTSDGGGHDQ
    47   95 L D  G <  S+     0   0   44  887   62  GG.L AAGG NAAG  ENGGD TTEEDDDDDDE  GEE GAD  GGD. D G  EDDGEEPADEGGGREE
    48   96 L e    <   -     0   0    0  892    0  CCCC CCCC CCCC  CCCCC CCCCCCCCCCC  CCC CCC  CCCC C C  CCCCCCCCCCCCCCCC
    49   97 L D  S    S-     0   0   59  892   74  LSDQ VVEE SVHE  LSSSE AADESSSSSSD  STT TSR  SPKS L E  SSSARANSDVSSQGAQ
    50   98 L Q  S    S+     0   0    2  892   63  HLpp ssHH QsQH  phHLs ddnerrrrrrs  Qss Lsn  Hegr s Q  stssssnsadHHQpss
    51   99 L F  E     -U   62   0I   4  892   80  HGmt vvRH VtLH  vfGGt rrtkffffffs  Vqq Gmm  Hiif t I  ivnqfvtvmeHHIvtt
    52  100 L d  E     +U   61   0I  10  893    1  CCCC CCCC CCCC  CSCCC CCCCCCCCCCC  CCC CCC  CCCC C C  CCCCCCCCCCCCCCCC
    53  101 L H  E     -U   60   0I  68  893   87  QENN LLET TLTT  QFSEV HHLGEEEEEEM  LVV EAK  EVLS I V  QVVETVVTKFEEVVNT
    54  102 L E  E     -U   59   0I  92  893   68  HNHK SSEN NSVN  NNHND EENPAAAAAAE  NNN NLD  HYDS D N  DDDNDDNEDEHHNNDK
    55  103 L E  S    S-     0   0  100  893   82  sIaL ddRl Tdtt  FSSIe KKTnffffffg  VGG TDe  trli G S  EegTmgIfenttalGr
    56  104 L Q  S    S-     0   0  175  693   73  .PaP qqd. Nqe.  PQ.P. ddHcttttntd  AAA PGg  apnk P E  E.dEdndngdnn..V.
    57  105 L N  S    S+     0   0  154  838   66  gG.L ggkg Nr.g  G.sGn ggGnnnnnnn.  GGG GTs  GGDP N G  Nn.GG.nggpGGggNn
    58  106 L S  S    S-     0   0   58  853   65  GSGN GGFS SGSS  S.gSG ssSsSSSSSSS  SSS SSN  .E.F S S  GSSS.SDeNr..SSNG
    59  107 L V  E     -U   54   0I   7  890   79  PYYY FFHF FFFF  FCPYY YYYFGGGGGGF  HFF YYF  PAYY Y Y  YFFYYFYYYYPPYYYY
    60  108 L V  E     -U   53   0I  45  891   88  VFQN RRRQ ISRQ  NTLFH AAQIFFFFFFT  RTT YKT  RTEK V S  TTTTVTTTTVLLERTE
    61  109 L e  E     +U   52   0I   5  893    1  CCCC CCCC CCCC  CFCCC CCCCCCCCCCC  CCC CCC  CCCC C C  CCCCCCCCCCCCCCCC
    62  110 L S  E     -U   51   0I  24  893   75  TTNS AAAS SASS  VSSTL EEMSNNNNNNI  GSS TNL  SVRT N A  TNTTAHLSMQSSQELS
    63  111 L f        -     0   0   23  893    0  CCCC CCCC CCCC  CCCCC CCCCCCCCCCC  CCC CCC  CCCC C C  CCCCCCCCCCCCCCCC
    64  112 L A    >   -     0   0    8  893   75  NPAL AAAE NAME  KAPPP PPPLPPPPPPA  HLL PVR  NKRK P T  EAATQARVRQNNHRIA
    65  113 L R  T 3  S+     0   0  149  893   80  HKDP FFLA DFSA  TERRI LLARFFFFFFA  RAA VKS  DPPR V A  DAVSPESSSPQQSSPP
    66  114 L G  T 3  S+     0   0   24  893    8  GGGG GGGG GGGG  GGGGG GGGGGGGGGGG  GGG GGG  GGGG G G  GGGGGGGGGGGGGGET
    67  115 L Y  E <   -V   78   0J  20  893   11  YYFY FFYY YFFY  YYYYY YYYYYYYYYYY  YYY FFY  YTFY Y Y  WYFYFYYFYYYYFYFY
    68  116 L T  E     -V   77   0J  72  891   85  RAVS HHKR EHKR  TEETH TTTTTTTTTTT  ETT VTT  ISTT T T  TKTTTETTTTQQFETT
    69  117 L L  E     -V   76   0J  67  888   64  LLGG GGLL LGLL  GLLLD GGGSGGGGGGG  LGG LGG  LRGG G V  GGGGGGGGGGLLLFGG
    70  118 L A    >   -     0   0   23  889   78  DLDR TTAH QTHD  VDDLP LLKPTTTTTTT  QTT LAP  GRDY V S  TDDITAIEDEDDSATA
    71  119 L D  T 3  S+     0   0  175  889   77  DPYN FFEE NFSE  FGQPF NNNAMMMMMMF  MLL PTN  LPDN S P  HTTNRNNNNTDDDDNN
    72  120 L N  T 3  S-     0   0   92  694   44  DD.. ..DD D.DD  ..DD. ..C.CCCCCC.  DCC DC.  DP.C . D  ..........DDNDC.
    73  121 L G  S <  S+     0   0   16  713   66  LR.. ..KR N.GR  G.QR. ..EGQQQQQQ.  GDD GG.  GS.E . G  ..........RRQRE.
    74  122 L K  S    S+     0   0   71  687   76  KK.. ..RR A.RR  K.KK. ..SPE    E.  KSS KK.  KS.K . R  ..........KKHHT.
    75  123 L A        -     0   0   22  685   66  TT.. ..KG T.SG  H.TT. ..KW      .  SDD RE.  TE.K . R  ..........SSTTS.
    76  124 L f  E     -V   69   0J  12  847    9  CCCC CCCC CCCC  C.CCC CCYF      C  CII C C  CCCI C C  CCCCCCCCCCCCCC C
    77  125 L I  E     -V   68   0J  78  846   80  IQQE EEHS QELT  E.IRM EEVM      P  KDD H D  TLSN E I  EQAGQEQEDSIIII E
    78  126 L P  E     -V   67   0J  62  850   71  DVST VVPP GVPP  lPGES RRPp      D  AEE Q V  EaIP N A  TTeQSITsIVDDHl K
    79  127 L T  S    S+     0   0  103  652   80  .ID. NNL. .NE.  ..A.N RRCh      D  FCC L T  ..DC D .  ..dDEEP.TN..Rt A
    80  128 L G  S    S-     0   0   32  788   69  VVlG VVD. .VV.  .GgII MMSG      I  pTT I I  V.ID V .  V.dIIIt.II..sp l
    81  129 L P  S    S+     0   0  116  601   75  ..sM .... ..E.  sEc.. ..P.      .  dSS . .  .p.A . .  ..s...ne..SSgp d
    82  130 L Y  S    S+     0   0   59  794   86  D.NY DD.. NDF.  YLVTN DDST      N  ADD . N  DSDR N .  N.SGNNASDDDDMN Y
    83  131 L P    >   -     0   0   17  799   62  EPPG DDP. TDP.  GQPPE KKPD      E  PPP S P  EDPP D .  A.PHEFPPPEEENP  
    84  132 L g  T 3  S+     0   0   16  800    5  CCCC CCC. CCC.   CCCC CCCC      C  PCC C C  CCCC C .  C.CCCC CCCCCCC  
    85  133 L G  T 3  S+     0   0    0  712   37  GE      .  EG.     GS TTQ       A  AQQ P T  E S  T .  SG AAE ST EE E  
    86  134 L K    <   -     0   0   69  588   68          .   R.     GS SSN       S  SNN S      K    D  S  SS     SS    
    87  135 L Q        -     0   0   37  477   65          .   L.     I  MM           S               E                  
    88  136 L T        +     0   0    4  428   78          .   P.                     P               P                  
    89  137 L L        +     0   0  105  372   61          L    L                     V               I                  
    90  138 L E              0   0  104  274   69          E    E                     E               D                  
    91  139 L R              0   0  231  199   47                                     N               K                  
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2      I    I    VI     I           VI   I   II    V V IL                
    94   17 C V  B     -A  271   0A   7  590    9      V    K    VV     V           VV   V   VV    V V VV                
    95   18 C G  S    S+     0   0   25  591    6      G    G    GA     G           GG   G   NG    G G GG                
    96   19 C G  S    S-     0   0   26  592    0      G    G    GG     G           GG   G   GG    G G GG                
    97   20 C Q  E     -B  237   0B  98  593   95      S    L    SR     K           MR   S   VR    R E VI                
    98   21 C E  E     -B  236   0B  80  594   67      P    F    RD     N           DQ   E   DQ    A N NE                
    99   22 C h        -     0   0    8  594   58      S    A    VA     A           CA   C   TA    A A TA                
   100   23 C K    >   -     0   0  123  593   78      L    D    SE     P           EE   A   TE    H K ED                
   101   24 C D  T 3  S+     0   0   60  594   85      L    I    IK     F           PV   A   IV    L E LA                
   102   25 C G  T 3  S+     0   0    0  595   74      G    A    GG     G           HE   H   EE    G C CH                
   103   26 C E  S <  S+     0   0   36  595   66      E    S    DL     R           SS   S   AS    A E ES                
   104   27 C h    >   +     0   0    4  595   92      W    H    HA     W           QQ   Q   HQ    W F FW                
   105   28 C P  T 3   +     0   0    0  599    9      P    P    PP     P           PP   P   PP    P P PP                
   106   29 C W  T 3  S+     0   0    5  600   26      W    W    WW     W           WW   W   YW    W F WW                
   107   30 C Q  E <   -J  122   0C   7  601   26      Q    q    AQ     q           qi   Q   Qi    t L MV                
   108   31 C A  E     -JK 121 146C   1  593   49      V    r    VV     t           an   V   Vn    v A VI                
   109   32 C L  E     -JK 120 145C   3  598   68      S    R    YM     S           II   S   PI    N Y RQ                
   110   33 C L  E     -JK 119 144C   0  601    9      L    L    LL     F           LL   L   LL    M V LL                
   111   34 C I  E     -JK 117 143C   0  601   81      R    P    AF     F           DG   N   QG    P N QI                
   112   35 C N  E >   - K   0 142C  30  601   88      W    G    DR     G           MI   I   NI    V A VY                
   113   36 C E  T 3  S+     0   0   63  117   78      .    .    SK     F           ..   .   A.    . . ..                
   114   37 C E  T 3  S-     0   0  136  242   77      Q    .    SN     S           ..   .   A.    . . .R                
   115   38 C N  S <  S+     0   0   84  565   53      G    .    GP     S           ..   G   L.    . G GG                
   116   39 C E        -     0   0  100  589   94      N    E    NQ     T           YD   Y   SD    . G SV                
   117   40 C G  E     +J  111   0C  14  600   57      H    R    QE     H           KQ   H   HQ    . S NH                
   118   41 C F  E     +     0   0C  28  611   33      V    f    Fl     R           lf   F   Ff    . Q LR                
   119   42 C i  E     -J  110   0C   0  612    1      C    c    Cc     C           cc   C   Cc    C C CC                
   120   43 C G  E     -J  109   0C   1  612    1      G    G    GG     G           GG   G   GG    G G SG                
   121   44 C G  E     -J  108   0C   0  612    9      G    G    GA     G           GG   G   GG    G G GG                
   122   45 C T  E     -JL 107 130C   0  612   45      S    I    TS     A           VS   S   SS    A T SA                
   123   46 C I  E     + L   0 129C   0  612   23      I    L    LL     V           LL   L   IL    I I IL                
   124   47 C L        -     0   0    6  612   27      I    I    VI     I           VI   I   II    L I II                
   125   48 C S  S    S-     0   0   22  612   56      S    S    AS     N           AD   S   SD    N D DD                
   126   49 C E  S    S+     0   0   99  612   63      G    S    PD     E           RP   S   EP    E N EE                
   127   50 C F  S    S+     0   0   42  612   83      Q    C    TR     N           QC   E   DC    R R TE                
   128   51 C Y  E     - M   0 185C   7  612   34      W    W    KW     W           WW   W   LW    V H HF                
   129   52 C I  E     -LM 123 184C   0  612   14      I    I    VV     I           VV   V   VV    I I VV                
   130   53 C L  E     +LM 122 183C   0  612   27      L    L    LL     A           VL   V   VL    I V MV                
   131   54 C T  E     - M   0 182C   0  612   43      S    S    TT     T           TT   S   TT    T T TT                
   132   55 C A    >>  -     0   0    0  613    2      A    A    AA     A           AA   A   AA    A A AA                
   133   56 C A  G >4 S+     0   0    0  613    9      A    A    AA     G           AA   A   AA    A A GA                
   134   57 C H  G >4 S+     0   0    7  613    0      H    H    HH     H           HH   H   HH    H H HH                
   135   58 C i  G X4 S+     0   0    0  613    1      C    C    CC     C           CC   C   CC    C C CC                
   136   59 C L  G << S+     0   0   31  613   66      F    F    TL     V           TF   Y   MF    F M VF                
   137   60 C Y  G <  S+     0   0  109  613   87      L    Q    GL     D           TY   M   QY    E V SA                
   138   61 C Q  S <  S+     0   0   95  613   78      l    e    ay     d           Pd   l   sd    d g tr                
   139   61AC A        -     0   0   16  373   75      s    p    pe     t           .t   a   at    p a ap                
   140   62 C K  S    S-     0   0  172  387   77      I    H    TN     S           GS   S   SS    T S SA                
   141   63 C R  S    S-     0   0  162  602   78      R    H    ID     Q           IA   R   QA    R S DM                
   142   64 C F  E     -K  112   0C  36  609   54      L    L    AL     I           TY   I   IY    W I MY                
   143   65 C K  E     -K  111   0C  67  609   79      Q    T    RL     R           TK   S   KK    T T TR                
   144   66 C V  E     -KN 110 161C   0  609   16      I    V    VV     I           IV   V   VV    V I VV                
   145   67 C R  E     -KN 109 160C  40  609   55      I    I    VR     R           RF   R   RF    T G NH                
   146   68 C V  E     +KN 108 159C   1  610   43      V    L    VI     V           LL   I   LL    A V VV                
   147   69 C G  S    S+     0   0    9  610   15      C    G    GG     G           GG   G   GG    G G GG                
   148   70 C D        +     0   0   11  611   58      S    R    RK     E           KK   E   SK    G S EG                
   149   71 C R  S    S+     0   0   24  611   73      R    T    EH     Y           HS   H   TS    I S YH                
   150   72 C N  B >   -P  234   0D  18  611   65      N    Y    DS     D           NV   N   IV    K Y DK                
   151   73 C T  T 3  S+     0   0   56  611   80      G    R    KR     F           LL   I   YL    Q K YS                
   152   74 C E  T 3  S-     0   0  119  611   84      K    V    TT     S           FN   F   NN    N N SG                
   153   75 C Q  S <  S-     0   0  130  610   85      E    V    DR     H           TV   A   EV    T N KS                
   154   76 C E        +     0   0  165  610   85      d    P    ay     v           RT   S   GT    F L TG                
   155   77 C E        -     0   0   93  469   27      k    .    qr     e           ED   E   .D    E . E.                
   156   78 C G  S    S+     0   0   46  578   34      W    G    GG     Q           WE   G   .E    Y . A.                
   157   79 C G  S    S+     0   0   47  585   75      t    e    EI     l           GN   T   .N    S . Q.                
   158   80 C E        -     0   0   37  472   30      h    e    .E     y           EE   E   GE    K . D.                
   159   81 C A  E     -N  146   0C  27  487   57      A    Q    .K     T           EQ   Q   EQ    R R QR                
   160   82 C V  E     -N  145   0C  71  590   83      G    K    AI     E           RV   W   LV    M N VA                
   161   83 C H  E     -N  144   0C  14  599   76      S    F    LS     R           KF   I   VF    Y Y VH                
   162   84 C E        -     0   0   90  602   78      I    E    PM     A           MM   Q   SM    Q R GF                
   163   85 C V  E     -O  186   0C  27  607   64      Y    V    VL     V           VV   A   VV    I V VI                
   164   86 C E  E    S+     0   0C  70  608   73      K    E    VE     A           QD   S   KD    E S SK                
   165   87 C V  E     -O  185   0C  13  609   72      S    K    GK     R           KE   K   AE    S R KN                
   166   88 C V  E     -O  184   0C  72  610   46      G    Y    VI     K           LI   A   FI    I V IL                
   167   89 C I  E     +O  183   0C  27  610   43      L    I    WY     V           VI   I   KI    M T TS                
   168   90 C K  E     -O  182   0C  68  610   82      P    V    RI     V           PS   S   FS    M V VT                
   169   91 C H    >   -     0   0   19  611   13      L    H    HH     H           HH   H   HH    Y H HH                
   170   92 C N  T 3  S+     0   0  156  611   61      E    K    pP     P           PP   P   EP    K P PS                
   171   93 C R  T 3  S+     0   0  150  608   73      Q    E    .R     K           ND   Q   GD    D N DL                
   172   94 C F    <   -     0   0   24  611    5      Y    F    .Y     Y           YF   Y   YF    Y Y YF                
   173   95 C T     >  -     0   0   56  611   68      s    D    .n     N           NT   H   NT    D Q Qn                
   174   96 C K  T  4 S+     0   0  145  561   78      q    D    hr     F           P.   S   P.    E P .v                
   175   97 C E  T  4 S+     0   0  174  569   91      K    D    QD     F           S.   A   K.    F N .W                
   176   98 C T  T  4 S-     0   0   44  598   57      I    T    SI     T           T.   T   T.    S T .P                
   177   99 C Y    ><  +     0   0   60  604   65      Y    Y    AL     Y           K.   T   M.    V F LS                
   178  100 C D  T 3   +     0   0   25  609   37      t    D    eD     E           DD   D   VD    E D dS                
   179  101 C F  T 3  S+     0   0   21  595   66      y    N    sR     F           Ne   N   Ne    N Y nY                
   180  102 C D    <   +     0   0    1  609    0      d    D    DD     D           Dd   D   Dd    D D DD                
   181  103 C I        +     0   0    0  611   13      I    I    VI     L           II   I   VI    I V IV                
   182  104 C A  E     -MO 131 168C   0  611   60      A    A    AA     A           MA   M   AA    A A AA                
   183  105 C V  E     -MO 130 167C   0  612   16      L    L    VL     L           LL   L   LL    L V IV                
   184  106 C L  E     -MO 129 166C   0  613   30      V    L    VL     V           IV   I   IV    V L LL                
   185  107 C R  E     -MO 128 165C  40  613   43      K    Q    TK     K           KR   K   KR    M T TR                
   186  108 C L  E     - O   0 163C   0  613   16      S    L    LL     L           LI   L   LI    L L LI                
   187  109 C K  S    S+     0   0  101  613   69      S    K    GR     E           LR   S   AR    K S DA                
   188  110 C T  S    S-     0   0   82  614   74      K    S    RK     Q           TT   S   TT    S S KP                
   189  111 C P        -     0   0   48  614   39      S    d    aP     P           Pa   P   Pa    E S PP                
   190  112 C I        -     0   0    4  562   63      I    c    sI     L           Vc   A   .c    I . LV                
   191  113 C T        -     0   0   95  566   73      I    A    PS     V           TA   T   .A    K . TK                
   192  114 C F        +     0   0   56  612   34      F    Q    LF     F           LV   L   VV    F L FL                
   193  115 C R  B >   -Q  196   0E  52  613   63      S    e    GS     A           Te   N   re    S t Nn                
   194  116 C M  T 3  S+     0   0   29  594   77      E    s    .D     P           Ek   Q   sk    N r Dn                
   195  117 C N  T 3  S+     0   0   13  602   90      R    V    .Y     H           RY   Y   KY    Y C CT                
   196  118 C V  B <   +Q  193   0E   0  604   27      I    V    .I     I           IV   A   IV    I I VA                
   197  119 C A        -     0   0    1  606   80      Q    R    .H     S           QR   Q   RR    R Q QR                
   198  120 C P        -     0   0    8  608   54      P    T    .P     P           PT   A   YT    P P PT                
   199  121 C A        -     0   0    2  609   39      V    V    .V     I           VV   V   IV    I A VI                
   200  122 C g  B     -c  290   0B   1  610   66      C    C    .C     C           PC   P   RC    C C CC                
   201  123 C L        -     0   0   27  612    5      L    L    LL     L           VL   L   LL    L L LM                
   202  124 C P        -     0   0    7  613   30      P    P    AP     P           AP   P   AP    P P PP                
   203  124AC E     >  -     0   0   92  612   75      R    P    DD     A           SE   S   DE    S T ES                
   204  125 C R  H  > S+     0   0  109  612   78      F    A    DK     T           CR   S   RR    E P VL                
   205  126 C D  H  > S+     0   0  124  612   85      G    D    PQ     D           PN   C   TN    N S GP                
   206  127 C W  H  >>S+     0   0    4  612   88      Q    L    AT     D           PL   V   PL    D L DP                
   207  128 C A  I  X>S+     0   0    0  612   75      I    Q    LA     L           VK   G   PK    T Q SM                
   208  129 C E  I  <5S+     0   0   75  613   82      F    L    YA     L           PL   T   TL    L L SP                
   209  130 C S  I  <5S+     0   0   70  614   66      S    P    ER     I           GR   G   GR    E R AN                
   210  131 C T  I  <5S+     0   0   18  108   73      P    .    .L     .           ..   .   ..    . . ..                
   211  131AC L  I ><  S-     0   0  119  503   80      v    A    Ss     S           ..   .   l.    . y .k                
   227  146 C E  T 3  S+     0   0   47  527   75      E    L    EA     E           ..   .   T.    . P .E                
   228  147 C K  T 3  S+     0   0  169  548   68      G    S    QS     G           ..   .   C.    . G .N                
   229  149 C G  S <  S-     0   0   29  559   66      G    P    GD     G           ..   .   V.    H G .G                
   230  150 C R        -     0   0  213  584   86      P    F    AT     T           SY   .   SY    G Y .R                
   231  151 C Q  B     -R  224   0F  79  599   93      V    Y    TQ     L           YY   .   LY    D S .R                
   232  152 C S        -     0   0   14  607   51      S    S    SP     P           PA   .   PA    S P SS                
   233  153 C T  S    S+     0   0   48  608   73      A    E    RS     S           DQ   .   KQ    D N PE                
   234  154 C R  B    S-P  150   0D 102  608   85      I    R    YV     V           VR   .   TR    R N IV                
   235  155 C L        -     0   0    3  610    3      L    L    LL     L           LL   .   LL    L A LL                
   236  156 C K  E     -BD  98 221B  31  610   51      R    K    RQ     Q           QM   .   QM    N Q QR                
   237  157 C M  E     -BD  97 220B  18  611   94      E    E    GV     E           CS   .   ES    Q K EE                
   238  158 C L  E     - D   0 219B   4  612   44      A    A    VV     V           VA   Q   VA    V A VI                
   239  159 C E  E     - D   0 218B 107  612   72      R    H    TN     S           TS   T   ES    K M TH                
   240  160 C V  E     - D   0 217B   0  612   46      V    V    VV     V           VV   S   VV    L V IV                
   241  161 C P  E     - D   0 216B  34  612   28      Q    R    PP     P           TN   V   DN    P P PP                
   242  162 C Y  E     -F  263   0B  36  613   46      L    L    VI     I           IL   G   IL    I I TI                
   243  163 C V  E     -F  262   0B  24  614   37      I    Y    VV     V           FI   E   VI    I V YL                
   244  164 C D     >  -     0   0   88  613   57      T    P    SE     S           SS   D   DS    A S SP                
   245  165 C R  H  > S+     0   0   51  613   78      R    S    DR     N           TQ   T   QQ    E M GF                
   246  166 C N  H  > S+     0   0  105  614   74      R    S    EP     D           AD   T   KD    D S AT                
   247  167 C S  H  > S+     0   0   48  614   78      D    R    SV     R           EK   S   AK    K Q LQ                
   248  168 C j  H  X S+     0   0    1  614    2      C    C    CC     C           CC   C   CC    C C CC                
   249  169 C K  H >< S+     0   0   88  614   73      n    t    Ak     k           Kt   k   at    s k dn                
   250  170 C L  H 3< S+     0   0  150  574   89      s    v    Af     a           Ry   y   fy    w s ph                
   251  171 C S  H 3< S+     0   0   23  604   76      F    .    Sa     G           LY   P   KY    Y Y NY                
   252  172 C S    <<  -     0   0   20  607   83      Y    .    YG     R           YD   G   YD    G G TA                
   253  173 C S  S    S+     0   0   79  607   83      Y    .    SK     H           PS   D   GS    N S TG                
   254  174 C F  S    S-     0   0  124  607   79      G    .    LS     E           GV   V   SV    F N PR                
   255  175 C I        -     0   0  100  608   87      S    .    FP     F           SR   R   QR    F T TV                
   256  176 C I        -     0   0   13  609   18      I    .    RV     I           IV   C   IV    K I DH                
   257  177 C T    >   -     0   0   16  614   35      T    T    PA     P           TT   R   QT    P N PL                
   258  178 C Q  T 3  S+     0   0  133  614   68      P    D    EQ     D           ED   S   DD    N D SP                
   259  179 C N  T 3  S+     0   0   24  614   60      R    N    AG     I           NN   Q   TN    S L VS                
   260  180 C M  E <   - G   0 311B   2  614   13      M    M    ML     F           MM   L   MM    S K QM                
   261  181 C F  E     - G   0 310B   8  613   35      L    L    VG     L           IV   L   VV    F I IL                
   262  182 C j  E     +FG 243 309B   1  614    1      C    C    CV     C           CC   I   CC    C C CC                
   263  183 C A  E     +FG 242 308B   0  614   26      A    A    AG     A           AA   P   AA    A A AA                
   264  184 C G  S    S-     0   0    3  614   10      G    G    GG     G           GG   D   YG    G G GG                
   265  185 C Y        -     0   0   56  591   57      Y    .    V.     H           S.   P   A.    Y Y KY                
   266  185AC D  S    S-     0   0   81  594   83      L    .    PM     E           L.   L   L.    A L PT                
   267  185BC T  S    S+     0   0   76  614   61      S    d    Ee     T           Qd   T   Kd    Q S SQ                
   268  186 C K  S    S-     0   0  107  563   32      G    g    Gk     G           Gw   .   .w    G G GG                
   269  187 C Q  S    S+     0   0  102  569   37      K    G    GP     G           GA   P   .A    G D GI                
   270  188 C E        +     0   0   33  613   55      V    P    LD     Q           RT   D   KT    K K AV                
   271  189 C D  B     -A   94   0A   7  614    4      D    Q    DE     D           DD   A   DD    D D DD                
   272  190 C A        -     0   0    7  614   42      S    A    TG     S           SA   A   AA    A A SS                
   273  191 C k    >   -     0   0    7  614    3      C    N    CK     C           CC   T   CC    C C CC                
   274  192 C Q  T 3  S+     0   0   90  614   25      K    L    QR     Q           QK   Q   QK    T K QQ                
   275  193 C G  T 3  S+     0   0    6  614    8      G    H    GG     G           GG   N   GG    G G GG                
   276  194 C D    X   +     0   0    0  614    0      D    d    Dd     D           DD   D   DD    D D DD                
   277  195 C S  T 3  S+     0   0   14  614    1      S    s    Ss     S           SS   S   SS    S S SS                
   278  196 C G  T 3  S+     0   0    0  614    0      G    G    GG     G           GG   G   GG    G G GG                
   279  197 C G    <   -     0   0    0  614    1      G    G    GG     G           GG   G   GG    S G GG                
   280  198 C P  E     - H   0 294B   1  614    2      P    P    PP     P           PP   P   PP    P P PP                
   281  199 C H  E     -EH 219 293B   0  614   49      L    L    LF     L           LM   V   LM    L L LL                
   282  200 C V  E     -EH 218 291B   3  614   26      V    V    VV     Q           VV   V   VV    V L FM                
   283  201 C T  E     - H   0 290B   0  614   66      C    C    AM     V           CC   C   AC    C C CC                
   284  202 C R  E     + H   0 289B  99  614   70      Q    L    GK     K           NE   N   NE    R A PA                
   285  203 C F  E >  S- H   0 288B  22  614   71      D    N    Gs     g           GH   G   NH    R E VN                
   286  204 C K  T 3  S-     0   0   85  222   71      E    G    .n     d           .N   .   .N    N G NM                
   287  205 C D  T 3  S+     0   0  108  223   55      G    G    .K     G           .G   .   .G    S S GG                
   288  206 C T  E <   - H   0 285B   3  233   75      V    R    .R     H           .R   .   .R    E S QR                
   289  207 C Y  E     - H   0 284B  21  242   51      W    M    .W     Y           .M   .   .M    W W YW                
   290  208 C F  E     -cH 200 283B   0  613   91      R    T    RY     F           TT   Q   QT    Q T VE                
   291  209 C V  E     + H   0 282B   1  613   38      L    L    LQ     L           LL   L   LL    V L QV                
   292  210 C T  E     +     0   0B   1  613   84      V    V    IM     A           QY   Q   VY    H A YH                
   293  211 C G  E     -IH 312 281B   0  613    0      G    G    GG     G           GG   G   GG    G G GG                
   294  212 C I  E     -IH 311 280B   0  613   19      I    I    VI     I           II   I   II    I I IL                
   295  213 C V  E     +I  310   0B   7  613   14      V    I    TV     I           VV   V   VV    S V VV                
   296  214 C S  E     -     0   0B   1  612    0      S    S    SS     S           SS   S   SS    S S SS                
   297  215 C W  E     -I  309   0B  45  613    7      W    W    WW     W           WW   W   WW    W F YW                
   298  216 C G        -     0   0   26  613    0      G    G    GG     G           gG   G   GG    G G GG                
   299  217 C E  S    S-     0   0   25  609   90      I    L    EE     I           eD   R   SD    Y N DI                
   300  218 C G  S    S-     0   0   19  612   13      G    G    GG     G           KG   G   GG    G G GG                
   301  220 C k  S    S-     0   0    7  613    2      C    C    CC     C           CC   C   CC    C C CC                
   302  221 C A  S    S+     0   0    4  612   16      G    G    AD     A           GA   A   AA    A A AG                
   303  222 C R    >   -     0   0  105  611   73      R    Q    RR     E           QK   L   RK    E K IR                
   304  223 C K  T 3  S+     0   0  152  611   64      P    K    KD     A           PQ   P   VQ    P P AP                
   305  223AC G  T 3  S+     0   0   26  613   58      N    D    GG     N           KN   N   GN    K Y GG                
   306  224 C K    <   -     0   0   43  613   85      R    V    KK     L           RK   Y   YK    W Y NN                
   307  225 C Y        -     0   0   33  613   50      P    P    PY     P           PP   P   PP    P P AP                
   308  226 C G  E     -G  263   0B   4  611    2      G    G    GG     G           GG   G   GG    G G GG                
   309  227 C I  E     -GI 262 297B   6  612   11      V    V    VF     V           VV   V   VV    I V VV                
   310  228 C Y  E     -GI 261 295B   1  612    1      Y    Y    YY     C           YY   Y   FY    Y Y YY                
   311  229 C T  E     -GI 260 294B   2  612   39      S    T    AT     T           TT   T   CT    T S TS                
   312  230 C K  E >   - I   0 293B  21  612   42      N    K    RH     R           KR   K   DR    R Y DN                
   313  231 C V  G >  S+     0   0    1  611    8      V    V    VV     I           VV   V   VV    V V VV                
   314  232 C T  G 3  S+     0   0    2  609   71      T    T    SF     S           CT   C   PT    N P SH                
   315  233 C A  G <  S+     0   0   29  609   79      A    N    TR     K           RK   N   SK    K N AA                
   316  234 C F  S <> S+     0   0    7  605   35      L    Y    YL     F           YY   Y   VY    Y L MA                
   317  235 C L  H  > S+     0   0   23  603   80      L    L    RK     V           AL   N   RL    L K TL                
   318  236 C K  H  > S+     0   0  116  602   68      D    D    AK     P           QN   S   SN    P T DP                
   319  237 C W  H  > S+     0   0   26  602    1      W    W    AW     W           WW   W   WW    W W FW                
   320  238 C I  H  X S+     0   0    1  599   12      I    I    II     I           II   I   II    I I II                
   321  239 C D  H  < S+     0   0   66  570   71           Q    VQ     L           QD   A   ED    N D NQ                
   322  240 C R  H >< S+     0   0  136  556   71           D    EK     D           QS   S   KS    H S SL                
   323  241 C S  H >< S+     0   0    6  523   72           N    QV     T           TH   T   TH    H I VE                
   324  242 C M  T 3< S+     0   0   25  479   41           M    LI     V           MM   M   AM    L T TM                
   325  243 C K  T <  S+     0   0  153  444   70           Q    HD                  N   A   KN      R KA                
   326  244 C T    <         0   0   51  390   65           P    T                   A   A   EA      S                   
   327  245 C R              0   0  197  273   47                                        N                               
## ALIGNMENTS 1261 - 1330
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....7....:....8....:....9....:....0....:....1....:....2....:....3
     1   49 L Q              0   0  101  671   35   EE EEEEE  EE  EEEE D   E EEEEE  E E  E  EEEEEE NE E E E  EEN EE  EE D
     2   50 L a    >   +     0   0   22  858    0   CC CCCCC  CCCCCCCC C   CCCCCCCCCC C CC CCCCCCC CCCCCC C  CCCCCCCCCCCC
     3   51 L E  T 3  S+     0   0  187  858   80   EK WQQWL  QLLLWILS A   AALGAADEAS W PW ELLAAAA RWLALE E  EWRATDQQWSIN
     4   52 L T  T 3  S-     0   0  105  864   61   RS SRRSD  RDTTSDDT E   SSTSETMPQS T ET NNSPAPP GSSVSNSN TNTGSSRTSAPSP
     5   53 L S    <   +     0   0   89  868   72   PSNNYYSSN YSKKSSSN D   NNQNNEYNNN S GS NNSGSGG SSSDSDHD HDSSNNQNTSNNN
     6   54 L P        +     0   0   10  878   31   VPPPPPPNPPPNPPPNNP L   PPNPNNNVPPPPPTP PPSGNGG TPPNPYTHPAYPTPPPPSPPPP
     7   55 L b        -     0   0   18  893   21   CCCCGGCGCCGGCCCGGC C   CCGCGGGCCCCGCCT CCCGGGGCCCCGCYCYCCYGCCCCCCSCCC
     8   56 L Q  S    S+     0   0   92  892   83   SKERRRQQIQRQAAQQQQ L   QQGQGGGQQQQRLGR LHNNGNNRGQQGQNANQENRGAKGLSRAQL
     9   57 L N  S    S-     0   0   63  893   51   FNNNLLNCNNLCNNNCCN N   HNCNCCCNNSQLNIL HQNQCQQNQNNCNGTGNEGLQNNNHKLNNN
    10   58 L Q  S    S-     0   0  152  893   57   PGKGCCGSNGCSGGGSSG G   GGSGAAAGGGGCQNC GNGCNCCGDGQQQGTGGTGCDGRGGQCNEG
    11   59 L G        -     0   0   16  893   40   RGGGggGQGLgQGGGQQV G   GGQGHHQGGGGqGAq GAGnQanGSGGDGcAcAAcqSGGTGGqGGG
    12   60 L K  E     -S   23   0G 117  852   79   LTVTkkTLVTkLSSTLL. V   TTTTNFNNTTQtIKt TDViTiiS.TTQTdReQRet.QT.SEtTVA
    13   61 L a  E     -S   22   0G  45  882   10   CCCCCCCCCCCCCCCCCC C   CCCCCCCCCCCCCCC CCCCCCCC.CCCCCCCCCCC.CCCCCCCCC
    14   62 L K  E     -S   21   0G 155  890   81   RVvVEEVLNhELTTVLLI I   TETTTAHtTTTEVLE kEvNLTNVKVhWhIHIiQIEKSTKlTEMNK
    15   63 L X  E     +S   20   0G 120  768   39   NDqDNNDNKtNN..DNNN D   DDNDNHNcDD.NRSN nNdNNNN..DdNd.P.dP.N..NNeENNND
    16   64 L G        -     0   0   44  862   73   TGAGTTGQSGTQNNGQQT G   AETGITTFTGDTPKT GTHTSTT..GPTPNANRGNT.ATTGTTHEG
    17   65 L L  S    S-     0   0  152  871   64   LILILLVPIPLPLLVPPD L   LVIVLQDGGVTLEDL TVLIVII..VLILITIDTIL.FLVGILVDI
    18   66 L G  S    S+     0   0   67  883   63   GNSAGGAGDYGGnnAGGG N   DNGNGTGgENgGQDG MGGGGGGQ.AEGEpgpGgpG.eGGGGGNgN
    19   67 L E        -     0   0  119  837   61   SR.ASSYGDSSGddYGGN N   SGSSGGSsTGsS.KS .G.DSDDPSYVSVndnDgnSShGS.NSStS
    20   68 L Y  E     -S   15   0G  37  883   11   YYYYYYYFYNYFYYYFFY Y   YYYYYHYTYYYY.YY YYKYYYYGYYYYYYYYYYYYYYYYYYYYYF
    21   69 L T  E     -S   14   0G  71  886   82   ASRNLLNATNLAQQNAAT T   TTSTTRYFTNTR.NR GERTSTTRSNRYRRTRSTRRSIVNSTRRNA
    22   70 L b  E     -S   13   0G  20  889    0   CCCCCCCCCCCCCCCCCC C   CCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    23   71 L T  E     -S   12   0G  85  890   86   DTNTSSTATTSAATTAAT S   STSVSTSDDTDSEES SSQSSSARTTTITTETLETSTTSLLSSTTS
    24   72 L c        -     0   0   44  890    0   CCCCCCCCCCCCCCCCCC C   CCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    25   73 L L    >   -     0   0   62  890   88   PVLPSSPEALSERRPEEA P   TASRRRDPWQPAAKA DKLNLNNPAPPQPFAFPAFAAPRYPYALPI
    26   74 L E  T 3  S+     0   0  177  890   75   EAPDVVETAPVTAPETTS P   SPEPHRDDASSTPES QDPSTSSAEESASDSDEADSEPAPQSSACP
    27   75 L G  T 3  S+     0   0   29  893   20   GGGGGGGGNGGGGGGGGG G   GGGGGGGGAGGGGGG GGGGGGGGGGGGGGGGGGGGGNGGGGGGGG
    28   76 L F  E <   +T   36   0H  40  893    9   YFFFFFFFYYFFFFFFFY F   FYFFFFYFWYYFWFF FYFYYYYWYFYQYFYFFYFFYFYFYFFFWF
    29   77 L E  E     +T   35   0H  74  893   73   eTTIrrSeTTreTTSeeI T   QEaTvitDTATlGel ThTstssRtSKkKmqmHrmltHTqSYvTNT
    30   78 L G  S >  S-     0   0   32  889    5   rGGGggGgGGggGGGggG G   GGgGgggGGGGgGgg GgGggggGgGGgGgggGggggGGnGGgGGG
    31   79 L K  T 3  S+     0   0  156  891   73   RKTLRRSFKIRFKKSFFR S   DVHTHHYKDSEKKKK ELKRKRRDKSRRRHRHKRHKKQPNEPKETS
    32   80 L N  T 3  S-     0   0   33  892   62   DNNNSSNGNNSGDDNGGN N   NHTHGDSFNNNRHHH NIFGGGGTYNNGNNNNDGNHYTNDSRHRNR
    33   81 L c  S <  S+     0   0    1  892    3   SCCCCCCCCCCCCCCCCC C   CCCCCCCCCCCCCCC CCCPAPPCCCCCCCCCCCCCCCCCCCCCCC
    34   82 L E        +     0   0   87  891   44   DETEEEESETEASSESAE E   EEAEEEDEEEQEHIE EDESSSSQEEEEELVLEQLEEREIEEEEET
    35   83 L L  E    S-T   29   0H  96  889   88   KTIEDDEDIKDDIIEDDE V   TSDTDGDMTTIDVPD ILKGGGGSDEVDVDDDMDDDDQTDIYDIID
    36   84 L F  E     -T   28   0H 139  889   83   CDNNIINIDDIIDDNIIY N   DGFDNNVNDDDVDIV DTKCCCCDVNSVSVVVKVVVVDDTDvVNQE
    37   85 L T        -     0   0   44  677   75   v.I...V.....IIV... I   IN.I.DNI.V..V.. IVItlttV.VLDL...A....VI.Ie.VII
    38   86 L R        +     0   0   57  408   92   i................. .   .S............. ...lnll..................f....
    39   87 L K        +     0   0   96  535   81   D......D...D...DD. .   .CD.N.......DN. ...DNDDDN....DNDGDD.NN.D.K....
    40   88 L L        -     0   0   91  608   90   E......E...E...EE. .   .IE.EEE.....EP. .N.EEEEEE..E.EEEPEE.EE.E.L....
    41   89 L d  S  > S+     0   0   15  617   29   C......C...C...CC. .   .SC.CCC.....CC. .C.CCCCCC..C.CCCCCC.CC.C.P....
    42   90 L S  T  4 S+     0   0   98  624   84   G......S...S...SS. .   .FL.GAE.....RK. .F.SSSSSA..A.QAQEEQ.AA.V.Q....
    43   91 L L  T >4 S-     0   0  120  627   87   S......Q...Q...QQ. .   .LI.STY.....GT. .N.TSTTAF..L.DTDKED.FV.S.Y....
    44   92 L D  G >4 S-     0   0  107  638   73   G......D...D...DD. .   .ER.GEA.....GN. .D.NANNRW..V.NGNAGN.WS.L.V....
    45   93 L N  G >< S-     0   0    8  700   56   AI.F...YIL.Y...YYN .   .VN.NNN.V.I.IN. .N.NNNNRN..N.NFNGLN.NP.R.L..V.
    46   94 L G  G <  S-     0   0    0  882   52   ADDNNNDGDNNGDDDGGG N   DDGNGGGDDDNNTGN DGDGGGGGHDDGDGHGSGGNHSNGDTNDDN
    47   95 L D  G <  S+     0   0   44  887   62   REDEEEENPLENEEENNS D   EEGEGGGEEEEELDE DGHNGNNGGESGSGRGPQGEGPDLDNEDEE
    48   96 L e    <   -     0   0    0  892    0   CCCCCCCCCCCCCCCCCC C   CCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    49   97 L D  S    S-     0   0   59  892   74   DAELSSMSRRSSGGMSST D   ATGAAAEAQADESPE VSKGQGGPTMSQSQGQKGQETRSRQSEETL
    50   98 L Q  S    S+     0   0    2  892   63   HghssssDrtsDsssDDn s   ssQsHHQsqgsaHva sHpQHQQQLssQsQpQnpQtLnpnshagvs
    51   99 L F  E     -U   62   0I   4  892   80   KtispplIfapIttlIIv t   atVtRFItttnrHtr tFlNINNRGltRtIvIqvIrGtsntfrtqt
    52  100 L d  E     +U   61   0I  10  893    1   CCCCCCCCCCCCCCCCCC C   CCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCSCCCC
    53  101 L H  E     -U   60   0I  68  893   87   VKVHSSRILLSIMMRVIR I   IENLIATHTQVSVES INRNTNNVERHIHVVVQLVSEITIIFSKVK
    54  102 L E  E     -U   59   0I  92  893   68   NDDDQQDNRWQNNNDNNE D   DDNDHHNDNEDQNLQ DISNNNNNNDANANNNDNNQNNDNDNQDDD
    55  103 L E  S    S-     0   0  100  893   82   TGgQeerlNtelrrrllt g   LEagTTTdTGKetie ePeVLVVTIrqTqalaevaeIegtESeqEy
    56  104 L Q  S    S-     0   0  175  693   73   EIqDnnn.Npn...n..e .   VV..QQV.PVIn.pn ...PPPPAPnePe...g..nP...IQn.q.
    57  105 L N  S    S+     0   0  154  838   66   GN.NggGgYMggnnGggG n   NNgnSTGnGNNggGg n.nGGGGGGGdGdgggtgggGgngN.gngn
    58  106 L S  S    S-     0   0   58  853   65   SGSASS.TSSSTSS.TT. T   SGRSGGSSSQGSSKS T.SSSSSSS.gTgSSSNSSSSSSSS.SS.S
    59  107 L V  E     -U   54   0I   7  890   79   YFYFYYYHYYYHFFYHHP F   YYYYHHFYYFYYFSY FTYYYYYYYYFFFYYYFYYYYYFFFCYFYY
    60  108 L V  E     -U   53   0I  45  891   88   HTKVQQIAHNQAEEIAAK A   STSTRRYRSSVQTKQ VGTHAHHWYITHTERETREQYLRVVSQRHV
    61  109 L e  E     +U   52   0I   5  893    1   CCCCCCCCCCCCCCCCCC C   CCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCFCCCC
    62  110 L S  E     -U   51   0I  24  893   75   REEAYYTALNYAVVTAAV K   STSVITSSSSSYSVY LSYSSSSQTTSDSQEQREQYTRSVLHYQVS
    63  111 L f        -     0   0   23  893    0   CCCCCCCCCCCCCCCCCC C   CCCCCCCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
    64  112 L A    >   -     0   0    8  893   75   RPIARRQELSREAAQEEP A   AAWRPRYLAAQRPLR LPSYNYYWPQPDPHRHLHHRPPLLLARITA
    65  113 L R  T 3  S+     0   0  149  893   80   KVSPRRPRSSRRNNPRRH K   SPESQRDPDDPQQPQ PGPDSDDEVPSTSSSSASSQVPPDPEQPAP
    66  114 L G  T 3  S+     0   0   24  893    8   GGGGGGGGGGGGGGGGGA G   GGGGGGGGGGGGGGG SSGGGGGGGGGGGGGGGGGGGEGGSGGGGG
    67  115 L Y  E <   -V   78   0J  20  893   11   YYYFYYYYYYYYYYYYYN F   FYFFFFYYWFWYLMY YCYFYFFHFYFYFFYFFYFYFYFYYYYYYY
    68  116 L T  E     -V   77   0J  72  891   85   TSTIQQLETTQERRLEEC R   QERTSITTTDEQVEQ GWMRQRRSILEREFEFVRFQITTKGTQVAT
    69  117 L L  E     -V   76   0J  67  888   64   LGGGLLGLGGLLGGGLLS G   GGLGLLLGGGGLLSL GTGLLLLLLGGRGLFLGPLLLGGLGLLGGG
    70  118 L A    >   -     0   0   23  889   78   ASRESSSAQKSARKSAAS K   TDDTMMNDTTKAGSA SLEQQQQSLSLHLSASAASALPASANARFP
    71  119 L D  T 3  S+     0   0  175  889   77   PTFFddHKNNdKQQHEKl T   NHDHAAAnNLNEPDE LdKGPGGAPHTATDDDLEDEPHRPTGEIYI
    72  120 L N  T 3  S-     0   0   92  694   44   DC..dd.DCCdD...DDn .   CCF.DDDeCCCDDPD .d.DDDDDD..D.NDNCDNDDC.D..D...
    73  121 L G  S <  S+     0   0   16  713   66   GE..GG.KETGK...KKN .   EEL.GGGSGDEGGSG .N.GAGGGG..E.QRQEGQGGQ.G..G...
    74  122 L K  S    S+     0   0   71  687   76   HI..VV.QQKVQ...QQS .   AIH.HHSAENRHHKH .K.KKKKTK..R.HHHHHHHKR.S..H...
    75  123 L A        -     0   0   22  685   66   KD..TT.SDDTS...SSI .   GGN.GGSGDDSTTGT .T.SSSSLR..T.TTTDGTTRL.D..T...
    76  124 L f  E     -V   69   0J  12  847    9   CICCCCCCIICCCCCCCC C   TKCCCCCSVIVCCCC CCCCCCCCCCCCCCCCVCCCCYCIC.CCCC
    77  125 L I  E     -V   68   0J  78  846   80   QDEEEEEQNNEQDDEQQD H   NFNEEEDTNDNTATT EIHSVSSVHEGIGIIIDVITHQANE.IQQE
    78  126 L P  E     -V   67   0J  62  850   71   AElVDDLDEPDDEELDDL a   ISDTDEPREEEDEQD KlRENEEPQLmKmHlhDlHDQPTEKpDNTT
    79  127 L T  S    S+     0   0  103  652   80   .CpD..D.CC....D... .   GH.DSNVMCCC.G.. .a.....KLD.T.RtsCtR.LCECD..K.N
    80  128 L G  S    S-     0   0   32  788   69   DAmIIIVVHrIVEEVVV. .   cYVIDCDmAGWIv.I Dt.IIIIGIV.D.spsLpsIILLlT.IV.I
    81  129 L P  S    S+     0   0  116  601   75   LGn.....Ap..SS.... y   sI..P.VpNSP.eK. Ts........t.tgpgMag..P.p.e.D..
    82  130 L Y  S    S+     0   0   59  794   86   NNYADDADNFDDYFADD. H   SCDNC.DYSSSDPSD EM.DNDD..AD.DMNMRDMD.SNGELDY.Q
    83  131 L P    >   -     0   0   17  799   62   EP VEEVEPPEE  VEEH D   PTEEAGEQPPPEPAE GKPEEEE.AVDPDNPNPPNEAPETGEE PD
    84  132 L g  T 3  S+     0   0   16  800    5   CC CCCCCCCCC  CCCC C   CCCC CCCCCCCPCC CCCCCCC.CCCCCCCCCCCCCCCCCCC CC
    85  133 L G  T 3  S+     0   0    0  712   37   NA DAAEA  AA  EAA  A   QTSG GASEE AGTA DGQ T  GPEVAV E AE AP QGE A  T
    86  134 L K    <   -     0   0   69  588   68   NN    T       T        NS S H SNN QA Q HSD    PSTK K   N  QS S H Q   
    87  135 L Q        -     0   0   37  477   65         G       G         D     A    S    GI    P G            V       
    88  136 L T        +     0   0    4  428   78         T       T         P     S    I    S     R T            P       
    89  137 L L        +     0   0  105  372   61         G       G                    L    M     V G                    
    90  138 L E              0   0  104  274   69         A       A                    S    E     A A                    
    91  139 L R              0   0  231  199   47         R       R                                 R                    
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2  I                  I III               I                              
    94   17 C V  B     -A  271   0A   7  590    9  V                  V VTV               V                              
    95   18 C G  S    S+     0   0   25  591    6  G                  G GYG               G                              
    96   19 C G  S    S-     0   0   26  592    0  G                  G GGG               G                              
    97   20 C Q  E     -B  237   0B  98  593   95  V                  Q HDN               S                              
    98   21 C E  E     -B  236   0B  80  594   67  E                  E EDA               A                              
    99   22 C h        -     0   0    8  594   58  S                  A AAA               A                              
   100   23 C K    >   -     0   0  123  593   78  R                  H VAR               P                              
   101   24 C D  T 3  S+     0   0   60  594   85  Q                  G AVP               V                              
   102   25 C G  T 3  S+     0   0    0  595   74  G                  N GGG               G                              
   103   26 C E  S <  S+     0   0   36  595   66  T                  K SKS               R                              
   104   27 C h    >   +     0   0    4  595   92  W                  W WWW               Y                              
   105   28 C P  T 3   +     0   0    0  599    9  P                  P PPP               P                              
   106   29 C W  T 3  S+     0   0    5  600   26  W                  W WWW               Y                              
   107   30 C Q  E <   -J  122   0C   7  601   26  Q                  q mQq               M                              
   108   31 C A  E     -JK 121 146C   1  593   49  V                  d iVy               V                              
   109   32 C L  E     -JK 120 145C   3  598   68  A                  T QQL               S                              
   110   33 C L  E     -JK 119 144C   0  601    9  L                  Y LLL               L                              
   111   34 C I  E     -JK 117 143C   0  601   81  L                  W RTR               R                              
   112   35 C N  E >   - K   0 142C  30  601   88  L                  M PLY               D                              
   113   36 C E  T 3  S+     0   0   63  117   78  .                  . LA.               A                              
   114   37 C E  T 3  S-     0   0  136  242   77  N                  . EG.               S                              
   115   38 C N  S <  S+     0   0   84  565   53  G                  . NS.               G                              
   116   39 C E        -     0   0  100  589   94  T                  . SNG               S                              
   117   40 C G  E     +J  111   0C  14  600   57  Q                  H HSS               H                              
   118   41 C F  E     +     0   0C  28  611   33  F                  F Lff               Y                              
   119   42 C i  E     -J  110   0C   0  612    1  C                  C Ccc               C                              
   120   43 C G  E     -J  109   0C   1  612    1  G                  G GGG               G                              
   121   44 C G  E     -J  108   0C   0  612    9  G                  G GGG               G                              
   122   45 C T  E     -JL 107 130C   0  612   45  S                  S TTN               S                              
   123   46 C I  E     + L   0 129C   0  612   23  L                  L LLL               L                              
   124   47 C L        -     0   0    6  612   27  V                  I IVI               I                              
   125   48 C S  S    S-     0   0   22  612   56  T                  H SGH               A                              
   126   49 C E  S    S+     0   0   99  612   63  P                  P DGP               P                              
   127   50 C F  S    S+     0   0   42  612   83  E                  Q LQL               R                              
   128   51 C Y  E     - M   0 185C   7  612   34  W                  W WFW               V                              
   129   52 C I  E     -LM 123 184C   0  612   14  V                  V IVV               L                              
   130   53 C L  E     +LM 122 183C   0  612   27  V                  L LVL               L                              
   131   54 C T  E     - M   0 182C   0  612   43  T                  T STT               T                              
   132   55 C A    >>  -     0   0    0  613    2  A                  A AAA               A                              
   133   56 C A  G >4 S+     0   0    0  613    9  A                  A AAA               A                              
   134   57 C H  G >4 S+     0   0    7  613    0  H                  H HHH               H                              
   135   58 C i  G X4 S+     0   0    0  613    1  C                  C CCC               C                              
   136   59 C L  G << S+     0   0   31  613   66  F                  V FLV               V                              
   137   60 C Y  G <  S+     0   0  109  613   87  H                  G FEE               A                              
   138   61 C Q  S <  S+     0   0   95  613   78  d                  p rPd               d                              
   139   61AC A        -     0   0   16  373   75  e                  p p.p               h                              
   140   62 C K  S    S-     0   0  172  387   77  D                  N T.S               K                              
   141   63 C R  S    S-     0   0  162  602   78  H                  K V.E               F                              
   142   64 C F  E     -K  112   0C  36  609   54  W                  V Y.Y               P                              
   143   65 C K  E     -K  111   0C  67  609   79  T                  R E.N               S                              
   144   66 C V  E     -KN 110 161C   0  609   16  V                  V A.V               V                              
   145   67 C R  E     -KN 109 160C  40  609   55  T                  Q Y.I               H                              
   146   68 C V  E     +KN 108 159C   1  610   43  L                  L L.L               I                              
   147   69 C G  S    S+     0   0    9  610   15  G                  R G.G               G                              
   148   70 C D        +     0   0   11  611   58  E                  K K.K               R                              
   149   71 C R  S    S+     0   0   24  611   73  H                  Q H.Y               Q                              
   150   72 C N  B >   -P  234   0D  18  611   65  K                  Y S.N               Y                              
   151   73 C T  T 3  S+     0   0   56  611   80  L                  L I.K               L                              
   152   74 C E  T 3  S-     0   0  119  611   84  K                  Y R.S               S                              
   153   75 C Q  S <  S-     0   0  130  610   85  D                  Y T.A               Q                              
   154   76 C E        +     0   0  165  610   85  k                  H E.y               A                              
   155   77 C E        -     0   0   93  469   27  f                  . E.d               E                              
   156   78 C G  S    S+     0   0   46  578   34  E                  . S.P               S                              
   157   79 C G  S    S+     0   0   47  585   75  q                  . Y.T               D                              
   158   80 C E        -     0   0   37  472   30  r                  D Q.E               Y                              
   159   81 C A  E     -N  146   0C  27  487   57  D                  H Q.Q               D                              
   160   82 C V  E     -N  145   0C  71  590   83  I                  L R.R               V                              
   161   83 C H  E     -N  144   0C  14  599   76  S                  M I.L               R                              
   162   84 C E        -     0   0   90  602   78  A                  T E.A               R                              
   163   85 C V  E     -O  186   0C  27  607   64  I                  V I.V               T                              
   164   86 C E  E    S+     0   0C  70  608   73  Y                  S A.S               V                              
   165   87 C V  E     -O  185   0C  13  609   72  L                  Q E.Q               T                              
   166   88 C V  E     -O  184   0C  72  610   46  H                  I I.I               T                              
   167   89 C I  E     +O  183   0C  27  610   43  E                  I I.I               A                              
   168   90 C K  E     -O  182   0C  68  610   82  A                  T L.S               I                              
   169   91 C H    >   -     0   0   19  611   13  Y                  H H.H               H                              
   170   92 C N  T 3  S+     0   0  156  611   61  k                  P E.N               G                              
   171   93 C R  T 3  S+     0   0  150  608   73  m                  D D.E               S                              
   172   94 C F    <   -     0   0   24  611    5  F                  F FFY               Y                              
   173   95 C T     >  -     0   0   56  611   68  l                  Y ENs               D                              
   174   96 C K  T  4 S+     0   0  145  561   78  i                  . P..               P                              
   175   97 C E  T  4 S+     0   0  174  569   91  K                  . AF.               A                              
   176   98 C T  T  4 S-     0   0   44  598   57  D                  I AQ.               T                              
   177   99 C Y    ><  +     0   0   60  604   65  T                  V FI.               S                              
   178  100 C D  T 3   +     0   0   25  609   37  p                  q Rh.               A                              
   179  101 C F  T 3  S+     0   0   21  595   66  f                  a Nny               N                              
   180  102 C D    <   +     0   0    1  609    0  D                  D DDd               D                              
   181  103 C I        +     0   0    0  611   13  I                  I IIL               I                              
   182  104 C A  E     -MO 131 168C   0  611   60  A                  A AAA               A                              
   183  105 C V  E     -MO 130 167C   0  612   16  L                  L LVL               L                              
   184  106 C L  E     -MO 129 166C   0  613   30  V                  L LLL               L                              
   185  107 C R  E     -MO 128 165C  40  613   43  R                  K RQK               R                              
   186  108 C L  E     - O   0 163C   0  613   16  L                  L LLL               L                              
   187  109 C K  S    S+     0   0  101  613   69  S                  T AKA               D                              
   188  110 C T  S    S-     0   0   82  614   74  E                  N ASQ               A                              
   189  111 C P        -     0   0   48  614   39  P                  P PYP               a                              
   190  112 C I        -     0   0    4  562   63  A                  V A.V               a                              
   191  113 C T        -     0   0   95  566   73  I                  N H.T               P                              
   192  114 C F        +     0   0   56  612   34  F                  I L.L               L                              
   193  115 C R  B >   -Q  196   0E  52  613   63  D                  S NeN               A                              
   194  116 C M  T 3  S+     0   0   29  594   77  E                  D HdQ               .                              
   195  117 C N  T 3  S+     0   0   13  602   90  N                  Y RYY               .                              
   196  118 C V  B <   +Q  193   0E   0  604   27  V                  V VIV               .                              
   197  119 C A        -     0   0    1  606   80  S                  H SNW               .                              
   198  120 C P        -     0   0    8  608   54  P                  P PSP               .                              
   199  121 C A        -     0   0    2  609   39  I                  V AAV               .                              
   200  122 C g  B     -c  290   0B   1  610   66  C                  P CCC               .                              
   201  123 C L        -     0   0   27  612    5  L                  L LLL               L                              
   202  124 C P        -     0   0    7  613   30  L                  P PPV               P                              
   203  124AC E     >  -     0   0   92  612   75  P                  P EGS               T                              
   204  125 C R  H  > S+     0   0  109  612   78  P                  A DAG               F                              
   205  126 C D  H  > S+     0   0  124  612   85  E                  S DDP               D                              
   206  127 C W  H  >>S+     0   0    4  612   88  H                  E VTG               L                              
   207  128 C A  I  X>S+     0   0    0  612   75  K                  T KED               V                              
   208  129 C E  I  <5S+     0   0   75  613   82  L                  F VFD               P                              
   209  130 C S  I  <5S+     0   0   70  614   66  P                  P GGP               A                              
   210  131 C T  I  <5S+     0   0   18  108   73  .                  . ...               .                              
   211  131AC L  I ><  S-     0   0  119  503   80  R                  . ...               e                              
   227  146 C E  T 3  S+     0   0   47  527   75  W                  D .E.               G                              
   228  147 C K  T 3  S+     0   0  169  548   68  N                  N .N.               G                              
   229  149 C G  S <  S-     0   0   29  559   66  G                  G .G.               M                              
   230  150 C R        -     0   0  213  584   86  T                  V .T.               Y                              
   231  151 C Q  B     -R  224   0F  79  599   93  Q                  N .Q.               L                              
   232  152 C S        -     0   0   14  607   51  P                  L .P.               S                              
   233  153 C T  S    S+     0   0   48  608   73  E                  P .D.               S                              
   234  154 C R  B    S-P  150   0D 102  608   85  A                  P .F.               D                              
   235  155 C L        -     0   0    3  610    3  L                  P .LL               L                              
   236  156 C K  E     -BD  98 221B  31  610   51  R                  F .QK               Q                              
   237  157 C M  E     -BD  97 220B  18  611   94  E                  P EDQ               H                              
   238  158 C L  E     - D   0 219B   4  612   44  A                  L EAA               V                              
   239  159 C E  E     - D   0 218B 107  612   72  K                  Q PRR               T                              
   240  160 C V  E     - D   0 217B   0  612   46  V                  V EVV               I                              
   241  161 C P  E     - D   0 216B  34  612   28  R                  P TAP               A                              
   242  162 C Y  E     -F  263   0B  36  613   46  L                  I GLL               Y                              
   243  163 C V  E     -F  262   0B  24  614   37  V                  I FIV               F                              
   244  164 C D     >  -     0   0   88  613   57  P                  E KPS               D                              
   245  165 C R  H  > S+     0   0   51  613   78  T                  N KDN               A                              
   246  166 C N  H  > S+     0   0  105  614   74  W                  H RSD               A                              
   247  167 C S  H  > S+     0   0   48  614   78  V                  L TAK               T                              
   248  168 C j  H  X S+     0   0    1  614    2  C                  C CCC               C                              
   249  169 C K  H >< S+     0   0   88  614   73  n                  d mld               q                              
   250  170 C L  H 3< S+     0   0  150  574   89  n                  g ksp               l                              
   251  171 C S  H 3< S+     0   0   23  604   76  S                  D FYA               Y                              
   252  172 C S    <<  -     0   0   20  607   83  Y                  N KGL               P                              
   253  173 C S  S    S+     0   0   79  607   83  N                  V DSA               F                              
   254  174 C F  S    S-     0   0  124  607   79  G                  H NRG               G                              
   255  175 C I        -     0   0  100  608   87  T                  I WFK               Q                              
   256  176 C I        -     0   0   13  609   18  I                  V SYI               I                              
   257  177 C T    >   -     0   0   16  614   35  H                  R SQT               K                              
   258  178 C Q  T 3  S+     0   0  133  614   68  S                  D DEE               P                              
   259  179 C N  T 3  S+     0   0   24  614   60  R                  D GEF               G                              
   260  180 C M  E <   - G   0 311B   2  614   13  A                  M RMM               M                              
   261  181 C F  E     - G   0 310B   8  613   35  L                  L RIM               L                              
   262  182 C j  E     +FG 243 309B   1  614    1  C                  C CCC               C                              
   263  183 C A  E     +FG 242 308B   0  614   26  A                  A RAA               A                              
   264  184 C G  S    S-     0   0    3  614   10  G                  G LGg               G                              
   265  185 C Y        -     0   0   56  591   57  F                  . PYy               A                              
   266  185AC D  S    S-     0   0   81  594   83  K                  . TWD               L                              
   267  185BC T  S    S+     0   0   76  614   61  E                  N TDS               A                              
   268  186 C K  S    S-     0   0  107  563   32  G                  E IGG               G                              
   269  187 C Q  S    S+     0   0  102  569   37  G                  G VKG               G                              
   270  188 C E        +     0   0   33  613   55  V                  H TVR               K                              
   271  189 C D  B     -A   94   0A   7  614    4  D                  D ADD               D                              
   272  190 C A        -     0   0    7  614   42  A                  S DTT               S                              
   273  191 C k    >   -     0   0    7  614    3  C                  C CCC               C                              
   274  192 C Q  T 3  S+     0   0   90  614   25  Q                  Q VQQ               Q                              
   275  193 C G  T 3  S+     0   0    6  614    8  Y                  G GGG               G                              
   276  194 C D    X   +     0   0    0  614    0  D                  D DDD               D                              
   277  195 C S  T 3  S+     0   0   14  614    1  S                  S SSS               S                              
   278  196 C G  T 3  S+     0   0    0  614    0  G                  G GGG               G                              
   279  197 C G    <   -     0   0    0  614    1  G                  G GGG               G                              
   280  198 C P  E     - H   0 294B   1  614    2  P                  P PPP               P                              
   281  199 C H  E     -EH 219 293B   0  614   49  L                  L LLL               L                              
   282  200 C V  E     -EH 218 291B   3  614   26  Q                  V MVV               V                              
   283  201 C T  E     - H   0 290B   0  614   66  C                  C CCC               L                              
   284  202 C R  E     + H   0 289B  99  614   70  E                  K EAS               P                              
   285  203 C F  E >  S- H   0 288B  22  614   71  H                  V srA               s                              
   286  204 C K  T 3  S-     0   0   85  222   71  D                  E ddG               a                              
   287  205 C D  T 3  S+     0   0  108  223   55  G                  D GNG               S                              
   288  206 C T  E <   - H   0 285B   3  233   75  R                  T HRR               G                              
   289  207 C Y  E     - H   0 284B  21  242   51  W                  W WWW               D                              
   290  208 C F  E     -cH 200 283B   0  613   91  Y                  L FYT               L                              
   291  209 C V  E     + H   0 282B   1  613   38  L                  Q LLL               Q                              
   292  210 C T  E     +     0   0B   1  613   84  T                  A YTY               L                              
   293  211 C G  E     -IH 312 281B   0  613    0  G                  G GGG               G                              
   294  212 C I  E     -IH 311 280B   0  613   19  L                  V IVV               V                              
   295  213 C V  E     +I  310   0B   7  613   14  V                  V TTT               T                              
   296  214 C S  E     -     0   0B   1  612    0  S                  S SSS               S                              
   297  215 C W  E     -I  309   0B  45  613    7  W                  W YWW               W                              
   298  216 C G        -     0   0   26  613    0  G                  G GGG               G                              
   299  217 C E  S    S-     0   0   25  609   90  H                  E EDE               Y                              
   300  218 C G  S    S-     0   0   19  612   13  E                  G GGG               G                              
   301  220 C k  S    S-     0   0    7  613    2  C                  C CCC               C                              
   302  221 C A  S    S+     0   0    4  612   16  A                  A AGA               A                              
   303  222 C R    >   -     0   0  105  611   73  R                  Q QIQ               R                              
   304  223 C K  T 3  S+     0   0  152  611   64  P                  P PAP               P                              
   305  223AC G  T 3  S+     0   0   26  613   58  Q                  N RRT               G                              
   306  224 C K    <   -     0   0   43  613   85  K                  R NKY               L                              
   307  225 C Y        -     0   0   33  613   50  Y                  P PPP               P                              
   308  226 C G  E     -G  263   0B   4  611    2  G                  G AGG               G                              
   309  227 C I  E     -GI 262 297B   6  612   11  V                  I VIV               V                              
   310  228 C Y  E     -GI 261 295B   1  612    1  Y                  Y YSY               Y                              
   311  229 C T  E     -GI 260 294B   2  612   39  S                  T TAA               T                              
   312  230 C K  E >   - I   0 293B  21  612   42  N                  R KRR               S                              
   313  231 C V  G >  S+     0   0    1  611    8  M                  V VVV               T                              
   314  232 C T  G 3  S+     0   0    2  609   71  Q                  T PTS               A                              
   315  233 C A  G <  S+     0   0   29  609   79  V                  Y ANS               H                              
   316  234 C F  S <> S+     0   0    7  605   35  M                  Y MYM               Y                              
   317  235 C L  H  > S+     0   0   23  603   80  T                  L VIL               R                              
   318  236 C K  H  > S+     0   0  116  602   68  S                  D PDG               S                              
   319  237 C W  H  > S+     0   0   26  602    1  W                  W WWW               W                              
   320  238 C I  H  X S+     0   0    1  599   12  V                  I IIL               I                              
   321  239 C D  H  < S+     0   0   66  570   71  V                  H RKH               N                              
   322  240 C R  H >< S+     0   0  136  556   71  R                  R ESQ                                              
   323  241 C S  H >< S+     0   0    6  523   72  M                  Y  IT                                              
   324  242 C M  T 3< S+     0   0   25  479   41  M                  V  MM                                              
   325  243 C K  T <  S+     0   0  153  444   70  A                  P  ND                                              
   326  244 C T    <         0   0   51  390   65  E                  K  NN                                              
   327  245 C R              0   0  197  273   47  H                  D   N                                              
## ALIGNMENTS 1331 - 1400
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....4....:....5....:....6....:....7....:....8....:....9....:....0
     1   49 L Q              0   0  101  671   35  EE  QEEEEEE  E EEE  E E  EDEEE DEEE E  EE     QEEEE  EEEEEEEEDDD  E EE
     2   50 L a    >   +     0   0   22  858    0  CC  CCCCCCCCCCCCCC  C CC CCCCCCCCCC CCCCC  CC CCCCC  CCCCCCCCCCCCCCCCC
     3   51 L E  T 3  S+     0   0  187  858   80  WW  FEEQQQSIAWEEQE  Q QE AAAWAQAEEE EVDQQ  VV AVVVV  AAAAAAAASSNEEAGEE
     4   52 L T  T 3  S-     0   0  105  864   61  TTT PRNRRRSSSTNTRNS R RN SDTTSPSNNS SSSRR  SS ENNNN  TTTTTTTTPPPSPSNKK
     5   53 L S    <   +     0   0   89  868   72  SSH LEDYYYNSGSNLYDH Y YN HASSHTSDDN NSSYY  SS KSSSS  IIIIIIIIDDNSNSHQQ
     6   54 L P        +     0   0   10  878   31  PPT PDYPPPNPPPPPPYT P PP PPPPPSPSHP PPPPP  PP PPPPP  AAAAAAAAPPPPPPSPP
     7   55 L b        -     0   0   18  893   21  GGC CNYGGGGCCGCCGYC GCGC CCCSCCCYYC CCCGGC CC CCCCCC SSSSSSSSCCCCCCCCC
     8   56 L Q  S    S+     0   0   92  892   83  RRD HANRRRGQQRLLRND RRRL QCLRQSANNV MQERRR QQ KLLLLK NNNNNNNNLLLQGRFGG
     9   57 L N  S    S-     0   0   63  893   51  LLV EGGLLLCGNLHNLGM LNLH NQNLNQNGGN NNNLLN NN NNNNNN QQQQQQQQNNNNNNNNN
    10   58 L Q  S    S-     0   0  152  893   57  CCT DCGCCCEKGCGGCGT CGCG GQGCGQGGGG GGGCCG QQ GGGGGG CCCCCCCCNNGNNRLGG
    11   59 L G        -     0   0   16  893   40  qqA gvcgggQcGqGGgcA gGgG GVGqGGGccG GGGggG GG AAAAAQ aaaaaaaaAAGGGAVTT
    12   60 L K  E     -S   23   0G 117  852   79  ttQ fdekkkIpTtTSkeR kSkT T.StTETeeT TATkkS VV MTTTT. llllllllTTTTET...
    13   61 L a  E     -S   22   0G  45  882   10  CCC CCCCCCCYCCCCCCC CCCC CCCCCCCCCC CCCCCC CC CCCCCC CCCCCCCCCCCCCC.CC
    14   62 L K  E     -S   21   0G 155  890   81  EEL KVIEEEKPFEkIEIH EVEk TAVETIRIIK KqVEEV RR SKKKKF VVVVVVVVTTTseT.KK
    15   63 L X  E     +S   20   0G 120  768   39  NNV D..NNNN.HNnNN.P N.Nn HNENHED... .q.NN. DD DDDDDN DDDDDDDDDDDdeN.NN
    16   64 L G        -     0   0   44  862   73  TTG GNNTTTQ.YTGRTNG T.TG GTGTSTGNND DSGTT. DD STTTTS TTTTTTTTGGGEPT.TT
    17   65 L L  S    S-     0   0  152  871   64  RRT QIILLLE.ILTLLIP L.LT VPILVIVIIM MSALL. HH VLLLLL LLLLLLLLLLVNGQ.VV
    18   66 L G  S    S+     0   0   67  883   63  GGg GppGGGGGGGMGGpg GQGM NGGGNGNppt tEgGGQ tt GGGGGG TTTTTTTTDDNGgGGGG
    19   67 L E        -     0   0  119  837   61  SSa RnnSSSGGKS.GSnh SPS. SGNSSNDnng gEsSSP ll GSSSSS SSSSSSSSNNS.eDASS
    20   68 L Y  E     -S   15   0G  37  883   11  YYY YYYYYYYFYYYYYYY YGYY FYYYFYYYYY YYFYYG FF YYYYYY YYYYYYYYYYFYRYYYY
    21   69 L T  E     -S   14   0G  71  886   82  RRS TRRLVLMTKRGQLRT LRLG TEQRSTSRRV ITTLLR TT DRRRRT YYYYYYYYTTTKVSRNN
    22   70 L b  E     -S   13   0G  20  889    0  CCC CCCCCCCCCCCCCCC CCCC CCCCCCCCCC CCCCCC CC CCCCCC CCCCCCCCCCCCCCCCC
    23   71 L T  E     -S   12   0G  85  890   86  SSE VTTSSSSQDSSFSTE SRSS QGISQSTTTT TSISSR TT VNNNNT DDDDDDDDNNTQKTELL
    24   72 L c        -     0   0   44  890    0  CCC CCCCCCCCCCCCCCC CCCC CCCCCCCCCC CCCCCC CC CCCCCC CCCCCCCCCCCCCCCCC
    25   73 L L    >   -     0   0   62  890   88  AAA RYFSSSESLADSSFT SPSD PYPAPYPFFR RAKSSP KK KKKKKK NNNNNNNNLLVELRRYY
    26   74 L E  T 3  S+     0   0  177  890   75  SSS PDDVVVPVPTQPVDP VAVQ TAPMAPPDDE ESEVVA PP SPPPPP PPPPPPPPEEAMPPKPP
    27   75 L G  T 3  S+     0   0   29  893   20  GGG GGGGGGGGGGGGGGG GGGG GGGGGGGGGG GGGGGG GG GGGGGG GGGGGGGGGGGGGGGGG
    28   76 L F  E <   +T   36   0H  40  893    9  FFY WFFFFFFYYFFFFFY FWFF FYFFFFYFFF FFWFFW FF FFFFFY FFFFFFFFYYYFFFFFF
    29   77 L E  E     +T   35   0H  74  893   73  rrq HhmrrremAlTTrmq rRrA GrErRYTmmS SSErrQ TT TTTTTt rrrrrrrrIITTLTfqq
    30   78 L G  S >  S-     0   0   32  889    5  ggg GgggggggGgGGggg gGgG GgGgGGGggG GGGggG GG GGGGGg ggggggggGGGGGGtnn
    31   79 L K  T 3  S+     0   0  156  891   73  KKR EHHRRRHLRKENRHR RDRE PCDKPPRHHP PKLRRD KK VRRRRT KKKKKKKKKKDVENKSS
    32   80 L N  T 3  S-     0   0   33  892   62  RRN RNNSSSSNHRNRSNS STSN TSNHTENNNN NHTSST HH HNNNNT AAAAAAAANNTDYNRDD
    33   81 L c  S <  S+     0   0    1  892    3  CCC CCCCCCCCCCCCCCC CCCC CCCCCCCCCC CCCCCC CC CCCCCC CCCCCCCCCCCCCCCCC
    34   82 L E        +     0   0   87  891   44  EEF ELLEEEHLEEEEELV EQEE GEEEEESLLQ QETEEQ EE EEEEEV EEEEEEEESSTREEEII
    35   83 L L  E    S-T   29   0H  96  889   88  DDD NDDDDDDDIDITDDD DSDN SDHDSYADDT TTQDDS TT KTTTTD DDDDDDDDIITFITDDD
    36   84 L F  E     -T   28   0H 139  889   83  VVI DVVIIIIVAVDNIVV IDII AVEVAvPVVN NPNIID PP aNNNNV IIIIIIIINNDNDDVVV
    37   85 L T        -     0   0   44  677   75  ... I.......P.II... .V.. ..V..eV..I IVV..V VV pIIII. ........III..T...
    38   86 L R        +     0   0   57  408   92  ... ............... .... .....f.... ...... .. t..... .................
    39   87 L K        +     0   0   96  535   81  ..N .DD...ND.....DN .D.. .D...D.DD. .....D .. L..... NNNNNNNN......NDD
    40   88 L L        -     0   0   91  608   90  ..E .EE...EE.....EE .E.. .E...L.EE. .....E .. C..... EEEEEEEE......EEE
    41   89 L d  S  > S+     0   0   15  617   29  ..C .CC...CC.....CC .C.. .C...P.CC. .....C .. V..... CCCCCCCC......CCC
    42   90 L S  T  4 S+     0   0   98  624   84  ..V .AQ...LK.....QA .S.. .A...R.QQ. .....S .. V..... IIIIIIII......RAA
    43   91 L L  T >4 S-     0   0  120  627   87  ..T .ED...IA.....DT .A.. .S...H.DD. .....A .. D..... EEEEEEEE......YVV
    44   92 L D  G >4 S-     0   0  107  638   73  ..D .GN...NS.....NG .R.. .S...V.NN. .....R .. S..... TTTTTTTT......YQQ
    45   93 L N  G >< S-     0   0    8  700   56  ..S .NN...NS.....NF .R.. QR..QS.NN. .....R .. D..... PPPPPPPP...LV.QRR
    46   94 L G  G <  S-     0   0    0  882   52  NNQ DGGNNNGRSNDDNGH NGND SGNNSMRGGN NDDNNG DD KNNNND WWWWWWWWDDNDKDGGG
    47   95 L D  G <  S+     0   0   44  887   62  EEL EGGEEEGPPEDEEGR EGED PSEELNRGGE EADEEG AA GDDDDE VVVVVVVVDDDDEDLLL
    48   96 L e    <   -     0   0    0  892    0  CCC CCCCCCCCCCCCCCC CCCC CCCCCCCCCC CCCCCC CC CCCCCC CCCCCCCCCCCCCCCCC
    49   97 L D  S    S-     0   0   59  892   74  EEG EQQSSSAELEVLSQG SPSI EEAEDDEQQA AVKSSP VV SNNNNI SSSSSSSSQQDADSARR
    50   98 L Q  S    S+     0   0    2  892   63  aah dQQsssQQmasssQp sQsc dHhtnhhQQs sspssQ ss Qppppq QQQQQQQQnnpsspHnn
    51   99 L F  E     -U   62   0I   4  892   80  rrv gSIpppLItrtspIm pRpt qHqrqftIIt ttippR vv Faaaai LLLLLLLLtttttsNqq
    52  100 L d  E     +U   61   0I  10  893    1  CCC CCCCCCCCCCCCCCC CCCC CCCCCSCCCC CCCCCC CC CCCCCC CCCCCCCCCCCCCCCCC
    53  101 L H  E     -U   60   0I  68  893   87  SSV SVVSSSKVESIISIV SVSI QTESQFHVVI ILISSV LL KVVVVK DDDDDDDDTTTVSKEVV
    54  102 L E  E     -U   59   0I  92  893   68  QQN QNNQQQNNDQDDQNN QNQD ANDQDNENND DSDQQN SS PDDDDN NNNNNNNNDDDDDDNNN
    55  103 L E  S    S-     0   0  100  893   82  eel nmteeeRtleedeaL eTee elreESRaag ddgeeT dd geeeeT IIIIIIIIllsgngttt
    56  104 L Q  S    S-     0   0  175  693   73  nn. n..nnnK.hn..n.P nAn. ...nRE...a aq.nnA qq .nnnnE EEEEEEEEnn..pn...
    57  105 L N  S    S+     0   0  154  838   66  ggg pgggggGg.gnnggG gGgn ggggG.gggG GgnggG rr t....G GGGGGGGGDDnnN.ggg
    58  106 L S  S    S-     0   0   58  853   65  SSS sSSSSSSSSSASSSS SSSG SSSSS.rSS. .GWSSS GG SSSSSG SSSSSSSS..SKHSSSS
    59  107 L V  E     -U   54   0I   7  890   79  YYY FYYYYYRFYYFYYYY YYYF AFYYACYYYY YFFYYY FF FFFFFY YYYYYYYYFFFYYFYFF
    60  108 L V  E     -U   53   0I  45  891   88  QQM HEEQQQRIVQVKQER QWQV VQLQVTAEER TSRQQW SS VLLLLL YYYYYYYYKKTSDTRLL
    61  109 L e  E     +U   52   0I   5  893    1  CCC CCCCCCCCCCCCCCC CCCC CCCCCFCCCC CCCCCC CC CCCCCC CCCCCCCCCCCCCCCCC
    62  110 L S  E     -U   51   0I  24  893   75  YYE SHQYYYQRIYLHYQE YQYL VSHYVQEQQN NVEYYQ AA SIIIIS KKKKKKKKNNAKATSEE
    63  111 L f        -     0   0   23  893    0  CCC CCCCCCCCCCCCCCC CCCC CCCCCCCCCC CCCCCC CC CCCCCC CCCCCCCCCCCCCCCCC
    64  112 L A    >   -     0   0    8  893   75  RRQ KRHRRRFHPRLRRHR RWRL PELRQAAHHL LAARRW AA ALLLLP GGGGGGGGTTAPLMANN
    65  113 L R  T 3  S+     0   0  149  893   80  KKN TESRRRAQAQPRRSS RERP AAHQAERSSL LFPRRE FF QPPPPR SSSSSSSSAAAPPAAEE
    66  114 L G  T 3  S+     0   0   24  893    8  GGG GGGGGGGGGGSGGGG GGGS GGGGGGGGGP PGGGGG GG GGGGGG GGGGGGGGGGGGMGGGG
    67  115 L Y  E <   -V   78   0J  20  893   11  YYY YFFYYYYYYYYFYFY YHYY YYWYYYYFFY YFFYYH FF WFFFFY YYYYYYYYYYYYWFFYY
    68  116 L T  E     -V   77   0J  72  891   85  QQE QFFQQQVKTQGIQFT QSQG TRTQTEGFFT THAQQS HH KRRRRI LLLLLLLLSSTNETQEE
    69  117 L L  E     -V   76   0J  67  888   64  LLF MLLLLLLPGLGGLLF LLLG GLGLGLGLLG GGGLLL GG IGGGGL RRRRRRRRGGGGGGLLL
    70  118 L A    >   -     0   0   23  889   78  AAA LSSSSSATRASPSSA SSSS TDPAAAPSSA ATPSSS TT STTTTQ EEEEEEEEKKDTIPSTT
    71  119 L D  T 3  S+     0   0  175  889   77  EED LDDdddHeHELNdDD dAdL TEHESgNDDT TFDddA FF SKKKKE PPPPPPPPNNTLNRYQQ
    72  120 L N  T 3  S-     0   0   92  694   44  DDD NNNdddDn.D..dND dDd. .D.D.r.NN. ...ddD .. .....D DDDDDDDD...CC.DDD
    73  121 L G  S <  S+     0   0   16  713   66  GGK KQQGGGEG.G..GQQ GGG. .R.G.G.QQ. ...GGG .. .....G GGGGGGGG...QE.GGG
    74  122 L K  S    S+     0   0   71  687   76  HHH KHHVVVKQ.H..VHH VTV. .R.H.T.HH. ...VVT .. .....K VVVVVVVV...NT.VRR
    75  123 L A        -     0   0   22  685   66  TTT NTTTTTSA.T..TTT TLT. .G.T.K.TT. ...TTL .. .....S TTTTTTTT...DE.NLL
    76  124 L f  E     -V   69   0J  12  847    9  CCC CCCCCCCCCCCCCCC CCCC CCCCCCCCCC CCCCCC CC SCCCCC CCCCCCCCCCCLKCCCC
    77  125 L I  E     -V   68   0J  78  846   80  TTI RIIEEEIQETEEEII EVEE ETETELQIIE EEREEV EE DEEEER RRRRRRRRSSEDITEAA
    78  126 L P  E     -V   67   0J  62  850   71  DDl DqHDDDADADKTDHl DPDK TpEDTAfHHA DVIDDP VV rEEEED qqqqqqqqTTTLPSdDD
    79  127 L T  S    S+     0   0  103  652   80  ..s .pR.....E..D.Ra .K.. DeR.N..RR. .NN..K NN kDDDD. ssssssssDDDCCEd..
    80  128 L G  S    S-     0   0   32  788   69  IIp VesIII.IVIDVIsp IGID VeLIV..ssV VVIIIG VV VIIII. ggggggggIIIEDIeII
    81  129 L P  S    S+     0   0  116  601   75  ..s .gg.......T..gp ...T .v....pggL L..... .. .....L pppppppp...DP.a..
    82  130 L Y  S    S+     0   0   59  794   86  DDN NMMDDD.D.DENDMN D.DE DDTDD.EMMA ADDDD. DD .NNNND YYYYYYYYDDNYNNRNN
    83  131 L P    >   -     0   0   17  799   62  EEP ENNEEEAEDEGEENP E.EG EPTEE.PNNP PDEEE. DD .EEEEE         DDDNPEPEE
    84  132 L g  T 3  S+     0   0   16  800    5  CCC CCCCCCSCCCCCCCC C.CC CDCCCSPCCC CCCCC. CC CCCCCC         CCCCCCCCC
    85  133 L G  T 3  S+     0   0    0  712   37    E    AAAEAGAD A E AGAD GGAASGG  A AE AAG     EEEES         AADG  GAA
    86  134 L K    <   -     0   0   69  588   68            STRQH   N  P R SQDQS P         P     SSSS          KK N  Q  
    87  135 L Q        -     0   0   37  477   65            VL         P    LF   V         P                            
    88  136 L T        +     0   0    4  428   78            DT         R    PP   V         R                            
    89  137 L L        +     0   0  105  372   61            I          V    F    V         V                            
    90  138 L E              0   0  104  274   69                       A    E    D         A                            
    91  139 L R              0   0  231  199   47                            R                                           
    92      ! !              0   0    0   0     0  
    93   16 C I              0   0    0  587    2     I               I    I          V      I  I      L                 
    94   17 C V  B     -A  271   0A   7  590    9     V               V    V          G      V  I      L                 
    95   18 C G  S    S+     0   0   25  591    6     G               G    E          G      G  G      G                 
    96   19 C G  S    S-     0   0   26  592    0     G               G    G          L      G  G      G                 
    97   20 C Q  E     -B  237   0B  98  593   95     Q               S    W          S      R  S      R                 
    98   21 C E  E     -B  236   0B  80  594   67     E               P    D          S      N  M      E                 
    99   22 C h        -     0   0    8  594   58     A               A    A          A      A  A      S                 
   100   23 C K    >   -     0   0  123  593   78     P               P    E          E      E  Q      R                 
   101   24 C D  T 3  S+     0   0   60  594   85     R               E    T          T      P  P      R                 
   102   25 C G  T 3  S+     0   0    0  595   74     N               R    G          G      G  G      A                 
   103   26 C E  S <  S+     0   0   36  595   66     R               R    V          D      L  Q      E                 
   104   27 C h    >   +     0   0    4  595   92     W               W    A          W      F  W      F                 
   105   28 C P  T 3   +     0   0    0  599    9     P               P    P          P      P  P      P                 
   106   29 C W  T 3  S+     0   0    5  600   26     W               W    W          W      W  W      W                 
   107   30 C Q  E <   -J  122   0C   7  601   26     Q               Q    Q          Q      q  Q      L                 
   108   31 C A  E     -JK 121 146C   1  593   49     V               V    V          A      e  L      V                 
   109   32 C L  E     -JK 120 145C   3  598   68     S               S    M          S      D  T      S                 
   110   33 C L  E     -JK 119 144C   0  601    9     L               L    L          L      L  L      L                 
   111   34 C I  E     -JK 117 143C   0  601   81     R               R    F          Q      S  H      Q                 
   112   35 C N  E >   - K   0 142C  30  601   88     v               I    R          Y      r  F      S                 
   113   36 C E  T 3  S+     0   0   63  117   78     r               .    K          .      p  .      .                 
   114   37 C E  T 3  S-     0   0  136  242   77     Q               G    T          N      E  M      D                 
   115   38 C N  S <  S+     0   0   84  565   53     F               Y    P          N      D  G      G                 
   116   39 C E        -     0   0  100  589   94     W               S    Q          I      R  S      D                 
   117   40 C G  E     +J  111   0C  14  600   57     K               H    E          H      W  H      H                 
   118   41 C F  E     +     0   0C  28  611   33     h               F    l          R      F  V      I                 
   119   42 C i  E     -J  110   0C   0  612    1     c               C    c          C      G  C      C                 
   120   43 C G  E     -J  109   0C   1  612    1     G               G    G          G      S  G      G                 
   121   44 C G  E     -J  108   0C   0  612    9     G               G    A          A      G  G      G                 
   122   45 C T  E     -JL 107 130C   0  612   45     S               S    S          T      A  I      T                 
   123   46 C I  E     + L   0 129C   0  612   23     L               L    L          L      L  L      I                 
   124   47 C L        -     0   0    6  612   27     I               I    I          I      L  I      I                 
   125   48 C S  S    S-     0   0   22  612   56     H               T    S          S      S  S      S                 
   126   49 C E  S    S+     0   0   99  612   63     P               S    D          N      Q  P      D                 
   127   50 C F  S    S+     0   0   42  612   83     Q               R    R          T      S  D      R                 
   128   51 C Y  E     - M   0 185C   7  612   34     W               W    W          W      W  F      H                 
   129   52 C I  E     -LM 123 184C   0  612   14     V               V    A          L      V  V      I                 
   130   53 C L  E     +LM 122 183C   0  612   27     L               L    L          V      L  L      L                 
   131   54 C T  E     - M   0 182C   0  612   43     T               S    T          S      T  T      T                 
   132   55 C A    >>  -     0   0    0  613    2     A               A    A          A      A  A      A                 
   133   56 C A  G >4 S+     0   0    0  613    9     A               A    A          A      A  A      A                 
   134   57 C H  G >4 S+     0   0    7  613    0     H               H    H          H      H  H      H                 
   135   58 C i  G X4 S+     0   0    0  613    1     C               C    C          C      V  C      C                 
   136   59 C L  G << S+     0   0   31  613   66     L               I    V          F      L  F      F                 
   137   60 C Y  G <  S+     0   0  109  613   87     G               L    L          R      R  P      D                 
   138   61 C Q  S <  S+     0   0   95  613   78     p               R    y          d      s  K      e                 
   139   61AC A        -     0   0   16  373   75     l               Y    e          t      p  .      p                 
   140   62 C K  S    S-     0   0  172  387   77     A               A    N          A      E  .      L                 
   141   63 C R  S    S-     0   0  162  602   78     D               D    D          T      H  .      G                 
   142   64 C F  E     -K  112   0C  36  609   54     L               Y    L          F      V  .      F                 
   143   65 C K  E     -K  111   0C  67  609   79     R               M    L          G      K  .      M                 
   144   66 C V  E     -KN 110 161C   0  609   16     V               V    L          A      V  .      V                 
   145   67 C R  E     -KN 109 160C  40  609   55     Q               Q    R          L      F  .      V                 
   146   68 C V  E     +KN 108 159C   1  610   43     L               L    I          L      L  .      T                 
   147   69 C G  S    S+     0   0    9  610   15     R               G    G          K      G  .      G                 
   148   70 C D        +     0   0   11  611   58     E               D    K          P      L  .      A                 
   149   71 C R  S    S+     0   0   24  611   73     Q               R    H          P      H  .      N                 
   150   72 C N  B >   -P  234   0D  18  611   65     H               M    S          S      D  S      D                 
   151   73 C T  T 3  S+     0   0   56  611   80     L               L    R          L      A  F      L                 
   152   74 C E  T 3  S-     0   0  119  611   84     Y               D    S          K      G  N      R                 
   153   75 C Q  S <  S-     0   0  130  610   85     Y               G    R          R      D  K      P                 
   154   76 C E        +     0   0  165  610   85     K               s    Y          S      k  c      L                 
   155   77 C E        -     0   0   93  469   27     .               e    E          .      s  h      D                 
   156   78 C G  S    S+     0   0   46  578   34     .               Q    R          .      A  S      S                 
   157   79 C G  S    S+     0   0   47  585   75     .               A    n          .      T  T      E                 
   158   80 C E        -     0   0   37  472   30     D               .    e          .      .  .      A                 
   159   81 C A  E     -N  146   0C  27  487   57     R               L    K          .      .  .      L                 
   160   82 C V  E     -N  145   0C  71  590   83     L               M    I          .      N  .      S                 
   161   83 C H  E     -N  144   0C  14  599   76     L               V    S          .      R  .      Y                 
   162   84 C E        -     0   0   90  602   78     R               P    M          .      S  .      R                 
   163   85 C V  E     -O  186   0C  27  607   64     V               V    L          V      V  .      V                 
   164   86 C E  E    S+     0   0C  70  608   73     S               Q    E          K      D  .      H                 
   165   87 C V  E     -O  185   0C  13  609   72     R               K    K          K      R  .      S                 
   166   88 C V  E     -O  184   0C  72  610   46     L               I    I          I      I  .      A                 
   167   89 C I  E     +O  183   0C  27  610   43     L               I    F          I      I  .      Q                 
   168   90 C K  E     -O  182   0C  68  610   82     V               I    I          I      L  .      I                 
   169   91 C H    >   -     0   0   19  611   13     H               H    H          H      H  E      H                 
   170   92 C N  T 3  S+     0   0  156  611   61     P               K    P          E      P  P      R                 
   171   93 C R  T 3  S+     0   0  150  608   73     Q               D    R          N      N  P      T                 
   172   94 C F    <   -     0   0   24  611    5     F               F    Y          Y      F  L      Y                 
   173   95 C T     >  -     0   0   56  611   68     Y               E    n          L      Q  S      D                 
   174   96 C K  T  4 S+     0   0  145  561   78     .               A    r          Y      P  .      Q                 
   175   97 C E  T  4 S+     0   0  174  569   91     .               A    E          P      D  .      T                 
   176   98 C T  T  4 S-     0   0   44  598   57     .               S    N          E      S  A      A                 
   177   99 C Y    ><  +     0   0   60  604   65     M               L    L          H      Y  F      Y                 
   178  100 C D  T 3   +     0   0   25  609   37     a               T    D          D      D  Q      i                 
   179  101 C F  T 3  S+     0   0   21  595   66     a               H    R          Y      N  N      w                 
   180  102 C D    <   +     0   0    1  609    0     D               D    D          D      D  Q      D                 
   181  103 C I        +     0   0    0  611   13     I               L    I          I      I  I      I                 
   182  104 C A  E     -MO 131 168C   0  611   60     A               A    A          A      A  Q      A                 
   183  105 C V  E     -MO 130 167C   0  612   16     L               L    L          L      L  M      I                 
   184  106 C L  E     -MO 129 166C   0  613   30     L               L    L          V      V  K      L                 
   185  107 C R  E     -MO 128 165C  40  613   43     E               R    K          Q      R  R      E                 
   186  108 C L  E     - O   0 163C   0  613   16     L               L    L          L      L  Q      V                 
   187  109 C K  S    S+     0   0  101  613   69     E               A    K          S      S  R      E                 
   188  110 C T  S    S-     0   0   82  614   74     E               Y    R          K      Q  C      R                 
   189  111 C P        -     0   0   48  614   39     P               S    P          R      E  a      R                 
   190  112 C I        -     0   0    4  562   63     V               V    V          V      V  p      F                 
   191  113 C T        -     0   0   95  566   73     K               N    P          E      E  M      Q                 
   192  114 C F        +     0   0   56  612   34     V               F    F          F      L  L      F                 
   193  115 C R  B >   -Q  196   0E  52  613   63     S               S    S          T      D  s      S                 
   194  116 C M  T 3  S+     0   0   29  594   77     S               S    D          S      E  n      Q                 
   195  117 C N  T 3  S+     0   0   13  602   90     H               Y    Y          S      L  N      F                 
   196  118 C V  B <   +Q  193   0E   0  604   27     I               I    I          I      I  V      A                 
   197  119 C A        -     0   0    1  606   80     R               Q    H          H      Q  Q      S                 
   198  120 C P        -     0   0    8  608   54     T               P    P          H      P  P      S                 
   199  121 C A        -     0   0    2  609   39     V               V    V          V      V  A      A                 
   200  122 C g  B     -c  290   0B   1  610   66     T               C    C          C      C  C      C                 
   201  123 C L        -     0   0   27  612    5     L               L    L          L      L  L      L                 
   202  124 C P        -     0   0    7  613   30     P               P    P          P      P  P      P                 
   203  124AC E     >  -     0   0   92  612   75     P               G    D          E      R  N      G                 
   204  125 C R  H  > S+     0   0  109  612   78     A               K    K          P      L  F      D                 
   205  126 C D  H  > S+     0   0  124  612   85     S               S    Q          S      Q  D      N                 
   206  127 C W  H  >>S+     0   0    4  612   88     E               L    T          Q      H  Q      I                 
   207  128 C A  I  X>S+     0   0    0  612   75     T               T    V          T      R  S      W                 
   208  129 C E  I  <5S+     0   0   75  613   82     F               V    V          F      T  F      F                 
   209  130 C S  I  <5S+     0   0   70  614   66     P               K    S          p      P  P      R                 
   210  131 C T  I  <5S+     0   0   18  108   73     .               .    L          n      .  .      .                 
   211  131AC L  I ><  S-     0   0  119  503   80     .               n    .          t      s  .      .                 
   227  146 C E  T 3  S+     0   0   47  527   75     .               G    .          N      D  .      E                 
   228  147 C K  T 3  S+     0   0  169  548   68     H               S    .          D      L  .      N                 
   229  149 C G  S <  S-     0   0   29  559   66     L               S    .          G      G  S      G                 
   230  150 C R        -     0   0  213  584   86     P               Q    .          P      M  D      L                 
   231  151 C Q  B     -R  224   0F  79  599   93     P               M    Q          A      T  T      D                 
   232  152 C S        -     0   0   14  607   51     P               A    P          P      S  S      P                 
   233  153 C T  S    S+     0   0   48  608   73     Y               V    S          N      D  R      Y                 
   234  154 C R  B    S-P  150   0D 102  608   85     P               E    V          A      L  S      L                 
   235  155 C L        -     0   0    3  610    3     L               L    L          L      L  L      Q                 
   236  156 C K  E     -BD  98 221B  31  610   51     R               Q    Q          Q      Q  M      Y                 
   237  157 C M  E     -BD  97 220B  18  611   94     E               E    L          E      Y  E      N                 
   238  158 C L  E     - D   0 219B   4  612   44     V               S    V          A      V  V      I                 
   239  159 C E  E     - D   0 218B 107  612   72     E               Q    N          T      K  T      E                 
   240  160 C V  E     - D   0 217B   0  612   46     V               L    L          V      L  V      T                 
   241  161 C P  E     - D   0 216B  34  612   28     P               R    P          K      P  D      P                 
   242  162 C Y  E     -F  263   0B  36  613   46     I               I    I          L      V  I      I                 
   243  163 C V  E     -F  262   0B  24  614   37     V               I    V          I      V  I      L                 
   244  164 C D     >  -     0   0   88  613   57     E               H    D          D      S  G      T                 
   245  165 C R  H  > S+     0   0   51  613   78     N               F    R          S      Q  D      H                 
   246  166 C N  H  > S+     0   0  105  614   74     H               N    P          E      D  S      N                 
   247  167 C S  H  > S+     0   0   48  614   78     L               Q    T          T      E  V      I                 
   248  168 C j  H  X S+     0   0    1  614    2     C               C    C          C      C  C      C                 
   249  169 C K  H >< S+     0   0   88  614   73     d               n    r          n      q  n      n                 
   250  170 C L  H 3< S+     0   0  150  574   89     g               s    .          e      r  s      g                 
   251  171 C S  H 3< S+     0   0   23  604   76     D               T    s          V      S  V      G                 
   252  172 C S    <<  -     0   0   20  607   83     S               S    T          Y      V  Y      Y                 
   253  173 C S  S    S+     0   0   79  607   83     F               T    R          D      R  N      E                 
   254  174 C F  S    S-     0   0  124  607   79     R               N    I          G      Y  N      G                 
   255  175 C I        -     0   0  100  608   87     I               L    R          D      N  A      S                 
   256  176 C I        -     0   0   13  609   18     V               V    I          I      I  I      I                 
   257  177 C T    >   -     0   0   16  614   35     Q               K    T          T      T  T      S                 
   258  178 C Q  T 3  S+     0   0  133  614   68     D               M    D          P      D  K      E                 
   259  179 C N  T 3  S+     0   0   24  614   60     S               G    N          R      N  N      R                 
   260  180 C M  E <   - G   0 311B   2  614   13     M               S    M          M      M  M      M                 
   261  181 C F  E     - G   0 310B   8  613   35     L               I    F          L      F  L      I                 
   262  182 C j  E     +FG 243 309B   1  614    1     C               C    C          C      C  C      C                 
   263  183 C A  E     +FG 242 308B   0  614   26     A               G    A          A      A  A      A                 
   264  184 C G  S    S-     0   0    3  614   10     G               Y    g          G      G  G      G                 
   265  185 C Y        -     0   0   56  591   57     N               S    f          Y      Y  H      Y                 
   266  185AC D  S    S-     0   0   81  594   83     E               A    Q          L      F  L      P                 
   267  185BC T  S    S+     0   0   76  614   61     E               Q    t          E      E  G      S                 
   268  186 C K  S    S-     0   0  107  563   32     .               .    g          G      G  G      T                 
   269  187 C Q  S    S+     0   0  102  569   37     .               G    r          G      G  G      G                 
   270  188 C E        +     0   0   33  613   55     R               K    G          V      Q  K      G                 
   271  189 C D  B     -A   94   0A   7  614    4     D               D    D          D      D  D      T                 
   272  190 C A        -     0   0    7  614   42     S               A    A          A      T  S      V                 
   273  191 C k    >   -     0   0    7  614    3     C               C    C          C      C  C      C                 
   274  192 C Q  T 3  S+     0   0   90  614   25     Q               Q    E          Q      L  Q      V                 
   275  193 C G  T 3  S+     0   0    6  614    8     G               G    G          G      G  G      G                 
   276  194 C D    X   +     0   0    0  614    0     D               D    D          D      D  D      D                 
   277  195 C S  T 3  S+     0   0   14  614    1     S               S    S          S      S  S      S                 
   278  196 C G  T 3  S+     0   0    0  614    0     G               G    G          G      G  G      G                 
   279  197 C G    <   -     0   0    0  614    1     G               G    G          G      G  G      G                 
   280  198 C P  E     - H   0 294B   1  614    2     P               P    P          P      A  P      P                 
   281  199 C H  E     -EH 219 293B   0  614   49     L               L    F          L      F  L      L                 
   282  200 C V  E     -EH 218 291B   3  614   26     V               V    V          V      V  V      L                 
   283  201 C T  E     - H   0 290B   0  614   66     C               C    M          T      M  C      C                 
   284  202 C R  E     + H   0 289B  99  614   70     K               E    K          P      E  Q      E                 
   285  203 C F  E >  S- H   0 288B  22  614   71     V               Y    n          d      d  E      a                 
   286  204 C K  T 3  S-     0   0   85  222   71     N               N    n          r      s  G      d                 
   287  205 C D  T 3  S+     0   0  108  223   55     D               E    N          L      R  D      N                 
   288  206 C T  E <   - H   0 285B   3  233   75     T               T    R          M      R  R      K                 
   289  207 C Y  E     - H   0 284B  21  242   51     W               W    W          W      W  W      W                 
   290  208 C F  E     -cH 200 283B   0  613   91     L               I    Y          Y      V  Y      Y                 
   291  209 C V  E     + H   0 282B   1  613   38     Q               Q    Q          L      V  V      L                 
   292  210 C T  E     +     0   0B   1  613   84     A               V    M          V      F  V      A                 
   293  211 C G  E     -IH 312 281B   0  613    0     G               G    G          G      G  G      G                 
   294  212 C I  E     -IH 311 280B   0  613   19     V               V    I          I      L  I      V                 
   295  213 C V  E     +I  310   0B   7  613   14     V               V    V          V      V  T      V                 
   296  214 C S  E     -     0   0B   1  612    0     S               S    S          S      S  S      S                 
   297  215 C W  E     -I  309   0B  45  613    7     W               W    W          W      W  W      W                 
   298  216 C G        -     0   0   26  613    0     G               G    G          G      g  G      S                 
   299  217 C E  S    S-     0   0   25  609   90     E               I    E          D      g  Y      I                 
   300  218 C G  S    S-     0   0   19  612   13     G               G    G          E      D  G      G                 
   301  220 C k  S    S-     0   0    7  613    2     C               C    C          C      C  C      C                 
   302  221 C A  S    S+     0   0    4  612   16     A               G    D          G      G  G      A                 
   303  222 C R    >   -     0   0  105  611   73     L               R    R          K      S  R      E                 
   304  223 C K  T 3  S+     0   0  152  611   64     P               Q    D          P      Q  E      R                 
   305  223AC G  T 3  S+     0   0   26  613   58     N               G    G          N      G  N      K                 
   306  224 C K    <   -     0   0   43  613   85     R               Y    K          K      V  K      K                 
   307  225 C Y        -     0   0   33  613   50     P               P    Y          P      Y  P      P                 
   308  226 C G  E     -G  263   0B   4  611    2     G               G    G          G      G  G      D                 
   309  227 C I  E     -GI 262 297B   6  612   11     I               V    F          V      V  V      V                 
   310  228 C Y  E     -GI 261 295B   1  612    1     Y               Y    Y          Y      Y  Y      F                 
   311  229 C T  E     -GI 260 294B   2  612   39     T               T    T          T      T  T      T                 
   312  230 C K  E >   - I   0 293B  21  612   42     H               E    H          R      R  R      N                 
   313  231 C V  G >  S+     0   0    1  611    8     V               V    V          V      V  V      V                 
   314  232 C T  G 3  S+     0   0    2  609   71     T               G    F          T      V  S      Q                 
   315  233 C A  G <  S+     0   0   29  609   79     Y               Y    R          Y      R  S      Y                 
   316  234 C F  S <> S+     0   0    7  605   35     Y               H    L          F      Y  V      F                 
   317  235 C L  H  > S+     0   0   23  603   80     L               R    K          R      V  L      M                 
   318  236 C K  H  > S+     0   0  116  602   68     D               D    K          D      E  S      N                 
   319  237 C W  H  > S+     0   0   26  602    1     W               W    W          W      W  W      W                 
   320  238 C I  H  X S+     0   0    1  599   12     I               I    I          I      I  I      I                 
   321  239 C D  H  < S+     0   0   66  570   71     H                    Q                           N                 
   322  240 C R  H >< S+     0   0  136  556   71     Q                    K                           Q                 
   323  241 C S  H >< S+     0   0    6  523   72     Y                    V                                             
   324  242 C M  T 3< S+     0   0   25  479   41     V                    I                                             
   325  243 C K  T <  S+     0   0  153  444   70     P                    E                                             
   326  244 C T    <         0   0   51  390   65     K                                                                  
   327  245 C R              0   0  197  273   47     K                                                                  
## ALIGNMENTS 1401 - 1470
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1   49 L Q              0   0  101  671   35   EEEEEEDEE  EE E  EENEE EEEEEE   EE  EEE EE   EEEE EE E      E  EEEEEE
     2   50 L a    >   +     0   0   22  858    0  CCCCCCCCCC CCCCCC CCCCC CCCCCCCCCCCCCCCCCCC  CCCCCCCCCCCC   CCCCCCCCCC
     3   51 L E  T 3  S+     0   0  187  858   80  GEQVQQDNLS LEEEAR VARWA SKQQQQAPLWAEEVEKEAW  QVQEAVQTDQAA   KLDDISEEES
     4   52 L T  T 3  S-     0   0  105  864   61  NKTKRREPQT SRSRTT SSGTS TTRRRRSSSTSNNKRTTTS  SKTKSSDSSRSP   PVSSSSINNS
     5   53 L S    <   +     0   0   89  868   72  HQESYYGNGN HENSTDNNQSSN SSYYYYSNSSHNNNQENGS  TSEQSSNNNYTT   NHKKDNDDDG
     6   54 L P        +     0   0   10  878   31  SPAPPPIPLP PDPPKTPPPTPPPPPPPPPPAPPPPPPPEPLP  SPAPPPNPPPTT   PNPPPPSYYP
     7   55 L b        -     0   0   18  893   21  CCSCGGGCCC CNCCDCCCCCGCCCCGGGGCSCGCCCCCTCACCCCCSCCCGCCGCC  CCGCCCCYYYC
     8   56 L Q  S    S+     0   0   92  892   83  FGNLRRNQDQ AAVQSYEQFGRLNGKRRRREEQRQLLRGNLMQRRSLNGRQGKQRAA  SENLLQQNNNL
     9   57 L N  S    S-     0   0   63  893   51  NNCNLLCNQN NGNHENNNNQLNNNNLLLLNCNLNHHNNCHCNNNKNCNNNCNNLNN  LNCNNNHGGGN
    10   58 L Q  S    S-     0   0  152  893   57  LGAGCCIGNG GCGGCQKGGDCGNNGCCCCGSQCGGGGGAGAGRGQGAGAQQRGCGG  EGDKKNGGGGG
    11   59 L G        -     0   0   16  893   40  VTHAggQGCM SvGGeGGGGSqGGGGggggAHGqGGGATHGHGGGGAHTGGQGGgGG  SGNGGGGcccG
    12   60 L K  E     -S   23   0G 117  852   79  ..GTkkIT.. TdTSeTVQS.tQNVTkkkkTETtTTTT.GTSTSTETG.TVITTkII  RSDTTTSeeeS
    13   61 L a  E     -S   22   0G  45  882   10  .CCCCCCC.C CCCCCCCCC.CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCC
    14   62 L K  E     -S   21   0G 155  890   81  .KHQEENITI TVKtIqvRIKEKSKVEEEEVvhETkkQKRqLVVVTQHKVKVTnESS  HsLSSIDIIIV
    15   63 L X  E     +S   20   0G 120  768   39  .NNNNNNDNN ...lNiqD..NDDNDNNNNNtdNHnnNNNnND..ENNNDDNNvNVV  .dNKKDD...D
    16   64 L G        -     0   0   44  862   73  .TTTTTTGTT TNDPVSAQD.TGGTGTTTTSSPTGGGTTTGTG..TTTTGDATTTGG  .GTIIGGNNNR
    17   65 L L  S    S-     0   0  152  871   64  .VLLLLIVND VIMSYELVL.LVVVHLLLLADLLITTLVLTRV..ILLVAHMLLLTK  FALNNELIIIV
    18   66 L G  S    S+     0   0   67  883   63  GGGGGGGAGG aptGGESGp.GNgGKGGGGdGEGNMMGGGVGAQAGGGGNtGGDGRR  ANGggNApppG
    19   67 L E        -     0   0  119  837   61  ASSSSSSGSN qngGTA.TgSSKdSDSSSSg.VSS..SSS.SYPSNSSSGlSGNSSS  ..SeeSFnnnN
    20   68 L Y  E     -S   15   0G  37  883   11  YYYYYYYYYY FYYYYYYYYYYYGYYYYYYYPYYFYYYYYYFYGNYYYYFFYYYYLL  TFYYYYYYYYF
    21   69 L T  E     -S   14   0G  71  886   82  RNVHIITTTT SRVQRKRERSRTTQSLLLLRIRRSGGRNASKNRKTHVNTTEVTLSS  SWTQQNNRRRT
    22   70 L b  E     -S   13   0G  20  889    0  CCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC  PCCCCCCCCCC
    23   71 L T  E     -S   12   0G  85  890   86  ELVNSSDNNT TTTTRHNRQTSSTSESSSSIFTSRSSGLVSTTRESNVLTTQSSSSS  STHAATSTTTL
    24   72 L c        -     0   0   44  890    0  CCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCC
    25   73 L L    >   -     0   0   62  890   88  RYNESSKTTA LYRLRKLAKAAPFSLSSSSRPPAPDDKYNDNPPSYENYAKHRTSPP  DPRSSLTFFFA
    26   74 L E  T 3  S+     0   0  177  890   75  KPALVVTEAS ADESPWPLNESAPESVVVVEESSAQQPITQPEAASLAPLPSATVLL  SEEEEDDDDDE
    27   75 L G  T 3  S+     0   0   29  893   20  GGAGGGGGGG GGGQGGGGGGGGGGGGGGGGGGGGGGGGAGGGGGGGAGGGGGGGGG  GGGGGGGGGGP
    28   76 L F  E <   +T   36   0H  40  893    9  FFYFFFFFFY FFFFYYFFFYFYYWFFFFFFSYFFFFFFYFYFWWFFYFFFFYYFFF  FYFFFFYFFFF
    29   77 L E  E     +T   35   0H  74  893   73  fqeTrreNtT ThSTqVTIStlETSTrrrrEvKlGAATqeTeSRRYTeqATfTRrSS  pEkTTTTmmmE
    30   78 L G  S >  S-     0   0   32  889    5  tngGgggGgG GgGGgGGGGggGGGGggggGgGgGGGGngGgGGGGGgnG.qGGgGG  rGgGGGGgggG
    31   79 L K  T 3  S+     0   0  156  891   73  KSKRRRLTHR QHPRRKTRIKKITSKRRRRAKRKPEERGKEKSDIPRKSQCHPHREE  AEFKKTQHHHP
    32   80 L N  T 3  S-     0   0   33  892   62  RDQNSSTDLN KNNNQRNNNYHRSTDSSSSNTNRTNNNDQNQNTYRNQDDATNHSYY  SRSDDVNNNNR
    33   81 L c  S <  S+     0   0    1  892    3  CCCCCCCCCC CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC  CCCCCCCCCCC
    34   82 L E        +     0   0   87  891   44  EIYEEENSDE ELQEKETEQEEEQEEEEEERSEEEEEEIYEYEQQEEYISAIEEEEE  SEESSEELLLE
    35   83 L L  E    S-T   29   0H  96  889   88  DDRTDDDNDV TDTSPLIIEDDTLNEDDDDRGVDTIITDRIRESTYTRDLFHTDDVV  FVDDDTLDDDT
    36   84 L F  E     -T   28   0H 139  889   83  VViNIIINIY DVNEIANNEVVKCDNIIIIDCSVADDDIiDiNDDvNiVRGrDVIRR  fEDEENNVVVG
    37   85 L T        -     0   0   44  677   75  ..mI...I.. V.IIITIVK..TVL.....V.L.LIII.mImVVVeIm..f.I....  pTDI.II....
    38   86 L R        +     0   0   57  408   92  ..v....... ............................v.v...f.v..gn.....  y..........
    39   87 L K        +     0   0   96  535   81  NDN...N.N. .D..D....N..N..............DN.N.DDK.ND.TE.....  T......DDD.
    40   88 L L        -     0   0   91  608   90  EES...E.E. NE..P....E..S..............ES.S.EEL.SE.FT.....  N.E....EEE.
    41   89 L d  S  > S+     0   0   15  617   29  CCC...C.C. EC..C....C..T.......S......CC.C.CCP.CC.CC.....  C.C....CCCS
    42   90 L S  T  4 S+     0   0   98  624   84  RAE...D.L. CA..Q....A..D.......S......SE.E.SSQ.EA.EA.....  SLE....QQQH
    43   91 L L  T >4 S-     0   0  120  627   87  YVN...L.T. DE..N....F..N.......P......TS.A.ADY.NV.VV.....  VPT....DDDP
    44   92 L D  G >4 S-     0   0  107  638   73  YQN...N.D. VG..R....W..S.......D......QN.S.RGV.NQ.NN...DD  NIS....NNNV
    45   93 L N  G >< S-     0   0    8  700   56  QRN...N.NN PN..N....N..T.R.....N......RN.N.RSL.NR.VN...GG  NIN.I..NNNP
    46   94 L G  G <  S-     0   0    0  882   52  GGGDNNGDGG GGNTG.DDSHNNSDNNNNNDGDNSDDDGGDGDGHTDGG.DGNDNLL  GDGNNDDGGGD
    47   95 L D  G <  S