Complet list of 1fq1 hssp fileClick here to see the 3D structure Complete list of 1fq1.hssp file
HSSP       HOMOLOGY DERIVED SECONDARY STRUCTURE OF PROTEINS , VERSION 2.0 2011
PDBID      1FQ1
THRESHOLD  according to: t(L)=(290.15 * L ** -0.562) + 5
REFERENCE  Sander C., Schneider R. : Database of homology-derived protein structures. Proteins, 9:56-68 (1991).
CONTACT    Maintained at http://www.cmbi.ru.nl/ by Maarten L. Hekkelman 
DATE       file generated on 2014-04-29
HEADER     HYDROLASE/TRANSFERASE                   01-SEP-00   1FQ1
COMPND     MOL_ID: 1; MOLECULE: CYCLIN-DEPENDENT KINASE INHIBITOR 3; CHAIN: A; EC
SOURCE     MOL_ID: 1; ORGANISM_SCIENTIFIC: HOMO SAPIENS; ORGANISM_COMMON: HUMAN; 
AUTHOR     H.SONG,N.HANLON,N.R.BROWN,M.E.M.NOBLE,L.N.JOHNSON,D.BARFORD
DBREF      1FQ1 A    1   212  UNP    Q16667   CDKN3_HUMAN      1    212
DBREF      1FQ1 B    1   298  UNP    P24941   CDK2_HUMAN       1    298
SEQLENGTH   479
NCHAIN        2 chain(s) in 1FQ1 data set
NALIGN      249
NOTATION : ID: EMBL/SWISSPROT identifier of the aligned (homologous) protein
NOTATION : STRID: if the 3-D structure of the aligned protein is known, then STRID is the Protein Data Bank identifier as taken
NOTATION : from the database reference or DR-line of the EMBL/SWISSPROT entry
NOTATION : %IDE: percentage of residue identity of the alignment
NOTATION : %SIM (%WSIM):  (weighted) similarity of the alignment
NOTATION : IFIR/ILAS: first and last residue of the alignment in the test sequence
NOTATION : JFIR/JLAS: first and last residue of the alignment in the alignend protein
NOTATION : LALI: length of the alignment excluding insertions and deletions
NOTATION : NGAP: number of insertions and deletions in the alignment
NOTATION : LGAP: total length of all insertions and deletions
NOTATION : LSEQ2: length of the entire sequence of the aligned protein
NOTATION : ACCNUM: SwissProt accession number
NOTATION : PROTEIN: one-line description of aligned protein
NOTATION : SeqNo,PDBNo,AA,STRUCTURE,BP1,BP2,ACC: sequential and PDB residue numbers, amino acid (lower case = Cys), secondary
NOTATION : structure, bridge partners, solvent exposure as in DSSP (Kabsch and Sander, Biopolymers 22, 2577-2637(1983)
NOTATION : VAR: sequence variability on a scale of 0-100 as derived from the NALIGN alignments
NOTATION : pair of lower case characters (AvaK) in the alignend sequence bracket a point of insertion in this sequence
NOTATION : dots (....) in the alignend sequence indicate points of deletion in this sequence
NOTATION : SEQUENCE PROFILE: relative frequency of an amino acid type at each position. Asx and Glx are in their
NOTATION : acid/amide form in proportion to their database frequencies
NOTATION : NOCC: number of aligned sequences spanning this position (including the test sequence)
NOTATION : NDEL: number of sequences with a deletion in the test protein at this position
NOTATION : NINS: number of sequences with an insertion in the test protein at this position
NOTATION : ENTROPY: entropy measure of sequence variability at this position
NOTATION : RELENT: relative entropy, i.e.  entropy normalized to the range 0-100
NOTATION : WEIGHT: conservation weight

## PROTEINS : identifier and alignment statistics
  NR.    ID         STRID   %IDE %WSIM IFIR ILAS JFIR JLAS LALI NGAP LGAP LSEQ2 ACCNUM     PROTEIN
    1 : CDKN3_HUMAN         0.99  0.99    1  183   21  203  183    0    0  212  Q16667     Cyclin-dependent kinase inhibitor 3 OS=Homo sapiens GN=CDKN3 PE=1 SV=1
    2 : F7FIB2_MACMU        0.99  0.99   32  183   12  163  152    0    0  172  F7FIB2     Uncharacterized protein OS=Macaca mulatta GN=CDKN3 PE=4 SV=1
    3 : F8WD24_HUMAN        0.99  0.99   31  183    5  157  153    0    0  166  F8WD24     Cyclin-dependent kinase inhibitor 3 OS=Homo sapiens GN=CDKN3 PE=2 SV=1
    4 : G3V2J7_HUMAN        0.99  0.99    1  165   21  185  165    0    0  203  G3V2J7     Cyclin-dependent kinase inhibitor 3 OS=Homo sapiens GN=CDKN3 PE=2 SV=1
    5 : H7C0S3_HUMAN        0.99  0.99    1  183   21  202  183    1    1  211  H7C0S3     Cyclin-dependent kinase inhibitor 3 OS=Homo sapiens GN=CDKN3 PE=2 SV=1
    6 : H9F7P8_MACMU        0.99  0.99   41  183    1  143  143    0    0  152  H9F7P8     Cyclin-dependent kinase inhibitor 3 isoform 1 (Fragment) OS=Macaca mulatta GN=CDKN3 PE=2 SV=1
    7 : L8Y724_TUPCH        0.99  1.00  185  480    1  296  296    0    0  298  L8Y724     Cyclin-dependent kinase 2 OS=Tupaia chinensis GN=TREES_T100006937 PE=4 SV=1
    8 : Q9C043_HUMAN        0.99  0.99    1  145   21  165  145    0    0  166  Q9C043     Mutant cyclin-dependent kinase associated protein phosphatase OS=Homo sapiens PE=2 SV=1
    9 : CDK2_RAT            0.98  1.00  185  480    1  296  296    0    0  298  Q63699     Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1
   10 : F7FIB7_MACMU        0.98  0.99    1  183   21  203  183    0    0  212  F7FIB7     Cyclin-dependent kinase inhibitor 3 isoform 1 OS=Macaca mulatta GN=CDKN3 PE=2 SV=1
   11 : G1RQ90_NOMLE        0.98  0.99    1  183   21  203  183    0    0  212  G1RQ90     Uncharacterized protein OS=Nomascus leucogenys GN=CDKN3 PE=4 SV=1
   12 : G3TH75_LOXAF        0.98  0.99  185  480    1  296  296    0    0  298  G3TH75     Uncharacterized protein OS=Loxodonta africana GN=CDK2 PE=4 SV=1
   13 : G7MXX8_MACMU        0.98  0.99    1  183   18  200  183    0    0  209  G7MXX8     Putative uncharacterized protein (Fragment) OS=Macaca mulatta GN=EGK_18197 PE=4 SV=1
   14 : G7PAA5_MACFA        0.98  0.99    1  183   18  200  183    0    0  209  G7PAA5     Putative uncharacterized protein (Fragment) OS=Macaca fascicularis GN=EGM_16637 PE=4 SV=1
   15 : H2NLA0_PONAB        0.98  0.99    1  183   21  203  183    0    0  212  H2NLA0     Uncharacterized protein OS=Pongo abelii GN=CDKN3 PE=4 SV=1
   16 : H2Q8C0_PANTR        0.98  0.99    1  183   21  203  183    0    0  212  H2Q8C0     Cyclin-dependent kinase inhibitor 3 OS=Pan troglodytes GN=CDKN3 PE=2 SV=1
   17 : W5PLX3_SHEEP        0.98  0.99  185  480    1  296  296    0    0  298  W5PLX3     Uncharacterized protein OS=Ovis aries GN=CDK2 PE=4 SV=1
   18 : G2HF96_PANTR        0.97  0.99    1  183   21  203  183    0    0  212  G2HF96     Cyclin-dependent kinase inhibitor 3 OS=Pan troglodytes PE=2 SV=1
   19 : G3QSG9_GORGO        0.97  0.99    1  183   21  203  183    0    0  212  G3QSG9     Uncharacterized protein OS=Gorilla gorilla gorilla GN=101127699 PE=4 SV=1
   20 : Q9BPV5_HUMAN        0.97  0.97   29  183    3  157  155    0    0  166  Q9BPV5     Mutant cyclin-dependent kinase associated protein phosphatase OS=Homo sapiens PE=2 SV=1
   21 : F6X4M9_CALJA        0.94  0.97   32  183   12  163  152    0    0  172  F6X4M9     Uncharacterized protein OS=Callithrix jacchus GN=CDKN3 PE=4 SV=1
   22 : F6X5L7_CALJA        0.94  0.97    1  183   21  203  183    0    0  212  F6X5L7     Uncharacterized protein OS=Callithrix jacchus GN=CDKN3 PE=4 SV=1
   23 : Q9C045_HUMAN        0.93  0.95    1  183   21  198  183    1    5  207  Q9C045     Mutant cyclin-dependent kinase associated protein phosphatase OS=Homo sapiens PE=2 SV=1
   24 : Q9C048_HUMAN        0.93  0.95    2  183   16  197  182    0    0  206  Q9C048     Mutant cyclin-dependent kinase associated protein phosphatase OS=Homo sapiens PE=2 SV=1
   25 : E2RDA9_CANFA        0.92  0.97    1  183   21  203  183    0    0  212  E2RDA9     Uncharacterized protein OS=Canis familiaris GN=CDKN3 PE=4 SV=1
   26 : L5K451_PTEAL        0.92  0.97   14  182   31  199  169    0    0  209  L5K451     Cyclin-dependent kinase inhibitor 3 OS=Pteropus alecto GN=PAL_GLEAN10023290 PE=4 SV=1
   27 : M3WLX1_FELCA        0.92  0.97    1  183   18  200  183    0    0  209  M3WLX1     Uncharacterized protein (Fragment) OS=Felis catus GN=CDKN3 PE=4 SV=1
   28 : M3Y281_MUSPF        0.92  0.97    1  183   21  203  183    0    0  212  M3Y281     Uncharacterized protein OS=Mustela putorius furo GN=CDKN3 PE=4 SV=1
   29 : CDKN3_PIG           0.91  0.97    1  183   21  203  183    0    0  212  Q9MYN5     Cyclin-dependent kinase inhibitor 3 OS=Sus scrofa GN=CDKN3 PE=2 SV=1
   30 : F6VTZ2_HORSE        0.91  0.97    1  183   18  200  183    0    0  209  F6VTZ2     Uncharacterized protein (Fragment) OS=Equus caballus GN=CDKN3 PE=4 SV=1
   31 : G1M9X4_AILME        0.91  0.97    1  183   18  200  183    0    0  209  G1M9X4     Uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=CDKN3 PE=4 SV=1
   32 : G1SIX6_RABIT        0.91  0.97    1  183   21  203  183    0    0  212  G1SIX6     Uncharacterized protein OS=Oryctolagus cuniculus GN=CDKN3 PE=4 SV=1
   33 : G3TDY3_LOXAF        0.91  0.96    1  183   21  206  186    1    3  215  G3TDY3     Uncharacterized protein (Fragment) OS=Loxodonta africana GN=CDKN3 PE=4 SV=1
   34 : CDKN3_RAT           0.90  0.97    1  183   21  203  183    0    0  212  B2RZ50     Cyclin-dependent kinase inhibitor 3 OS=Rattus norvegicus GN=Cdkn3 PE=2 SV=1
   35 : D2HCL0_AILME        0.90  0.97    1  164   18  181  164    0    0  181  D2HCL0     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_008341 PE=4 SV=1
   36 : H0X109_OTOGA        0.90  0.96    1  183   18  200  183    0    0  209  H0X109     Uncharacterized protein (Fragment) OS=Otolemur garnettii GN=CDKN3 PE=4 SV=1
   37 : I3MH53_SPETR        0.90  0.96    1  183   21  202  183    1    1  211  I3MH53     Uncharacterized protein OS=Spermophilus tridecemlineatus GN=CDKN3 PE=4 SV=1
   38 : CDKN3_MOUSE         0.89  0.96    1  183   21  202  183    1    1  211  Q810P3     Cyclin-dependent kinase inhibitor 3 OS=Mus musculus GN=Cdkn3 PE=2 SV=1
   39 : F6XTU8_CALJA        0.89  0.93    1  183   20  196  183    1    6  205  F6XTU8     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=CDKN3 PE=4 SV=1
   40 : I3KST3_ORENI        0.89  0.96  185  480    1  296  296    0    0  298  I3KST3     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100706903 PE=4 SV=1
   41 : H2VDI9_TAKRU        0.88  0.95  185  480    1  296  296    0    0  298  H2VDI9     Uncharacterized protein OS=Takifugu rubripes GN=LOC101062041 PE=4 SV=1
   42 : S7N7Z7_MYOBR        0.88  0.95   31  183   12  164  153    0    0  173  S7N7Z7     Cyclin-dependent kinase inhibitor 3 OS=Myotis brandtii GN=D623_10007591 PE=4 SV=1
   43 : G5BF85_HETGA        0.87  0.94    1  183   17  199  183    0    0  208  G5BF85     Cyclin-dependent kinase inhibitor 3 (Fragment) OS=Heterocephalus glaber GN=GW7_16983 PE=4 SV=1
   44 : H0V2L8_CAVPO        0.87  0.95    1  183   16  198  183    0    0  207  H0V2L8     Uncharacterized protein (Fragment) OS=Cavia porcellus GN=CDKN3 PE=4 SV=1
   45 : F6UZN6_MONDO        0.84  0.93    1  183   21  203  183    0    0  212  F6UZN6     Uncharacterized protein OS=Monodelphis domestica GN=CDKN3 PE=4 SV=2
   46 : G3W4P3_SARHA        0.84  0.93    1  183   21  203  183    0    0  212  G3W4P3     Uncharacterized protein OS=Sarcophilus harrisii GN=CDKN3 PE=4 SV=1
   47 : L5LMN1_MYODS        0.84  0.94    2  183   30  211  182    0    0  220  L5LMN1     Cyclin-dependent kinase inhibitor 3 OS=Myotis davidii GN=MDA_GLEAN10023947 PE=4 SV=1
   48 : M3X5Z7_FELCA        0.84  0.89    1  183   21  188  183    1   15  197  M3X5Z7     Uncharacterized protein OS=Felis catus GN=LOC101084703 PE=4 SV=1
   49 : Q63700_RATRT        0.84  0.85  185  480    1  344  344    1   48  346  Q63700     Cyclin dependent kinase 2-beta OS=Rattus rattus PE=2 SV=1
   50 : F7ETE4_MONDO        0.81  0.92  185  470    1  286  286    0    0  305  F7ETE4     Uncharacterized protein OS=Monodelphis domestica GN=CDK3 PE=4 SV=1
   51 : D2HD59_AILME        0.79  0.92  185  447    1  263  263    0    0  264  D2HD59     Putative uncharacterized protein (Fragment) OS=Ailuropoda melanoleuca GN=PANDA_008590 PE=4 SV=1
   52 : G1T7L9_RABIT        0.79  0.92  185  470   51  336  286    0    0  355  G1T7L9     Uncharacterized protein OS=Oryctolagus cuniculus GN=CDK3 PE=4 SV=2
   53 : F7CB13_CALJA        0.78  0.79  185  480    1  236  296    2   60  238  F7CB13     Uncharacterized protein OS=Callithrix jacchus GN=CDK2 PE=4 SV=1
   54 : F1SFD7_PIG          0.77  0.88    1  183   21  204  184    1    1  213  F1SFD7     Cyclin-dependent kinase inhibitor 3 OS=Sus scrofa GN=CDKN3 PE=4 SV=2
   55 : G3HTW4_CRIGR        0.76  0.91  185  470   21  306  286    0    0  322  G3HTW4     Cell division protein kinase 3 OS=Cricetulus griseus GN=I79_014344 PE=4 SV=1
   56 : K7FZT3_PELSI        0.75  0.89   11  183    2  174  173    0    0  183  K7FZT3     Uncharacterized protein OS=Pelodiscus sinensis GN=CDKN3 PE=4 SV=1
   57 : H0ZS88_TAEGU        0.74  0.90    1  183   20  202  183    0    0  211  H0ZS88     Uncharacterized protein (Fragment) OS=Taeniopygia guttata GN=CDKN3 PE=4 SV=1
   58 : U3JMH5_FICAL        0.74  0.89    1  183   56  238  183    0    0  247  U3JMH5     Uncharacterized protein OS=Ficedula albicollis GN=CDKN3 PE=4 SV=1
   59 : R7VQK3_COLLI        0.73  0.88   12  164    1  153  153    0    0  153  R7VQK3     Cyclin-dependent kinase inhibitor 3 (Fragment) OS=Columba livia GN=A306_10087 PE=4 SV=1
   60 : W5QIU2_SHEEP        0.73  0.76    1  183   21  164  183    1   39  173  W5QIU2     Uncharacterized protein OS=Ovis aries GN=CDKN3 PE=4 SV=1
   61 : F2U4J6_SALR5        0.69  0.85  185  470    1  284  286    1    2  289  F2U4J6     CMGC/CDK/CDC2 protein kinase OS=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) GN=PTSG_03214 PE=4 SV=1
   62 : H9GNC7_ANOCA        0.69  0.86    1  180   21  199  180    1    1  211  H9GNC7     Uncharacterized protein (Fragment) OS=Anolis carolinensis GN=CDKN3 PE=4 SV=1
   63 : V4M0G8_THESL        0.69  0.86  185  474    1  291  291    1    1  294  V4M0G8     Uncharacterized protein OS=Thellungiella salsuginea GN=EUTSA_v10010585mg PE=4 SV=1
   64 : B7PRS4_IXOSC        0.68  0.85  186  478    7  301  295    1    2  303  B7PRS4     Protein kinase, putative OS=Ixodes scapularis GN=IscW_ISCW019950 PE=4 SV=1
   65 : C3XQE9_BRAFL        0.68  0.83  185  476    1  295  295    2    3  305  C3XQE9     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_114825 PE=4 SV=1
   66 : H3BII6_LATCH        0.68  0.87    1  183   16  198  183    0    0  208  H3BII6     Uncharacterized protein OS=Latimeria chalumnae PE=4 SV=2
   67 : K1RDV7_CRAGI        0.68  0.83  197  476    1  281  281    1    1  290  K1RDV7     Cell division control protein 2-like protein (Fragment) OS=Crassostrea gigas GN=CGI_10002412 PE=4 SV=1
   68 : M4DNE9_BRARP        0.68  0.86  185  474    1  291  291    1    1  294  M4DNE9     Uncharacterized protein OS=Brassica rapa subsp. pekinensis GN=BRA018036 PE=4 SV=1
   69 : M4SL30_9BILA        0.68  0.88  185  478    4  298  295    1    1  301  M4SL30     Cyclin Dependent Kinase 2 OS=Brachionus calyciflorus GN=CDK2 PE=4 SV=1
   70 : Q32PC4_BOVIN        0.68  0.72    1  183   21  158  183    1   45  167  Q32PC4     Cyclin-dependent kinase inhibitor 3 OS=Bos taurus GN=CDKN3 PE=2 SV=1
   71 : Q9XF13_PHAVU        0.68  0.85  195  469    1  276  276    1    1  280  Q9XF13     Cell division control protein 2 (Fragment) OS=Phaseolus vulgaris PE=2 SV=1
   72 : R0FQR1_9BRAS        0.68  0.86  185  474    1  291  291    1    1  294  R0FQR1     Uncharacterized protein OS=Capsella rubella GN=CARUB_v10017746mg PE=4 SV=1
   73 : T1K828_TETUR        0.68  0.88  186  474    8  295  289    1    1  304  T1K828     Uncharacterized protein OS=Tetranychus urticae PE=4 SV=1
   74 : V4CNG7_LOTGI        0.68  0.83  185  474    1  291  291    1    1  302  V4CNG7     Uncharacterized protein OS=Lottia gigantea GN=LOTGIDRAFT_230226 PE=4 SV=1
   75 : A1DMK1_NEOFI        0.67  0.85  185  472    1  290  290    2    2  305  A1DMK1     Cdk1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_053680 PE=4 SV=1
   76 : A9TPJ3_PHYPA        0.67  0.86  185  474    1  291  291    1    1  294  A9TPJ3     Cyclin-dependent kinase A;2 OS=Physcomitrella patens subsp. patens GN=CDKA;2 PE=2 SV=1
   77 : D7U5N9_VITVI        0.67  0.87  185  474    1  291  291    1    1  294  D7U5N9     Putative uncharacterized protein OS=Vitis vinifera GN=VIT_15s0045g00310 PE=4 SV=1
   78 : F1NIB9_CHICK        0.67  0.87    1  183   16  198  183    0    0  207  F1NIB9     Uncharacterized protein OS=Gallus gallus GN=CDKN3 PE=4 SV=2
   79 : K4L981_9TELE        0.67  0.85  185  476    1  293  293    1    1  302  K4L981     CDC2 OS=Carassius carassius red var. x Cyprinus carpio PE=2 SV=1
   80 : M9Z5Q7_LOLTE        0.67  0.87  185  474    1  291  291    1    1  294  M9Z5Q7     Serine threonine protein kinase OS=Lolium temulentum GN=CDKA PE=2 SV=1
   81 : V7BN84_PHAVU        0.67  0.86  185  473    1  290  290    1    1  294  V7BN84     Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_006G122800g PE=4 SV=1
   82 : W5LM94_ASTMX        0.67  0.84  185  476    1  293  293    1    1  302  W5LM94     Uncharacterized protein OS=Astyanax mexicanus PE=4 SV=1
   83 : C1BWE3_ESOLU        0.66  0.83  185  476    1  293  293    1    1  302  C1BWE3     Cell division control protein 2 homolog OS=Esox lucius GN=CDC2 PE=2 SV=1
   84 : CDC22_MEDSA         0.66  0.85  185  473    1  290  290    1    1  294  Q05006     Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1
   85 : G1P8L2_MYOLU        0.66  0.72    1  183   21  158  183    1   45  167  G1P8L2     Uncharacterized protein (Fragment) OS=Myotis lucifugus GN=CDKN3 PE=4 SV=1
   86 : Q5XLI0_9POAL        0.66  0.85  185  475    1  292  292    1    1  294  Q5XLI0     Cell-division-cycle-2 kinase OS=Saccharum hybrid cultivar ROC16 GN=Cdc2 PE=2 SV=2
   87 : A3A2L7_ORYSJ        0.65  0.84  186  474   34  322  290    2    2  324  A3A2L7     Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_05184 PE=4 SV=1
   88 : B4NFU0_DROWI        0.65  0.84  185  475    5  292  292    4    5  314  B4NFU0     GK22466 OS=Drosophila willistoni GN=Dwil\GK22466 PE=4 SV=1
   89 : CDK1_HUMAN          0.65  0.83  185  480    1  297  297    1    1  297  P06493     Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3
   90 : CDK1_ORYJA          0.65  0.84  185  476    1  293  293    1    1  303  Q9DGA2     Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1
   91 : E2RGJ9_CANFA        0.65  0.83  185  480    1  297  297    1    1  297  E2RGJ9     Uncharacterized protein OS=Canis familiaris GN=CDK1 PE=4 SV=1
   92 : J3L951_ORYBR        0.65  0.85  185  474    1  290  291    2    2  292  J3L951     Uncharacterized protein OS=Oryza brachyantha GN=OB02G11680 PE=4 SV=1
   93 : K4DAH0_SOLLC        0.65  0.85  185  475    1  292  292    1    1  294  K4DAH0     Uncharacterized protein OS=Solanum lycopersicum GN=Solyc11g070140.1 PE=4 SV=1
   94 : K4FTM0_CALMI        0.65  0.84    1  183   22  204  183    0    0  214  K4FTM0     Cyclin-dependent kinase inhibitor 3 isoform 1 OS=Callorhynchus milii PE=2 SV=1
   95 : K4GGA1_CALMI        0.65  0.84    1  183   22  204  183    0    0  214  K4GGA1     Cyclin-dependent kinase inhibitor 3 isoform 1 OS=Callorhynchus milii PE=2 SV=1
   96 : K7UBZ7_MAIZE        0.65  0.85  185  476    1  292  293    2    2  292  K7UBZ7     Putative cyclin-dependent kinase A family protein OS=Zea mays GN=ZEAMMB73_987534 PE=4 SV=1
   97 : L9L1F0_TUPCH        0.65  0.82  197  480    1  285  285    1    1  285  L9L1F0     Cyclin-dependent kinase 1 (Fragment) OS=Tupaia chinensis GN=TREES_T100011859 PE=4 SV=1
   98 : R7QBF2_CHOCR        0.65  0.83  185  475    1  289  291    1    2  307  R7QBF2     Cyclin-dependent kinase A-1, CDKA-1 OS=Chondrus crispus GN=CHC_T00009317001 PE=4 SV=1
   99 : S8F515_FOMPI        0.65  0.83  185  473    1  292  292    2    3  294  S8F515     Uncharacterized protein OS=Fomitopsis pinicola (strain FP-58527) GN=FOMPIDRAFT_1025270 PE=4 SV=1
  100 : B4KJH9_DROMO        0.64  0.83  185  473    1  290  290    1    1  297  B4KJH9     GI18275 OS=Drosophila mojavensis GN=Dmoj\GI18275 PE=4 SV=1
  101 : C5XT32_SORBI        0.64  0.85  185  476    1  292  293    2    2  293  C5XT32     Putative uncharacterized protein Sb04g001920 OS=Sorghum bicolor GN=Sb04g001920 PE=4 SV=1
  102 : E1ZQW0_CHLVA        0.64  0.82  185  471    1  288  288    1    1  288  E1ZQW0     Putative uncharacterized protein OS=Chlorella variabilis GN=CHLNCDRAFT_32928 PE=4 SV=1
  103 : F2EBW2_HORVD        0.64  0.85  185  477    1  293  294    2    2  293  F2EBW2     Predicted protein OS=Hordeum vulgare var. distichum PE=2 SV=1
  104 : F7D748_ORNAN        0.64  0.84    1  183   18  200  183    0    0  209  F7D748     Uncharacterized protein (Fragment) OS=Ornithorhynchus anatinus GN=CDKN3 PE=4 SV=1
  105 : G1NLR3_MELGA        0.64  0.87    1  183   19  201  183    0    0  210  G1NLR3     Uncharacterized protein (Fragment) OS=Meleagris gallopavo GN=CDKN3 PE=4 SV=1
  106 : I3KU47_ORENI        0.64  0.86    1  179   16  194  179    0    0  207  I3KU47     Uncharacterized protein OS=Oreochromis niloticus GN=LOC100694859 PE=4 SV=1
  107 : J9VUC9_CRYNH        0.64  0.85  185  474    3  294  292    2    2  298  J9VUC9     CMGC/CDK/CDC2 protein kinase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_01664 PE=4 SV=1
  108 : W1Q7A7_OGAPD        0.64  0.84  185  472    4  294  291    3    3  317  W1Q7A7     Cyclin-dependent kinase 1 OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=HPODL_02864 PE=4 SV=1
  109 : W6MLH4_9ASCO        0.64  0.82  185  472    4  294  291    3    3  320  W6MLH4     Genomic scaffold, Kuraishia_capsulata_scaffold_2 OS=Kuraishia capsulata CBS 1993 GN=KUCA_T00001637001 PE=4 SV=1
  110 : A6RA88_AJECN        0.63  0.81  185  472    1  309  309    3   21  324  A6RA88     Cell division control protein 2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_05876 PE=4 SV=1
  111 : B5U1S7_GALME        0.63  0.81  185  476    1  293  295    3    5  320  B5U1S7     Cell division cycle 2 OS=Galleria mellonella GN=cdc2 PE=2 SV=1
  112 : C1G8Q1_PARBD        0.63  0.80  185  472    1  309  309    3   21  333  C1G8Q1     Cell division control protein OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_03637 PE=4 SV=1
  113 : D4AUQ6_ARTBC        0.63  0.81  185  472    1  308  308    3   20  323  D4AUQ6     Putative uncharacterized protein OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07973 PE=4 SV=1
  114 : E4V6R7_ARTGP        0.63  0.81  185  472    1  308  308    3   20  323  E4V6R7     CMGC/CDK/CDC2 protein kinase OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_08708 PE=4 SV=1
  115 : K7IS13_NASVI        0.63  0.83  185  475    1  292  292    1    1  298  K7IS13     Uncharacterized protein OS=Nasonia vitripennis PE=4 SV=1
  116 : L7MGB1_9ACAR        0.63  0.82  185  471    6  294  290    4    4  294  L7MGB1     Putative cyclin-dependent kinase 1 (Fragment) OS=Rhipicephalus pulchellus PE=2 SV=1
  117 : Q2UM55_ASPOR        0.63  0.81  185  471    1  307  307    3   20  320  Q2UM55     Protein kinase PCTAIRE and related kinases OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090003000133 PE=4 SV=1
  118 : Q5SCC1_OSTTA        0.63  0.79  185  479    1  296  296    1    1  296  Q5SCC1     Cell cycle dependent kinase A OS=Ostreococcus tauri GN=CDKA PE=4 SV=1
  119 : W8BQQ5_CERCA        0.63  0.82  185  475    4  291  291    3    3  302  W8BQQ5     Cell division control protein 2 cognate OS=Ceratitis capitata GN=CDC2C PE=2 SV=1
  120 : A2QVX4_ASPNC        0.62  0.81  185  472    1  308  308    3   20  323  A2QVX4     Catalytic activity: ATP + a protein <=> ADP + a phosphoprotein OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An11g02960 PE=4 SV=1
  121 : B0W261_CULQU        0.62  0.80  185  477    1  294  295    3    3  298  B0W261     Cell division protein kinase 2 OS=Culex quinquefasciatus GN=CpipJ_CPIJ001155 PE=4 SV=1
  122 : B3MJG3_DROAN        0.62  0.82  185  477    1  294  294    1    1  297  B3MJG3     GF14103 OS=Drosophila ananassae GN=Dana\GF14103 PE=4 SV=1
  123 : B4G798_DROPE        0.62  0.83  185  477    1  294  294    1    1  297  B4G798     GL19151 OS=Drosophila persimilis GN=Dper\GL19151 PE=4 SV=1
  124 : C0MJ66_DROME        0.62  0.81  185  479    1  296  296    1    1  297  C0MJ66     CG5363-PA OS=Drosophila melanogaster GN=CG5363 PE=4 SV=1
  125 : C4JG20_UNCRE        0.62  0.81  185  472    1  309  309    3   21  324  C4JG20     Cell division control protein 2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01100 PE=4 SV=1
  126 : D8TU35_VOLCA        0.62  0.82  185  478    1  294  295    2    2  306  D8TU35     Cyclin dependent kinase OS=Volvox carteri GN=cdka1 PE=4 SV=1
  127 : G0VBJ3_NAUCC        0.62  0.85  185  472    5  295  291    3    3  296  G0VBJ3     Uncharacterized protein OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=NCAS0B02350 PE=4 SV=1
  128 : I2H8C3_TETBL        0.62  0.86  185  471    5  294  290    3    3  294  I2H8C3     Uncharacterized protein OS=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) GN=TBLA0H03440 PE=4 SV=1
  129 : I8AD03_ASPO3        0.62  0.80  185  472    1  305  305    2   17  308  I8AD03     Protein kinase OS=Aspergillus oryzae (strain 3.042) GN=Ao3042_11726 PE=4 SV=1
  130 : J4WD41_BEAB2        0.62  0.80  185  478    1  315  315    3   21  324  J4WD41     Cell division control protein 2 OS=Beauveria bassiana (strain ARSEF 2860) GN=BBA_02861 PE=4 SV=1
  131 : M9N3T6_ASHG1        0.62  0.86  185  472    4  294  291    3    3  295  M9N3T6     FADR058Cp OS=Ashbya gossypii (strain FDAG1) GN=FAGOS_FADR058C PE=4 SV=1
  132 : R8BD03_TOGMI        0.62  0.79  185  476    1  313  313    3   21  321  R8BD03     Putative cell division control protein 2 protein OS=Togninia minima (strain UCR-PA7) GN=UCRPA7_7325 PE=4 SV=1
  133 : R9XE70_ASHAC        0.62  0.85  185  472    4  294  291    3    3  295  R9XE70     AaceriADR058Cp OS=Ashbya aceri GN=AACERI_AaceriADR058C PE=4 SV=1
  134 : V7PQF8_9APIC        0.62  0.77  185  472    1  286  288    2    2  288  V7PQF8     CMGC/CDK protein kinase OS=Plasmodium yoelii 17X GN=YYC_01941 PE=4 SV=1
  135 : W2LG47_PHYPR        0.62  0.82  185  479    1  295  296    2    2  297  W2LG47     CMGC/CDK protein kinase OS=Phytophthora parasitica GN=L914_06207 PE=4 SV=1
  136 : W2XB49_PHYPR        0.62  0.82  185  479    1  295  296    2    2  297  W2XB49     CMGC/CDK protein kinase OS=Phytophthora parasitica CJ01A1 GN=F441_06397 PE=4 SV=1
  137 : W7LL44_GIBM7        0.62  0.79  185  473    1  310  310    3   21  325  W7LL44     CMGC/CDK/CDC2 protein kinase OS=Gibberella moniliformis (strain M3125 / FGSC 7600) GN=FVEG_02139 PE=4 SV=1
  138 : B5XBH4_SALSA        0.61  0.85    1  183   17  199  183    0    0  208  B5XBH4     Cyclin-dependent kinase inhibitor 3 OS=Salmo salar GN=CDKN3 PE=2 SV=1
  139 : B6Q9S5_PENMQ        0.61  0.79  197  472   42  337  297    4   22  349  B6Q9S5     Cell division control protein 2 kinase, putative OS=Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_072380 PE=4 SV=1
  140 : E3S457_PYRTT        0.61  0.79  185  479    1  317  317    4   22  324  E3S457     Putative uncharacterized protein OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_17311 PE=4 SV=1
  141 : F0VPX8_NEOCL        0.61  0.80  185  480    1  294  296    2    2  300  F0VPX8     Putative CMGC kinase, CDK family TgPK2 OS=Neospora caninum (strain Liverpool) GN=NCLIV_062010 PE=4 SV=1
  142 : F1L3C9_ASCSU        0.61  0.80  185  475    9  301  294    4    4  318  F1L3C9     Cell division protein kinase 1 OS=Ascaris suum PE=2 SV=1
  143 : F9G7F9_FUSOF        0.61  0.80  185  473    1  310  310    3   21  311  F9G7F9     Uncharacterized protein OS=Fusarium oxysporum (strain Fo5176) GN=FOXB_14591 PE=4 SV=1
  144 : H2TMA6_TAKRU        0.61  0.84    1  183   27  209  183    0    0  219  H2TMA6     Uncharacterized protein (Fragment) OS=Takifugu rubripes GN=LOC101078509 PE=4 SV=1
  145 : H6VMF4_BOMMO        0.61  0.82  185  480    1  300  301    4    6  302  H6VMF4     Cyclin dependent kinase 2 OS=Bombyx mori GN=CDK2 PE=2 SV=1
  146 : J6EF35_SACK1        0.61  0.84  185  472    5  297  293    4    5  298  J6EF35     CDC28-like protein OS=Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889) GN=YBR160W PE=4 SV=1
  147 : M4G3P0_MAGP6        0.61  0.77  185  476    1  316  316    4   24  328  M4G3P0     Uncharacterized protein OS=Magnaporthe poae (strain ATCC 64411 / 73-15) PE=4 SV=1
  148 : M7TWM1_BOTF1        0.61  0.79  185  472    1  312  313    6   26  333  M7TWM1     Putative cell division control protein 2 protein OS=Botryotinia fuckeliana (strain BcDW1) GN=BcDW1_5714 PE=4 SV=1
  149 : N1RR49_FUSC4        0.61  0.80  185  473    1  310  310    3   21  311  N1RR49     Cyclin-dependent kinase 1 OS=Fusarium oxysporum f. sp. cubense (strain race 4) GN=FOC4_g10005199 PE=4 SV=1
  150 : N4TUG4_FUSC1        0.61  0.80  185  473    1  310  310    3   21  311  N4TUG4     Cyclin-dependent kinase 1 OS=Fusarium oxysporum f. sp. cubense (strain race 1) GN=FOC1_g10003598 PE=4 SV=1
  151 : Q5CRJ8_CRYPI        0.61  0.80  185  477    2  293  294    3    3  295  Q5CRJ8     Cdc2-like CDK2/CDC28 like protein kinase (Fragment) OS=Cryptosporidium parvum (strain Iowa II) GN=cgd5_2510 PE=1 SV=1
  152 : T0M8F3_COLGC        0.61  0.79  185  479    1  316  316    3   21  326  T0M8F3     Uncharacterized protein OS=Colletotrichum gloeosporioides (strain Cg-14) GN=CGLO_02610 PE=4 SV=1
  153 : W0VWN7_ZYGBA        0.61  0.85  185  474    5  297  293    3    3  297  W0VWN7     CDC28-Cyclin-dependent protein kinase OS=Zygosaccharomyces bailii ISA1307 GN=ZbCDC28 PE=4 SV=1
  154 : A7AS99_BABBO        0.60  0.78  185  476    1  290  292    2    2  295  A7AS99     Cell division control protein 2 , putative OS=Babesia bovis GN=BBOV_IV010650 PE=2 SV=1
  155 : H2LZB8_ORYLA        0.60  0.83    1  179   27  205  179    0    0  219  H2LZB8     Uncharacterized protein (Fragment) OS=Oryzias latipes GN=LOC101160519 PE=4 SV=1
  156 : W5LQ75_ASTMX        0.60  0.84    1  183   24  206  183    0    0  216  W5LQ75     Uncharacterized protein (Fragment) OS=Astyanax mexicanus PE=4 SV=1
  157 : W5N1L0_LEPOC        0.60  0.86    1  183   15  197  183    0    0  207  W5N1L0     Uncharacterized protein OS=Lepisosteus oculatus PE=4 SV=1
  158 : W5N1L8_LEPOC        0.60  0.86    1  183   24  206  183    0    0  216  W5N1L8     Uncharacterized protein (Fragment) OS=Lepisosteus oculatus PE=4 SV=1
  159 : CDK1_DICDI          0.59  0.82  185  476    7  294  292    2    4  296  P34112     Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1
  160 : F9X9J8_MYCGM        0.59  0.79  185  472    1  315  315    7   27  328  F9X9J8     Cell division control protein 2 serine/threonine protein kinase OS=Mycosphaerella graminicola (strain CBS 115943 / IPO323) GN=CDC2 PE=4 SV=1
  161 : G3HB69_CRIGR        0.59  0.79  185  473    1  289  291    4    4  292  G3HB69     Cell division protein kinase 5 OS=Cricetulus griseus GN=I79_007690 PE=4 SV=1
  162 : H2QVM3_PANTR        0.59  0.79  185  473    1  289  291    4    4  292  H2QVM3     Cyclin-dependent kinase 5 OS=Pan troglodytes GN=CDK5 PE=2 SV=1
  163 : I7J7N2_BABMI        0.59  0.79  185  478    1  292  294    2    2  297  I7J7N2     Chromosome III, complete sequence OS=Babesia microti strain RI GN=BBM_III03500 PE=4 SV=1
  164 : J9EWG4_WUCBA        0.59  0.81  185  480    9  306  298    2    2  329  J9EWG4     CMGC/CDK/CDC2 protein kinase OS=Wuchereria bancrofti GN=WUBG_02127 PE=4 SV=1
  165 : K9IHR6_DESRO        0.59  0.79  185  473    1  289  291    4    4  292  K9IHR6     Putative serine/threonine kinase OS=Desmodus rotundus PE=2 SV=1
  166 : M3YAB5_MUSPF        0.59  0.79  185  473    1  289  291    4    4  292  M3YAB5     Uncharacterized protein OS=Mustela putorius furo GN=CDK5 PE=4 SV=1
  167 : R8BPX3_TOGMI        0.59  0.78  185  479    1  316  316    3   21  324  R8BPX3     Putative cell division control protein 2 protein OS=Togninia minima (strain UCR-PA7) GN=UCRPA7_3106 PE=4 SV=1
  168 : A0BIA5_PARTE        0.58  0.79  186  475    8  301  296    5    8  301  A0BIA5     Chromosome undetermined scaffold_11, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00004644001 PE=4 SV=1
  169 : A0E076_PARTE        0.58  0.79  186  474   11  301  291    2    2  318  A0E076     Chromosome undetermined scaffold_71, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00021861001 PE=4 SV=1
  170 : B3NQB0_DROER        0.58  0.80  185  472    1  288  290    4    4  294  B3NQB0     GG22344 OS=Drosophila erecta GN=Dere\GG22344 PE=4 SV=1
  171 : B4KLK3_DROMO        0.58  0.79  185  472    1  288  290    4    4  294  B4KLK3     GI19456 OS=Drosophila mojavensis GN=Dmoj\GI19456 PE=4 SV=1
  172 : B4QGW7_DROSI        0.58  0.79  185  472    1  288  290    4    4  294  B4QGW7     GD25609 OS=Drosophila simulans GN=Dsim\GD25609 PE=4 SV=1
  173 : B8A6D9_DANRE        0.58  0.81    1  183   16  198  183    0    0  208  B8A6D9     Uncharacterized protein OS=Danio rerio GN=cdkn3 PE=4 SV=1
  174 : G3PDB3_GASAC        0.58  0.86    1  182   20  202  183    1    1  213  G3PDB3     Uncharacterized protein (Fragment) OS=Gasterosteus aculeatus PE=4 SV=1
  175 : G3Q1J9_GASAC        0.58  0.77  185  473    1  289  291    4    4  292  G3Q1J9     Uncharacterized protein OS=Gasterosteus aculeatus PE=4 SV=1
  176 : J7PUX3_OIKDI        0.58  0.76  185  476    5  300  297    5    6  313  J7PUX3     CDK1a protein OS=Oikopleura dioica GN=cdk1a PE=4 SV=1
  177 : Q5U3V4_DANRE        0.58  0.77  185  473    1  289  291    4    4  292  Q5U3V4     Cdk5 protein OS=Danio rerio GN=cdk5 PE=2 SV=1
  178 : Q7ZWJ8_DANRE        0.58  0.81    1  183   26  208  183    0    0  218  Q7ZWJ8     Cdkn3 protein (Fragment) OS=Danio rerio GN=cdkn3 PE=2 SV=1
  179 : T5C8U0_AJEDE        0.58  0.77  187  475   10  296  289    2    2  309  T5C8U0     CMGC/CDK protein kinase OS=Ajellomyces dermatitidis ATCC 26199 GN=BDFG_00126 PE=4 SV=1
  180 : W0G1U1_RHIMP        0.58  0.78  185  479    1  295  297    4    4  296  W0G1U1     Cyclin-dependent kinase 5 OS=Rhipicephalus microplus PE=2 SV=1
  181 : A0DY48_PARTE        0.57  0.79  186  475    8  301  296    5    8  301  A0DY48     Chromosome undetermined scaffold_7, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00002933001 PE=4 SV=1
  182 : C5DB66_VITVI        0.57  0.79  185  476    1  301  302    5   11  303  C5DB66     Kinase cdc2 homolog B OS=Vitis vinifera GN=VIT_08s0056g00210 PE=4 SV=1
  183 : E9ASH4_LEIMU        0.57  0.78  185  473   20  309  292    4    5  311  E9ASH4     Cell division related protein kinase 2 OS=Leishmania mexicana (strain MHOM/GT/2001/U1103) GN=LMXM_36_0550 PE=4 SV=1
  184 : F1L117_ASCSU        0.57  0.77  185  475    1  291  293    4    4  292  F1L117     Cell division protein kinase 5 OS=Ascaris suum GN=ASU_09203 PE=2 SV=1
  185 : H9K483_APIME        0.57  0.78  185  479    1  295  297    4    4  299  H9K483     Uncharacterized protein OS=Apis mellifera GN=Cdk5 PE=4 SV=1
  186 : J3L6Q1_ORYBR        0.57  0.79  185  476    1  301  302    5   11  303  J3L6Q1     Uncharacterized protein OS=Oryza brachyantha GN=OB01G49070 PE=4 SV=1
  187 : J9NLU0_FUSO4        0.57  0.77  185  473    1  310  311    5   23  312  J9NLU0     Uncharacterized protein OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=FOXG_16169 PE=4 SV=1
  188 : Q9UWF2_SPOSC        0.57  0.78  185  473    7  295  290    2    2  306  Q9UWF2     Cyclin-dependent protein kinase PHOSs OS=Sporothrix schenckii GN=phoSs PE=2 SV=1
  189 : V8PHU9_OPHHA        0.57  0.78    1  164   18  185  169    3    6  208  V8PHU9     Cyclin-dependent kinase inhibitor 3 (Fragment) OS=Ophiophagus hannah GN=CDKN3 PE=4 SV=1
  190 : B8A7Q0_ORYSI        0.56  0.78  185  476    1  301  302    5   11  303  B8A7Q0     Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_04781 PE=4 SV=1
  191 : B8R3A3_POPTO        0.56  0.79  185  476    5  304  301    5   10  306  B8R3A3     Cyclin-dependent kinase B OS=Populus tomentosa GN=CDKB PE=2 SV=1
  192 : C1EIR1_MICSR        0.56  0.75  186  476    7  305  300    5   10  323  C1EIR1     Predicted protein OS=Micromonas sp. (strain RCC299 / NOUM17) GN=CDKB PE=4 SV=1
  193 : D7KJ75_ARALL        0.56  0.77  185  475   13  311  300    5   10  315  D7KJ75     Cyclin-dependent kinase B2_2 OS=Arabidopsis lyrata subsp. lyrata GN=CDKB2_2 PE=4 SV=1
  194 : F2CTB4_HORVD        0.56  0.76  185  476    1  307  308    5   17  309  F2CTB4     Predicted protein OS=Hordeum vulgare var. distichum PE=2 SV=1
  195 : H3DPU4_TETNG        0.56  0.81    1  183   26  207  183    1    1  217  H3DPU4     Uncharacterized protein (Fragment) OS=Tetraodon nigroviridis PE=4 SV=1
  196 : J9JP19_ACYPI        0.56  0.77  185  474    1  290  292    4    4  294  J9JP19     Uncharacterized protein OS=Acyrthosiphon pisum GN=cdk5 PE=4 SV=1
  197 : W5EP91_WHEAT        0.56  0.77  185  476    1  307  308    5   17  309  W5EP91     Uncharacterized protein OS=Triticum aestivum PE=4 SV=1
  198 : D7FKL6_ECTSI        0.55  0.80  185  476    2  292  292    1    1  295  D7FKL6     Putative uncharacterized protein CDKB;2 OS=Ectocarpus siliculosus GN=CDKB;2 PE=4 SV=1
  199 : E1ZRU6_CHLVA        0.55  0.76  185  476    1  302  303    6   12  317  E1ZRU6     Putative uncharacterized protein OS=Chlorella variabilis GN=CHLNCDRAFT_33088 PE=4 SV=1
  200 : I3SZR5_MEDTR        0.55  0.78  186  476   16  314  300    5   10  316  I3SZR5     Uncharacterized protein OS=Medicago truncatula PE=2 SV=1
  201 : K4GKQ3_CALMI        0.55  0.74    1  183   22  189  183    1   15  199  K4GKQ3     Cyclin-dependent kinase inhibitor 3 isoform 1 OS=Callorhynchus milii PE=2 SV=1
  202 : O49120_DUNTE        0.55  0.76  185  472    1  296  298    6   12  314  O49120     Cyclin-dependent kinase 1 OS=Dunaliella tertiolecta GN=DUNCDC2 PE=2 SV=2
  203 : PHO85_YARLI         0.55  0.78  187  475    6  294  290    2    2  294  Q6C7U8     Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1
  204 : G0VCM7_NAUCC        0.54  0.75  187  473    6  300  296    5   10  311  G0VCM7     Uncharacterized protein OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=NCAS0C02470 PE=4 SV=1
  205 : H2AZ07_KAZAF        0.54  0.75  187  473    6  300  296    5   10  306  H2AZ07     Uncharacterized protein OS=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-8276) GN=KAFR0H01530 PE=4 SV=1
  206 : N1Q402_MYCP1        0.54  0.74  187  479    8  305  302    5   13  325  N1Q402     Uncharacterized protein OS=Mycosphaerella pini (strain NZE10 / CBS 128990) GN=DOTSEDRAFT_142948 PE=4 SV=1
  207 : R0I7G6_9BRAS        0.54  0.76  185  475   11  309  300    5   10  313  R0I7G6     Uncharacterized protein OS=Capsella rubella GN=CARUB_v10021486mg PE=4 SV=1
  208 : W5IC20_WHEAT        0.54  0.76  185  480   25  328  306    7   12  345  W5IC20     Uncharacterized protein OS=Triticum aestivum PE=4 SV=1
  209 : B9G1R8_ORYSJ        0.53  0.77  185  477   25  325  302    5   10  326  B9G1R8     Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_27911 PE=4 SV=1
  210 : C3Z3W3_BRAFL        0.53  0.81    6  182   19  195  177    0    0  207  C3Z3W3     Putative uncharacterized protein OS=Branchiostoma floridae GN=BRAFLDRAFT_99767 PE=4 SV=1
  211 : M7WKP0_RHOT1        0.53  0.69  185  472    1  333  335    5   49  436  M7WKP0     Cell division control protein Cdc2 OS=Rhodosporidium toruloides (strain NP11) GN=RHTO_05858 PE=4 SV=1
  212 : Q4CRI4_TRYCC        0.53  0.74  187  471    4  298  298    7   16  301  Q4CRI4     Cell division protein kinase 2 OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053504181.40 PE=4 SV=1
  213 : U6MEE6_9EIME        0.53  0.73  185  479    1  267  295    5   28  269  U6MEE6     CMGC kinase, CDK family TgPK2, putative OS=Eimeria necatrix GN=ENH_00019440 PE=4 SV=1
  214 : M4BZ82_HYAAE        0.50  0.66  185  476    1  298  307    4   24  300  M4BZ82     Uncharacterized protein OS=Hyaloperonospora arabidopsidis (strain Emoy2) PE=4 SV=1
  215 : S4RLZ4_PETMA        0.50  0.78    1  183   23  206  184    1    1  217  S4RLZ4     Uncharacterized protein (Fragment) OS=Petromyzon marinus PE=4 SV=1
  216 : G3MG18_9ACAR        0.49  0.75    6  174   19  187  169    0    0  188  G3MG18     Putative uncharacterized protein (Fragment) OS=Amblyomma maculatum PE=2 SV=1
  217 : E4X572_OIKDI        0.48  0.68  185  480    9  316  311    6   18  317  E4X572     Whole genome shotgun assembly, reference scaffold set, scaffold scaffold_11 OS=Oikopleura dioica GN=GSOID_T00002302001 PE=4 SV=1
  218 : G3MT57_9ACAR        0.48  0.72    6  182   19  195  177    0    0  203  G3MT57     Putative uncharacterized protein OS=Amblyomma maculatum PE=2 SV=1
  219 : B7PP47_IXOSC        0.47  0.70    5  181   17  193  177    0    0  202  B7PP47     CDK2-associated dual specificity phosphatase, putative OS=Ixodes scapularis GN=IscW_ISCW006791 PE=4 SV=1
  220 : G1N9I3_MELGA        0.47  0.70  186  480   11  310  305    7   15  326  G1N9I3     Uncharacterized protein OS=Meleagris gallopavo GN=CDK6 PE=4 SV=1
  221 : K1P547_CRAGI        0.47  0.70    1  179   30  211  182    1    3  225  K1P547     Cyclin-dependent kinase inhibitor 3 OS=Crassostrea gigas GN=CGI_10011135 PE=4 SV=1
  222 : U3K755_FICAL        0.47  0.69  186  480   11  310  305    7   15  326  U3K755     Uncharacterized protein OS=Ficedula albicollis GN=CDK6 PE=4 SV=1
  223 : V5GUN9_IXORI        0.47  0.71    5  182   17  194  178    0    0  202  V5GUN9     Putative cyclin-dependent kinase inhibitor 3 OS=Ixodes ricinus PE=2 SV=1
  224 : F1MA87_RAT          0.46  0.68  186  480   11  310  306    7   17  326  F1MA87     Cyclin-dependent kinase 6 OS=Rattus norvegicus GN=Cdk6 PE=4 SV=2
  225 : G1T0K2_RABIT        0.46  0.68  186  480   11  310  306    7   17  326  G1T0K2     Uncharacterized protein OS=Oryctolagus cuniculus GN=CDK6 PE=4 SV=1
  226 : E2RLM4_CANFA        0.45  0.67  186  480   11  310  306    7   17  326  E2RLM4     Uncharacterized protein OS=Canis familiaris GN=CDK6 PE=4 SV=1
  227 : G1PJ96_MYOLU        0.45  0.69  186  480   11  310  306    7   17  326  G1PJ96     Uncharacterized protein OS=Myotis lucifugus GN=CDK6 PE=4 SV=1
  228 : G3TL01_LOXAF        0.45  0.68  186  480   11  310  306    7   17  326  G3TL01     Uncharacterized protein OS=Loxodonta africana GN=CDK6 PE=4 SV=1
  229 : T1JGM7_STRMM        0.45  0.73    3  174   20  191  172    0    0  209  T1JGM7     Uncharacterized protein OS=Strigamia maritima PE=4 SV=1
  230 : E9AD33_LEIMA        0.44  0.67  188  472   24  326  306    9   24  327  E9AD33     Uncharacterized protein OS=Leishmania major GN=LMJF_27_0560 PE=4 SV=1
  231 : V5IGZ8_IXORI        0.44  0.67  185  473   13  313  302    4   14  317  V5IGZ8     Putative cdc2-related protein kinase (Fragment) OS=Ixodes ricinus PE=2 SV=1
  232 : F7FIA4_MACMU        0.43  0.44    1  183   21  103  184    3  102  112  F7FIA4     Uncharacterized protein (Fragment) OS=Macaca mulatta GN=CDKN3 PE=4 SV=1
  233 : Q86SK8_HUMAN        0.43  0.43    1  183   21  103  184    3  102  112  Q86SK8     Cdk-associated protein phosphatase mutant k2 OS=Homo sapiens PE=4 SV=1
  234 : V4C3P3_LOTGI        0.43  0.71    1  183   22  204  183    0    0  216  V4C3P3     Uncharacterized protein OS=Lottia gigantea GN=LOTGIDRAFT_188309 PE=4 SV=1
  235 : W4XJA3_STRPU        0.43  0.68    3  183   38  218  181    0    0  228  W4XJA3     Uncharacterized protein OS=Strongylocentrotus purpuratus GN=Sp-Cdkn3 PE=4 SV=1
  236 : W6L9F5_9TRYP        0.43  0.65  187  472   22  327  309   10   26  329  W6L9F5     Genomic scaffold, scaffold_11 OS=Phytomonas sp. isolate Hart1 GN=GSHART1_T00001523001 PE=4 SV=1
  237 : F6X4Q9_CALJA        0.42  0.43    1  183   20  102  184    2  102  111  F6X4Q9     Uncharacterized protein (Fragment) OS=Callithrix jacchus GN=CDKN3 PE=4 SV=1
  238 : R7TUX3_CAPTE        0.39  0.63    1  179   27  191  180    2   16  204  R7TUX3     Uncharacterized protein OS=Capitella teleta GN=CAPTEDRAFT_185188 PE=4 SV=1
  239 : E3RKJ3_PYRTT        0.34  0.54  186  476   46  384  347   14   64  437  E3RKJ3     Putative uncharacterized protein OS=Pyrenophora teres f. teres (strain 0-1) GN=PTT_08758 PE=4 SV=1
  240 : F2RZZ7_TRIT1        0.34  0.56  186  472   40  373  347   15   73  430  F2RZZ7     CMGC/CDK/CDK8 protein kinase OS=Trichophyton tonsurans (strain CBS 112818) GN=TESG_04257 PE=4 SV=1
  241 : I1KQ06_SOYBN        0.34  0.53  185  478   17  356  349   11   64  409  I1KQ06     Uncharacterized protein OS=Glycine max PE=4 SV=1
  242 : M2SQP6_COCSN        0.33  0.54  186  470   13  345  340   12   62  404  M2SQP6     Uncharacterized protein OS=Cochliobolus sativus (strain ND90Pr / ATCC 201652) GN=COCSADRAFT_165303 PE=4 SV=1
  243 : W6YGL8_COCCA        0.33  0.54  186  470   13  345  338   12   58  404  W6YGL8     Uncharacterized protein OS=Bipolaris zeicola 26-R-13 GN=COCCADRAFT_35697 PE=4 SV=1
  244 : S3UHV5_9LEPT        0.32  0.57    7  172  617  777  167    4    7  781  S3UHV5     Cyclin-dependent kinase inhibitor 3 OS=Leptospira wolffii serovar Khorat str. Khorat-H2 GN=LEP1GSC061_2636 PE=4 SV=1
  245 : D0NF32_PHYIT        0.31  0.54  186  480   14  353  341   14   47  358  D0NF32     Serine/threonine protein kinase OS=Phytophthora infestans (strain T30-4) GN=PITG_10334 PE=4 SV=1
  246 : R7Z4Q9_CONA1        0.31  0.53  185  476   13  357  354   13   71  408  R7Z4Q9     CMGC/CDK/CDK8 protein kinase OS=Coniosporium apollinis (strain CBS 100218) GN=W97_08328 PE=4 SV=1
  247 : Q11SI3_CYTH3        0.30  0.55    3  175  269  436  174    4    7  438  Q11SI3     Protein-tyrosine phosphatase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=yopH PE=4 SV=1
  248 : Q9RSG3_DEIRA        0.30  0.51    4  175    3  177  180    5   13  177  Q9RSG3     Protein-tyrosine phosphatase-related protein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_2161 PE=4 SV=1
  249 : V6HJR7_9LEPT        0.30  0.54   23  176  630  780  155    4    5  782  V6HJR7     Cyclin-dependent kinase inhibitor 3 OS=Leptospira kmetyi serovar Malaysia str. Bejo-Iso9 GN=LEP1GSC052_3085 PE=4 SV=1
## ALIGNMENTS    1 -   70
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....1....:....2....:....3....:....4....:....5....:....6....:....7
     1   21 A E              0   0  205   67   16  E  EE  E EE EEEE EE  EE E EEEEEEEDEEEDE   EEEE E     E  EE E E   D   E
     2   22 A D    >   +     0   0   66   69   46  D  DD  D DD DDDD DD  DDDD DDDDDDDDDDDED   DDNNQD     D  EE D K   D   D
     3   23 A E  B 3  S+a   38   0A 100   72   33  E  EE  E EE EEEE EE  EEEE EEEEEEEEEEEEE   EEEENE     E  EE E E   Q   E
     4   24 A Q  T 3  S+     0   0  153   73   71  Q  QQ  Q QQ QQQQ QQ  QQEQ QQQQQHQQQQQQQ   QQQQAQ     Q  PP Q E   C   Q
     5   25 A T  S <  S-     0   0   77   75   47  T  TT  T TT TTTT TT  TTPT TTTTTTTTTTTTT   TTTTTT     T  SS T T   T   T
     6   26 A P        -     0   0   85   78    8  P  PP  P PP PPPP PP  PPIP PPPPPPPPPPPPP   PPPPSP     P  PP P P   P   P
     7   27 A I        -     0   0   17   79   35  I  II  I II IIII II  IIEI MIIIIIIIIIIII   IIFFLI     I  LL I F   L   I
     8   28 A H        -     0   0  136   79   55  H  HH  H QQ QQQH HH  QHDQ QQQQQQQQQQQQQ   HEQQWQ     Q  HH Q Q   Q   Q
     9   29 A I        -     0   0   14   79   14  I  II  I II IIII II  IIDI IIIIIIIIIIIII   IIVVCI     I  II I V   V   I
    10   30 A S  E     -B   25   0B  11   79   45  S  SS  S SS SSSS SS  SSQS SSSSSSSSSSSSS   SSSSSS     S  SS S S   S   S
    11   31 A W  E     -B   24   0B  86   80    8  W  WW  W WW WWWW WW  WWWW WWWWWWWWWWWWW   WWWWKW     W WWW W W   W   W
    12   32 A L  E     -B   23   0B   9   81    7  L  LL  L LL LLLL LL  LLLL LLLLLLLLLLLLL   LLLLLL     L LLLLL L   L   L
    13   33 A S  E     -B   22   0B  39   81   58  S  SS  S SS SSSP PP  PSSP PPPPPSPPPPPPP   PPPPPP     P ASSTP A   S   P
    14   34 A L    > > +     0   0    0   82   17  L  LL  L LL LLLL LL  LLLLLLLLLLLLLLLLLL   LLLLLL     L LLLLL L   L   L
    15   35 A S  G > 5 +     0   0   64   81   20  S  SS  S SS SSSS SS  SSSSSSSSSSSSSSSSSS   SSSSSS     S SSPSS S   S   S
    16   36 A R  G 3 5S+     0   0  161   82   90  R  RR  R RR RRRR RR  RRRQRRQRRRRRRRRQRR   RQLLRR     R SPPPR P   V   R
    17   37 A V  G < 5S-     0   0    4   82   48  V  VV  V VV VVVV VV  VVVVVVVVVVVVVVVVVV   VVVVVV     V VLVVV V   V   V
    18   38 A N  T < 5S+     0   0  141   82   69  N  NN  N NN NNNN NN  NNTNNNNNNNNNNNNNNN   NNNNNN     N NYFYN Y   D   N
    19   39 A C      < -     0   0   29   79   49  C  CC  C CC CCCC CC  CCCCCCCYCCWCCCCCCC   CCCCCC     C CSSSC S   S   C
    20   40 A S  S    S+     0   0   84   79   48  S  SS  S SS SSSS SS  SSSSSSSSSSSSSSSSSS   SCSSSS     S SSSSS .   C   S
    21   41 A Q        -     0   0   37   82   44  Q  QQ  Q QQ QQQQ QQ  QQQQQQQQQQQQQQQQQQ   QQQQQQ     Q QEEKQ Q   Q   Q
    22   42 A F  E     -B   13   0B 105   82   68  F  FF  F FF FFFF FF  FFFFFFFFFFFFFFFFFF   FFFFFL     F FFFFF F   F   F
    23   43 A L  E     -B   12   0B   0   83   11  L  LL  L LL LLLL LL  LLLLLLLLLLLLLLLLLL   LLLLLL     L LLLLL L   L   L
    24   44 A G  E     -Bc  11 117B   0   82    5  G  GG  G GG GGGG GG  GGGGGGGGGGGGGGGGGG   GGGGGG     G GGGGG G   G   G
    25   45 A L  E     +Bc  10 118B   1   82   26  L  LL  L LL LLLL LL  LLLLLLLLLLLLLLLLLL   LLLLLL     L VLLLL I   I   L
    26   46 A C        -     0   0    2   81   35  C  CC  C CC CCCC CC  CCCCCCCCCCCCCCCCCC   CCCCCC     C CCCCC C   C   C
    27   47 A A        -     0   0   44   79   57  A  AA  A AA AAAA AA  AAAAAAAAAAAAAAAAAA   AASSAA     A SSSSA A   S   A
    28   48 A L    >   -     0   0    4   79    5  L  LL  L LL LLLL LL  LLLLLLLLLLLLLLLLLL   LLLLLL     L LLLLL L   L   L
    29   49 A P  T 3  S+     0   0    0   79    0  P  PP  P PP PPPP PPP PPPPPPPPPPPPPPPPPP   PPPPP.     P PPPPP P   P   P
    30   50 A G  T 3  S+     0   0    0   79    3  G  GG  G GG GGGG GGP GGGGGGGGGGGGGGGGGG   GGGGG.     G GGGGG G   G   G
    31   51 A C    <   -     0   0    4   77    8  C CCC  C CC CCCC CCS CCCCCCCCCCCCCCCCCC  CCCCCC.     C CCCCC C   C   C
    32   52 A K        +     0   0   37   79   28  KKKKK  K KK KKKK KKSKKKNKKKKKKKKKKKKKKK  KKKKKK.     K RRRRK R   K   K
    33   53 A F  B >  S-F   36   0C  25   82   27  FFFFF  F FF FFFF FFIFFFFFFFFFFFFFFFFFFF  FFFFFF.     F FFFFF F   F   F
    34   54 A K  T 3  S-     0   0   81   82    8  KKKKK  K KK KKKK KKKKKKKKKKKKKKKKKKKKKK  KKKKKK.     K KKKKK K   K   K
    35   55 A D  T 3  S+     0   0  118   82   22  DDDDD  D DD DDDD DDDNNDDNDNNDDNDDDNDDDN  DDDDDD.     D DDDDD N   D   D
    36   56 A V  B <   +F   33   0C  58   82   61  VVVVV  V VV VVVV VVVVVVVVIVVVVVVVVVTVVV  IVVVVI.     V VVIIV I   I   V
    37   57 A R        +     0   0   75   82   27  RRRRR  R RR RRRR RRRRRRSRRRRRRRRRRRRRRR  RRRRRR.     R RRRRR R   R   R
    38   58 A R  B     -a    3   0A  48   82    0  RRRRR  R RR RRRR RRRRRRRRRRRRRRRRRRRRRR  RRRRRR.     R RRRRR R   R   R
    39   59 A N     >  -     0   0   64   82   37  NNNNN  N NN NNNN NNNNNNVNNNNNNNNNNNNNNN  NNNNNN.     N NNNNN N   N   N
    40   60 A V  H  > S+     0   0   15   81   36  VVVVV  V VV VVVV VVVVVVVIIIIIIIIIIIIIIV  IIILLI.     I LLLLI L   L   I
    41   61 A Q  H  > S+     0   0   84   83   46  QQQQQQ Q QQ QQQQ QQQEEQQQQQQQQQGQQQQQQE  QQQQQQ.     Q QQQQQ Q   Q   Q
    42   62 A K  H  > S+     0   0   98   83   47  KKKKKK K KK KKKK KKKKKKTKKKKKKKKKKKKKKK  KKKKKK.     K KKKKK K   R   K
    43   63 A D  H  X S+     0   0    3   83    3  DDDDDD D DD DDDD DDDDDDDDDDDDDDDDDDDDDD  DDDDDD.     D DDDDD D   D   D
    44   64 A T  H  X S+     0   0    2   84   69  TTTTTT T TT TTTT TTTTTTTTTTTTTTTTTTTTTT  TTTMVTP     T IIIIT I   L   T
    45   65 A E  H  X S+     0   0   97   84   37  EEEEEE E EE EEEE EEEEEEEEEEEEEEEEEEEEEE  EEEEEEE     E EGGEE E   E   D
    46   66 A E  H  X S+     0   0   57   85   48  EEEEEE E EE EEEE EEEEEEEEEEEEEEEEEEEEEE  EEEEEEE     E EEEEE E   E   G
    47   67 A L  H  X>S+     0   0    0   85   16  LLLLLL L LL LLLL LLLLLLLLLLLLLLLLLLLLLL  LLLLLLL     L LLLLL L   L   G
    48   68 A K  H ><5S+     0   0   86   84   56  KKKKKK K KK KKKK KKKKKKKKKKKKKKKKKKKKKK  KKKKKKK     K KKKKK K   K   .
    49   69 A S  H 3<5S+     0   0   89   84   73  SSSSSS S SS SSSS SSSSSSSSSSSSSSSNSSSSSS  NSTNNNS     S RSNNS S   N   .
    50   70 A C  H 3<5S-     0   0   52   84   96  CCCCCC C CC CCCC CCCCCCCYYYYCHYCYSYYYYC  YYCYYYC     C HCCYY Y   Q   .
    51   71 A G  T <<5 +     0   0   37   83   20  GGGGGG G GG GGGG GGGGGGGGGGGGGGGGGGGGGG  GGGGGGG     G GGGG. G   S   .
    52   72 A I      < +     0   0    1   83   23  IIIIII I II IIII IIIIIIIIIIIIIIIIIIIIII  IIIIIII     I IIIT. V   I   .
    53   73 A Q        +     0   0   64   83   49  QQQQQQ Q QQ QQQQ QQQQQQQQQQQQQQQQQQQQQQ  QQQQQQQ     Q QQQQ. Q   Q   .
    54   74 A D  E     -de  82 116B   9   83   27  DDDDDD D DD DDDD DDDDDDDDDDDDDDDDDDDDDD  DDDDDDD     D DDDD. E   D   .
    55   75 A I  E     -de  83 117B   0   83   16  IIIIII I II IIIV VVIIIIIIIIIVIIIIVIIIVI  IIIIIII     V IIII. I   I   .
    56   76 A F  E     -de  84 118B   0   83   19  FFFFFF F FF FFFF FFFFFFFFFFFFFFFFFFFFFF  FFFFFFF     F FFFF. F   F   .
    57   77 A V  E     -de  85 119B   0   83   24  VVVVVV V VV VVVV VVVVVVVVVVVVVVVVVVVVVV  VVVVVVV     V VVVV. V   V   .
    58   78 A F        +     0   0    0   83   11  FFFFFF F FF FFFF FFFFFFFFFFFFFFFFFFFFFF  FFFFFFF     F LLLL. L   F   .
    59   79 A C  S    S-     0   0    0   83   26  CCCCCC C CC CCCC CCCCCCCCCCCCCCCCCCCCCC  CCCCCCC     C CCCC. C   C   .
    60   80 A T    >>  -     0   0   36   83   12  TTTTTT T TT TTTT TTTTTTTTTTTTTTTTTTTTTT  TTTTTTT     T TTTT. T   T   .
    61   81 A R  H 3> S+     0   0  157   83   39  RRRRRR R RR RRRR RRRRRRRRRRRRRRRRRRRRRR  RRRRRRR     R KRRR. R   R   .
    62   82 A G  H 3> S+     0   0   53   83   18  GGGGGG G GG GGGG GGGGGGGGGGGGGGGGGGGGGG  GGGGGGG     G GGGG. G   G   .
    63   83 A E  H <> S+     0   0   14   83    0  EEEEEE E EE EEEE EEEEEEEEEEEEEEEEEEEEEE  EEEEEEE     E EEEE. E   E   .
    64   84 A L  H  <>S+     0   0    1   83    7  LLLLLL L LL LLLL LLLLLLLLLLLLLLLLLLLLLL  LLLLLLL     L LLLL. L   L   .
    65   85 A S  H ><5S+     0   0   67   83   67  SSSSSS S SS SSSS SSSSSSSSSSSSSSSSSSSSSS  SSSSSSS     S SSSF. S   T   .
    66   86 A K  H 3<5S+     0   0  141   83   42  KKKKKK K KK KKKK KKKKKKKKKKKKKKKKKKKKKK  KKKKKKK     K KKKK. K   K   .
    67   87 A Y  T 3<5S-     0   0    6   83    5  YYYYYY Y YY YYYY YYYYYYYYYYYYYYYYYYYYYY  YYYYYYY     Y YYYY. C   Y   .
    68   88 A R  T < 5S+     0   0  130   83   21  RRRRRR R RR RRRR RRRRRRRRRRRRRRRRRRRRRR  RRRRRRR     R RRRR. R   R   .
    69   89 A V    > < +     0   0    0   83    6  VVVVVV V VV VVVV VVVVVVVVVVVVVVVVVVVVVV  VVVVVVV     V VVVV. V   V   .
    70   90 A P  T >  S+     0   0   69   83   21  PPPPPP P PP PPPP PPPPPPPPPPPPPPPPPPPPPP  PPPPPPP     P PPPP. P   P   .
    71   91 A N  T >> S+     0   0   63   83   70  NNNNNN N NN NNNN NNNNNNNNNNNNNNNNNNNNNN  NNNNNNN     N LNNN. N   N   .
    72   92 A L  H <> S+     0   0    0   83    5  LLLLLL L LL LLLL LLLLLLLLLLLLLLLLLLLLLL  LLLLLLL     L LLLL. L   L   .
    73   93 A L  H <> S+     0   0    5   83   29  LLLLLL L LL LLLL LLLLLLLLLLLLLLLLLLLLLL  LLLLLLL     L LLII. L   L   .
    74   94 A D  H <> S+     0   0   77   83   36  DDDDDD D DD DDDD DDDDDDDDDDDDDDEDDDDDDD  NDDDDND     D DDDD. A   E   .
    75   95 A L  H  < S+     0   0   16   83   85  LLLLLL L LL LLLL LLLLLLLLLLLLLLLLLLLLLL  FSFFFFL     L STTA. A   A   .
    76   96 A Y  H ><>S+     0   0    2   83   14  YYYYYY Y YY YYYY YYYYYYYYYYYYYYYYYYYYYY  YYYYYYY     Y YYYY. Y   Y   .
    77   97 A Q  H ><5S+     0   0   89   83   58  QQQQQQ Q QQ QQQQ QQQQQQQHQHHHHHEQQHQQQQ  QQQQQQH     H QQLQ. Q   Q   .
    78   98 A Q  T 3<5S+     0   0  140   83   50  QQQQQQ Q QQ QQQQ QQQQQQQQQQQQQQQQQQQQQQ  QQQQQQQ     Q HQQQ. D   H   .
    79   99 A C  T < 5S-     0   0   25   83   90  CCCCCC C CC CCCC CCCCCCCYYYYYYYCYYYHYYC  YCSHHYY     Y HHHH. H   H   .
    80  100 A G  T < 5S+     0   0   47   83    7  GGGGGG G GG GGGG GGGGGGGGGGGGGGGGGGGGGG  GGGGGGG     G GGGG. G   E   .
    81  101 A I      < -     0   0    8   83   33  IIIIII I II IIII IIIIIIIIIIFIIIIIIIIIII  IIIIIII     I IMII. F   F   .
    82  102 A I  E     -d   54   0B  73   83   83  IIIIII I II IIII IIIIIIIIVIIIIIAIVITTVI  TIIIITI     I ICCC. I   V   .
    83  103 A T  E     -d   55   0B  33   83   58  TTTTTT T TT TTTT TTTTTTTTTTTTTTTTTTTTTT  TATIIAT     T VVVV. V   V   .
    84  104 A H  E     -d   56   0B  26   83   20  HHHHHH H HH HHHH HHHHHHHHHHHHHHHHHHHHHH  HHHHHHH     H HHHH. H   H   .
    85  105 A H  E     +d   57   0B  55   84   13  HHHHHH H HH HHHH HHHHHHHHHHHHHHHHHHHHHH  HHHHHHH     H HHHH. H   H   .
    86  106 A H        -     0   0   16   84   68  HHHHHH H HH HHHH HHHHHHHHHHHHHHHHHHHHHH  HHHHHHH     H HHYY. H   C   .
    87  107 A P        -     0   0   64   84    4  PPPPPP P PP PPPP PPPPPPPPPPPPPPPPPPPPPP  PPPPPPP     P PPPP. P   P   .
    88  108 A I        -     0   0    3   84   36  IIIIII I II IIII IIIIIVIIIIIIIIIIIIIIII  IIIIIII     I IIIV. I   F   .
    89  109 A A    >   -     0   0   68   84   52  AAAAAA A AA AAAA AAAAAAAPPPPPPPPPPPPPPA  PPPPPPP     P PPPP. P   P   .
    90  110 A D  T 3  S+     0   0   41   85    4  DDDDDD D DD DDDD DDDDDDDDDDDDHDDDDDDDDD  DDDDDDD     D DDDDD D   D   .
    91  111 A G  T 3  S+     0   0   22   85   11  GGGGGG G GG GGGG GGGGGGGGGGGGGGGGGGGGGG  GGGGGGG     G GGGGG G   G   .
    92  112 A G  S <  S-     0   0   18   85   66  GGGGGG G GG GGGG GGGGGGGGGGGGGGGGGGGGGG  GEEDDGG     G DNNDG E   N   .
    93  113 A T        -     0   0   52   86   59  TTTTTT T TT TTTT TTTTTTTTTTTATTTTTTTTTT  TATTTTT     A TAATT A   A   T
    94  114 A P        -     0   0    7   86    0  PPPPPP P PP PPPP PPPPPPPPPPPPPPPPPPPPPP  PPPPPPP     P PPPPP P   P   P
    95  115 A D    >>  -     0   0  108   86   46  DDDDDD D DD DDDD DDDDDDDDDNDDDDDDDDDDDD  DDDDDDN     D DDDDD D   D   D
    96  116 A I  H 3> S+     0   0   38   86   44  IIIIII I II IIII IIIIIIIIIIIIVIIIIIIIII  IIIIIII     I IIIII F   I   I
    97  117 A A  H 3> S+     0   0   48   86   56  AAAAAA A AA AAAA AAAAAAAAAAAAAAAAGAAAGA  AAADDAA     A TAAAT A   A   T
    98  118 A S  H <> S+     0   0   24   86   77  SSSSSS S SS SSSS SSSCCSSSSSSSSSRSSSSSSC  NSSRRNS     S KTTNS Q   S   S
    99  119 A C  H  X S+     0   0    1   86   50  CCCCCC C CC CCCC CCCCCCCCCCCCCCCCCCCCCC  CCCCCCC     C CCCCC C   C   C
   100  120 A C  H  X S+     0   0   14   86   75  CCCCCC C CC CCCC CCCCCCCCCCCCCCCCWCCCWC  CWYCCCC     C CCCCC S   S   C
   101  121 A E  H  X S+     0   0   96   86   73  EEEEEE E EE EEEE EEEEEEEEEEEEEEEEEEEDEE  EETGGEE     E TKKKE V   T   E
   102  122 A I  H  X S+     0   0    1   86   21  IIIIII I II IIII IIIIIIIIIIIIIIIIIIVIII  IIVIIII     I IIIII I   I   I
   103  123 A M  H  X S+     0   0    0   86   16  MMMMMM M MM MMMM MMMMMMMMMMMMMMMMMMLMMM  MMMLLMM     M LLLLM L   L   M
   104  124 A E  H >X S+     0   0   96   86   37  EEEEEE E EE EEEE EEEEEEEEEEEEEEEEEEEEEE  EEEQQEE     E EEEEE N   E   E
   105  125 A E  H 3X S+     0   0   55   86   28  EEEEEE E EE EEEE EEEEEEEEEEEEEEEEEEEEEE  AEEEEAE     E EEEEE E   E   E
   106  126 A L  H 3X S+     0   0    0   86   13  LLLLLL L LL LLLL LLLLLLLLLLLLLLLLLLLLLL  LLLLLLL     L LLLLL L   M   L
   107  127 A T  H S+     0   0    5   86   61  CCCCCC C CC CCCC CCCCCCCCCCCCCCCCCCCCCC  CCCCCCC     C CCCCC S   C   C
   110  130 A L  H ><5S+     0   0    2   85   13  LLLLLL L LL LLLL LLLLLLLLLLLLLLLLLLLLL.  LLLLLLL     L LLLLL L   L   L
   111  131 A K  H 3<5S+     0   0  152   85   70  KKKKKK K KK KKKK KKKKKTKKKKKQKKKKKKKKK.  KRREEKK     Q EEEEK E   E   K
   112  132 A N  T 3<5S-     0   0   98   85   48  NNNNNN N NN NNNN NNNNNLNNNNNNNNNNNNNNN.  NNNNNNN     N TNNSN Y   N   N
   113  133 A Y  T < 5 +     0   0  170   85   75  YYYYYY Y YY YYYY YYYNNIYNNNNNNNNNNNGNN.  NNNNNNN     N NKKNN N   N   N
   114  134 A R      < -     0   0   87   85   42  RRRRRR R RR RRRR RRRRRHRRRRRRRRRRRRRRR.  RRRRRRR     R RQQRR R   R   R
   115  135 A K        -     0   0   89   84   29  KKKKKK K KK KKKK KKKKK.KKKKKKKKKKKKKKK.  KKKKKKK     K KKKKK K   K   K
   116  136 A T  E     - e   0  54B   0   85   43  TTTTTT T TT TTTT TTTTT.TTTTTTTTTTTTTTTL  TTTTTTT     T TATTT T   T   T
   117  137 A L  E     -ce  24  55B   0   85   20  LLLLLL L LL LLLL LLLLL.LLLLLLLLLLLLLLLP  LILLLLL     L LMMIL L   L   L
   118  138 A I  E     +ce  25  56B   0   85   17  IIIIII I II IIII IIIII.IIIIIIIIIIIIIIIF  IIIIIII     I IIIII I   I   I
   119  139 A H  E     - e   0  57B   0   85    9  HHHHHH H HH HHHH HHHHH.HHHHHHHHHHHHHHHQ  HHHHHHH     H HHHHH H   H   H
   120  140 A S        -     0   0    0   86    6  CCCCCC C CC CCCC CCCCCCCCCCCCCCCCCCCCCC  CCCCCCC     C CCCCC C   C   C
   121  141 A Y  S    S+     0   0   26   86   27  YYYYYY Y YY YYYY YYYYYYYYYYYYYYYYYYYYYY  YYYYYYY     Y FYYYY Y   Y   Y
   122  142 A G  S    S-     0   0   23   86    4  GGGGGG G GG GGGG GGGGGGGGGGGGGGGGGGGGGG  GRGGGGG     G GGGGG G   G   G
   123  143 A G  S    S+     0   0    2   87    3  GGGGGG G GG GGGG GGGGGGGGGGGGGGGGGGGGGG  GGGGGGG     G GGGGG G   G   G
   124  144 A L  S    S+     0   0   43   87    7  LLLLLL L LL LLLL LLLLLLLLVLLLLLLLLLLLLL  ILLLLIL     L LLLLL L   L   L
   125  145 A G  S >> S+     0   0    4   87    3  GGGGGG G GG GGGG GGGGGGGGGGGGGGGGGGGGGG  GGGGGGG     G GGGGG G   G   G
   126  146 A R  H 3> S+     0   0    2   88    6  RRRRRR R RR RRRR RRRRRRRRRRRRRRRRRRRRRR  RRRRRRR     R RRRRR R   R   R
   127  147 A S  H 3> S+     0   0    0   86   21  SSSSSS S SS SSSS SSSSSSSSSSSSSSSSSSSSSS  SSSSSSS     S SSSSS S   S   S
   128  148 A C  H <> S+     0   0    0   87   47  CCCCCC C CC CCCC CCCCCCCCCCCCCCCCCCCCCC  CCCCCCC     C CCCCC C   C   C
   129  149 A L  H  X S+     0   0    1   89   10  LLLLLL L LL LLLL LLLLLLLLLLLLLLLlLLLLLL  LLLLLLL     L LLLLL L   L   L
   130  150 A V  H  X S+     0   0    1   84   26  VVVV.V V VV VVVV VVVVVVVVVVVVVVVvVVV..V  VVVVVVV     A IVVIV I   I   V
   131  151 A A  H  X S+     0   0    0   89   15  AAAAAA A AA AAAA AAAAAAAAAAAAAAAAAAAAAA  AAAAAAA     S VAAAA A   A   A
   132  152 A A  H >X S+     0   0    0   89    6  AAAAAA A AA AAAA AAAAAAAAAAAAAAAAAAAAAA  AAAAAAA     N AAAGA A   A   A
   133  153 A C  H 3X S+     0   0    1   89    9  CCCCCC C CC CCCC CCCCCCCCCCCCCCCCCCCCCC  CCCCCCC     F CCCCC C   C   C
   134  154 A L  H 3X S+     0   0    0   89   13  LLLLLL L LL LLLL LLLLLLLLLLLLLLLLLLLLLL  LLLLLLL     L LLLLL L   L   L
   135  155 A L  H >  -     0   0   38   89   67  SSSSSS S SS SSSS PSSSSSSSSSSSSSSSSSSSSS  SSSSSSS     S EAAAS S   L   S
   144  164 A P  H 3> S+     0   0   24   89   28  PPPPPP P PP PPPP PPPPPPPPPPPPPPPPPPPPPP  PPPPPPP     P PPPPP P   P   P
   145  165 A E  H 3> S+     0   0  108   89   49  EEEEEE E EE EEEE EQEEEEEQQEEQQQQQQQQQQE  QQQQQQE     H QQQQQ Q   E   Q
   146  166 A Q  H <> S+     0   0   93   88   52  QQQQQQ   QQ QQQQ QQQQQQQQQQQQQQQQQQQQQQ  QQQQQQQ     Q EQQQQ Q   Q   Q
   147  167 A A  H  X S+     0   0    0   88   29  AAAAAA   AA AAAA AAAAAAAAAAAAAAAAAAAAAA  AAAAAAA     Y AVVAA A   I   A
   148  168 A I  H  X S+     0   0    4   88   14  IIIIII   II IIII IIIIIIIIIIIIIMIIIMIIII  IIIIIII     K IIIII L   I   I
   149  169 A D  H  X S+     0   0   77   88   51  DDDDDD   DD DDDD DDDDDDDDDDDDDDDDDDDDDD  DDDDDDD     S EEEDD D   E   D
   150  170 A S  H  X S+     0   0    6   88   83  SSSSSS   SS SSSS SSSSSSSSSSSSSSSSSSSSSS  STTSSSS     A TSSSS S   L   S
   151  171 A L  H  X>S+     0   0    0   88   22  LLLLLL   LL LLLL LLLLLLLLLLLLLLLLLLLLLL  LLLLLLL     V LLLLL L   L   L
   152  172 A R  H  X5S+     0   0   48   88   22  RRRRRR   RR RRRR RRRRRRRRRRRRRRRRRRRRRR  RKRRRRR     C RRRRR R   R   R
   153  173 A D  H  <5S+     0   0  137   88   37  DDDDDD   DD DDDD DDDDDDDDDDDDGDDDDDDDDD  DDDDDDD     N DNNND D   D   D
   154  174 A L  H  <5S+     0   0   35   88   40  LLLLLL   LL LLLL LLLLLLLLLLLLLLLLVLVVVL  LVVLLLL     L LLLLL L   L   L
   155  175 A R  H  <5S-     0   0   62   88    6  RRRRRR   RR RRRR RRRRRRRRRRRRRRRRRRRRRR  RRRRRRR     n RRRRR R   R   R
   156  176 A G    ><< -     0   0   33   86    7  GGGGGG   GG GGGG GGGGGGGGGGGGGGGGGGGGGG  GGGGGGG     s GGGGG G   G   G
   157  177 A S  T 3  S+     0   0   80   87   58  SSSSSS   SS SSSS SSSSSSSSSSSSSSSSSSSSSS  SSSSSSS     A SSSSS P   S   S
   158  178 A G  T 3   +     0   0   16   87   45  GGGGGG   GG GGGG GGGGGGGGGGGGGGGGGGGGGG  GGGGGGG     A GGGGG G   G   G
   159  179 A A  S <  S+     0   0    0   88    2  AAAAAA   AA AAAA AAAAAAAAAAAAAAAAAAAAAA  AAAAAAA     V AAAAA A   A   A
   160  180 A I  S    S+     0   0    1   88    5  IIIIII   II IIII IIIIIIIIIIIIIIIIIIIIII  IIIIIII     Q IIIII I   I   I
   161  181 A Q        +     0   0   20   88   11  QQQQQQ   QQ QQQQ QQQQQQQQQQQQQQQQQQQQQQ  QQQQQQQ     K QQQQQ Q   Q   Q
   162  182 A T  S  > S-     0   0   21   88   21  TTTTTT   TT TTTT TTTTTTTTTTTTTTTTTTTTTT  TTTTTTT     I TTTTT T   T   T
   163  183 A I  H  > S+     0   0    0   88   37  IIIIII   II IIII IIIIIIIIIIIIIIIIIIIIII  IIIIIIV     F IIIII I   V   I
   164  184 A K  H  > S+     0   0   65   88   20  KKKKKK   KK KKKK KKKKKKKKKKKKKKKKKKKKKK  KKKKKKK     E KKKKK K   K   K
   165  185 A Q  H  > S+     0   0   10   85    0  QQQDQQ   QQ QQQQ QQQQQQQQQQQQQQQQQ QQQQ  QQQQQQQ     Q QQQ Q Q   Q   Q
   166  186 A Y  H  X S+     0   0   39   84   24  YYY YY   YY YYYY YYYYYYYYYYYYYYYYY YYYY  YYYYYYY     Y YYY Y Y   Y   Y
   167  187 A N  H  X S+     0   0    8   84   14  NNN NN   NN NNNN NNNNNSNNNNNNNNNNN NNNN  NNNNNNN     N NNN N N   N   N
   168  188 A Y  H >X S+     0   0   20   84    4  YYY YY   YY YYYY YYYYYYYYYYYYYYYYY YYYY  YYYYYYY     Y YFF Y Y   F   Y
   169  189 A L  H >X S+     0   0    1   84   19  LLL LL   LL LLLL LLLLLLLLLLLLLLLLL LLLL  LLLLLLL     L LLL L L   L   L
   170  190 A H  H 3< S+     0   0   72   84   27  HHH HH   HH HHHH HHHHHHHHHHHHHHHHH HHHH  HHHHHHH     H HHH H H   H   H
   171  191 A E  H  S+     0   0  118   83   40  DDD DD   DD DDDD DDDDDDDDDDDDEDDDD DDDD  DDDDDDD     D EEE D E   E   D
   175  195 A K  H  < S+     0   0   92   81   54  KKK KK   KK KKKK KKKKKIKKKKKKKKKKK KKKK  KKKKKKK     K NNK K I   R   K
   176  196 A L  H >< S+     0   0   43   79   52  LLL LL   LL LLLL LLLLLLLLLLLLLLLLL LLLL  LLLLLLL     L LLL L L   M   L
   177  197 A A  H 3< S+     0   0   61   78   41  AAA AA   AA AAAA AAAAAAAAAAAAAAAAA AAAA  ADDAAAA     A AAA A A   A   A
   178  198 A A  T >< S+     0   0   57   78   43  AAA AA   AA AAAA AAAAAAAAAAAAAVAAA AAAA  AVAAAAA     A AAA A T   T   A
   179  199 A H  T <   +     0   0   85   78   52  HHH HH   HH HHHH HHHYYHHHHHHHHHHHY HYYY  HYYHHHH     H HHH H H   H   H
   180  200 A L  T 3   +     0   0  131   74   46  LLL LL   LL LLLL LLLLLLLLLLLLLLLLL LLLL  LLLLLLL     L LLL L M   L   L
   181  201 A S    <   +     0   0   82   73   63  SSS SS   SS SSSS SSSSSSSSSSSSSSSSS VSSS  SSSSSSS     S SAA S     A   S
   182  202 A S              0   0  120   72   57  SSS SS   SS SSSS SSSSSSSSSSSSSSSSS SSSS  SSSTTSS     S TTT S     A   S
   183  203 A R              0   0  282   67   29  RRR RR   RR RRRK KRRRRRRR RRRRRRRR RRRR  RRRRRRR     R KKR R     K   R
   184      ! !              0   0    0   0     0  
   185    1 B M              0   0  221  130    9        M M  M    M                      MM       MMMMM M     M M M  ML 
   186    2 B E        -     0   0  105  150   38        E E  E    E                      DD       EEDDE D     D DEE  DE 
   187    3 B N  S    S+     0   0   43  157   69        N N  N    N                      SA       NVVVN S     R QKD  QN 
   188    4 B F  B     -G  207   0D  42  158    2        F F  F    F                      FF       FFFFF F     Y YFY  YF 
   189    5 B Q        -     0   0   79  158   54        Q Q  Q    Q                      QQ       QQQQQ Q     E EHV  ES 
   190    6 B K        +     0   0  106  158   47        K K  K    K                      KK       KKKKK K     K KKK  KR 
   191    7 B V        +     0   0   77  158   35        V V  V    V                      VV       VVVVV V     I VLI  VV 
   192    8 B E        -     0   0  116  158   22        E E  E    E                      EE       EEEEE E     E EEE  EE 
   193    9 B K  E     +I  203   0E  98  158   30        K K  K    K                      KK       KKKKK K     K KKK  KR 
   194   10 B I  E     -     0   0E  32  158   17        I I  I    I                      II       IIIII I     I III  II 
   195   11 B G  E     -I  202   0E  23  159    5        G G  G    G                      GG       GGGGG G     G GGG  GG 
   196   12 B E        +     0   0  129  159   13        E E  E    E                      EE       EEEEE E     E EEE  EE 
   197   13 B G        -     0   0   50  162    0        G G  G    G                      GG       GGGGG G     G GGG GGG 
   198   14 B T  S    S-     0   0  141  162   11        T T  T    T                      TT       TTTTT T     T TTT TTT 
   199   15 B Y  S    S+     0   0   59  162    0        Y Y  Y    Y                      YY       YYYYY Y     Y YYY YYY 
   200   16 B G        -     0   0   20  162    5        G G  G    G                      GG       GGGGG G     G GGG GGG 
   201   17 B V        -     0   0   10  162   60        V V  V    V                      VV       VVVVV V     T VVV VVV 
   202   18 B V  E     -I  195   0E  40  162    0        V V  V    V                      VV       VVVVV V     V VVV VVV 
   203   19 B Y  E     -I  193   0E  49  162    2        Y Y  Y    Y                      YY       YYYYY Y     Y YYY YYY 
   204   20 B K        +     0   0   76  162    6        K K  K    K                      KK       KKKKK K     K KKK KKK 
   205   21 B A        -     0   0    1  162   21        A A  A    A                      AA       AAAAA A     A AAG GAA 
   206   22 B R        -     0   0  133  162   51        K K  K    K                      KK       KRKRR K     K RKR RRK 
   207   23 B N  B  >  -GH 188 211D  45  162   44        N N  N    N                      NH       NNNNN N     L DEN NDD 
   208   24 B K  T  4 S+     0   0  112  161   76        K K  K    K                      KK       KKKKK K     I KKK KKN 
   209   25 B L  T  4 S-     0   0  132  162   86        L L  V    L                      VV       LQEEL A     T VGK KVV 
   210   26 B T  T  4 S-     0   0   98  162   53        T T  T    T                      TT       TTTTT T     S TST STS 
   211   27 B G  B  <  +H  207   0D   7  162   55        G G  G    G                      GG       GGGGG G     G NGG GNN 
   212   28 B E        -     0   0  148  159   62        E E  E    E                      EE       EQQQE Q     E ERL REE 
   213   29 B V        -     0   0   95  142   49        V V  V    V                      TT       VLLLV L     L TPT LTM 
   214   30 B V        -     0   0    9  161   26        V V  V    V                      VV       VVVVV V     V IIV VIV 
   215   31 B A        -     0   0   12  162    8        A A  A    A                      AA       AAAAA A     A AAA AAA 
   216   32 B L        -     0   0   12  162   17        L L  L    L                      LL       LLLLL L     L LLL LLL 
   217   33 B K        -     0   0   23  162   11        K K  K    K                      KK       KKKKK K     K KKK KKK 
   218   34 B K        +     0   0   12  162   19        K K  K    K                      KK       KKKKK K     K KKK KKR 
   219   35 B I        -     0   0   12  162   37        I I  I    I                      II       IIIII I     I IFI III 
   220   36 B R        +     0   0  100  162   20        R R  R    R                      RR       RRRRR R     K RRR RRR 
   221   37 B L        -     0   0   33  162   32        L L  L    L                      LL       LLLLL L     L LLL LLL 
   222   38 B D        -     0   0   96  162   36        D D  D    D                      DE       DDDDD D     E EEE EED 
   223   39 B T  S    S+     0   0   75  161   78        T T  T    T                      TT       TSLL. A     T QSS SQT 
   224   40 B E  S    S+     0   0  158  161   30        E E  E    E                      EE       EEEE. E     E EEE EEE 
   225   41 B T  S    S-     0   0   43  161   36        T T  T    T                      TT       TTTT. T     E DSE EDA 
   226   42 B E  S    S-     0   0   70  160   11        E E  E    E                      EE       EEEE. E     E EEE EED 
   227   43 B G  S    S-     0   0   77  160    1        G G  G    G                      GG       GGGG. G     G GGG GGG 
   228   44 B V  S    S-     0   0   85  160   22        V V  V    V                      VV       VVVV. V     V VVV VVV 
   229   45 B P     >  -     0   0   26  160    7        P P  P    P                      PP       PPPP. P     P PPP PPP 
   230   46 B S  H  >> +     0   0   87  160   38        S S  S    S                      SS       SSSS. S     S SSS SSS 
   231   47 B T  H  45S+     0   0   56  160   27        T T  T    T                      TT       TTTT. T     T TTT TTT 
   232   48 B A  H  >>S+     0   0    1  160   19        A A  A    A                      AA       AAAA. A     A AAA AAT 
   233   49 B I  H  X5S+     0   0  106  161   19        I I  I    I                      II       IIII. I     I III III 
   234   50 B R  H  X5S+     0   0   38  161    1        R R  R    R                      RR       RRRR. R     R RRR RRR 
   235   51 B E  H  >X   -     0   0   25  160   36        H H  H    H                      HH       HHHH. H     H HHH HHH 
   245   61 B P  T 3  S+     0   0   91  160   63        P P  P    P                      PP       PPPP. P     R SPP PSL 
   246   62 B N  T 3  S+     0   0   11  160   20        N N  N    N                      NN       NNNN. N     N NNN NNN 
   247   63 B I  S <  S-     0   0    2  160   12        I I  I    I                      II       IIII. I     V IVI III 
   248   64 B V        -     0   0    9  160    3        V V  V    V                      VV       VVVV. V     V VVV VVV 
   249   65 B K        -     0   0  116  161   55        K K  K    K                      KK       KRRRT K     R KRN CKK 
   250   66 B L        -     0   0   17  162    9        L L  L    L                      LL       LLLLL L     L LLL LLL 
   251   67 B L        -     0   0   68  162   78        L L  L    L                      RR       LLLLL L     I QLQ EQL 
   252   68 B D        -     0   0   86  162   27        D D  D    D                      DD       DDDDD D     E DDD DDD 
   253   69 B V        -     0   0   39  162   15        V V  V    V                      VV       VVVVV V     V VVV VVI 
   254   70 B I  B     -J  261   0F  27  162   54        I I  I    I                      II       IVVVI V     I VVL LVI 
   255   71 B H        +     0   0  160  162   64        H H  H    H                      HH       HHHHH H     H HPM MHH 
   256   72 B T        -     0   0   56  162   75        T T  T    T                      TT       TSSNT R     S SCQ QST 
   257   73 B E  S    S+     0   0  161  162   40        E E  E    E                      EE       EEEEE E     E EEE EED 
   258   74 B N  S    S-     0   0   86  162   71        N N  N    N                      NN       NKKKN K     H KKS NKN 
   259   75 B K  S    S-     0   0   48  161   59        K K  K    K                      KK       KKKKK K     D RKK KRK 
   260   76 B L        -     0   0   26  161   13        L L  L    L                      LL       LLLLL L     L LLL LLL 
   261   77 B Y  B     -J  254   0F  23  161   53        Y Y  Y    Y                      YY       YYYYY Y     H YYY YYF 
   262   78 B L        -     0   0    0  162    5        L L  L    L                      LL       LLLLL L     L LLL LLL 
   263   79 B V        -     0   0   10  162    7        V V  V    V                      VV       VVVVV V     V VVV VVV 
   264   80 B F        -     0   0   20  162    4        F F  F    F                      FF       FFFFF F     F FFF FFF 
   265   81 B E        -     0   0   55  162    2        E E  E    E                      EE       EEEEE E     E EEE EEE 
   266   82 B F        +     0   0   40  162   23        F F  F    F                      FF       FFFFF F     F YYF FYF 
   267   83 B L        -     0   0   30  162   43        L L  L    L                      LL       LLLLL L     L LML LLL 
   268   84 B H  S    S-     0   0   89  162   42        H H  H    H                      HH       HSSSH T     D DTT SDN 
   269   85 B Q  E     -K  319   0G  36  162   76        Q Q  Q    Q                      QQ       QQQQQ Q     C LDM MLQ 
   270   86 B D  E  >  -K  318   0G  20  162    2        D D  D    D                      DD       DDDDD D     D DDD DDD 
   271   87 B L  H  > S+     0   0    0  162    2        L L  L    L                      LL       LLLLL L     L LLL LLL 
   272   88 B K  H  > S+     0   0   84  162   26        K K  K    K                      KK       KKKKK K     K KKK KKK 
   273   89 B K  H  > S+     0   0   67  162   34        K K  K    K                      KK       KKKKK K     K KKK RKK 
   274   90 B F  H  < S+     0   0    9  162   40        F F  F    F                      FF       FYYYF H     H HHY YHY 
   275   91 B M  H  < S+     0   0   11  162   28        M M  M    M                      MM       MMMMM M     M MMM MMM 
   276   92 B D  H >< S+     0   0   89  162   32        D D  D    D                      DD       DDDDD D     E DDD DDE 
   277   93 B A  T 3< S+     0   0   82  162   67        A A  A    A                      SS       ASSSA S     V SKS TSS 
   278   94 B S  T >> S+     0   0   22  162   87        S S  S    S                      SS       SAATS A     S SAI ISY 
   279   95 B A  T <4 S+     0   0   48  162   67        A A  A    A                      ST       AAPPA P     R PAP PPE 
   280   96 B L  T 34 S+     0   0  160  162   83        L L  L    L                      VV       LAAAL T     Q DHS NDN 
   281   97 B T  T <4 S-     0   0  122  162   83        T T  T    T                      TT       TTSST S     L Fgg gFk 
   282   98 B G     <  -     0   0   14  122   78        G G  G    G                      GG       GEEQG E     . Sly fSg 
   283   99 B I        -     0   0   21  157   44        I L  I    I                      II       LLLLI L     . KLM MKL 
   284  100 B P     >  -     0   0   67  162   62        P P  P    P                      PP       PPPPP P     A DGD DDP 
   285  101 B L  H  > S+     0   0  104  162   85        L L  L    L                      LL       LLLML L     P LPS KLL 
   286  102 B P  H  > S+     0   0   63  162   82        P P  P    P                      PP       PHHHP H     D HKM MHN 
   287  103 B L  H  > S+     0   0    1  162   60        L L  L    L                      LL       LLLLL V     L MLL LML 
   288  104 B I  H >X S+     0   0    5  162   28        I I  I    I                      VV       IVVVI V     V IVV VIV 
   289  105 B K  H 3X S+     0   0   34  162   19        K K  K    K                      KK       KKKKK K     R KKK KKK 
   290  106 B S  H 3X S+     0   0    3  162   60        S S  S    S                      SS       SSSSS S     S TSS SRS 
   291  107 B Y  H X S+     0   0    0  162   24        L L  L    L                      LL       LLLLL L     L LLL LVL 
   293  109 B F  H 3X S+     0   0   49  162   55        F F  F    F                      FF       FFLFF S     F YWY YYF 
   294  110 B Q  H 3X S+     0   0   22  162    3        Q Q  Q    Q                      QQ       QQQQQ Q     Q QQQ QQQ 
   295  111 B L  H X S+     0   0    3  162   30        L L  L    L                      LL       LVVVL L     I III III 
   300  116 B A  H 3X S+     0   0   12  162   78        A A  A    A                      AA       ANNNA N     E AAT LAA 
   301  117 B F  H 3< S+     0   0   45  162   23        F F  F    F                      FF       FFFFF F     F YYF FYY 
   302  118 B C  H X<>S+     0   0    2  162   35        C C  C    C                      CC       CCCCC C     C CCC CCC 
   303  119 B H  H ><5S+     0   0   21  162    1        H H  H    H                      HH       HHHHH H     H HHH HHH 
   304  120 B S  T 3<5S+     0   0   79  162   63        S S  S    S                      SS       SSSSS C     T SAS QST 
   305  121 B H  T < 5S-     0   0   62  162   44        H H  H    H                      HH       HHHHH H     H HHR RHH 
   306  122 B R  T < 5S+     0   0  164  162   42        R R  R    R                      RR       RRRRR R     R RRR RRR 
   307  123 B V  E   < -M  335   0H   2  162   14        V V  V    V                      VV       VVVVV V     I VIV VVI 
   308  124 B L  E     -M  334   0H   0  162   13        L L  L    L                      LL       LIIIL I     L LLL LLL 
   309  125 B H        +     0   0    2  162    2        H H  H    L                      HH       HHHHH H     H HHH HHH 
   310  126 B R        +     0   0   51  162    2        R R  R    Q                      RR       RRRRR R     R RRR RRR 
   311  127 B D        +     0   0   22  162    0        D D  D    D                      DD       DDDDD D     D DDD DDD 
   312  128 B L        +     0   0    4  162    1        L L  L    L                      LL       LLLLL L     L LLL LLL 
   313  129 B K  S >  S-     0   0   28  162    0        K K  K    K                      KK       KKKKK K     K KKK KKK 
   314  130 B P  G >  S+     0   0    4  162    1        P P  P    P                      PP       PPPPP P     P PPP PPP 
   315  131 B Q  G 3  S+     0   0   94  162   20        Q Q  Q    Q                      QQ       QQQQQ Q     Q QQQ QQQ 
   316  132 B N  G <  S+     0   0    9  162    0        N N  N    N                      NN       NNNNN N     N NNN NNN 
   317  133 B L  E <   - L   0 327G   0  162   13        L L  L    L                      LL       LLLLL L     L LLL LLL 
   318  134 B L  E     -KL 270 326G  36  162    0        L L  L    L                      LL       LLLLL L     L LLL LLL 
   319  135 B I  E     -KL 269 325G   0  162   16        I I  I    I                      II       IIIII I     I III IIL 
   320  136 B N    >   -     0   0   25  162   46        N N  N    N                      NN       NNNSN N     D DDD DDS 
   321  137 B T  T 3  S+     0   0   70  162   68        T A  A    A                      AA       AEEET E     S RPN NRA 
   322  138 B E  T 3  S-     0   0   89  158   70        E E  E    D                      QQ       ELLRE F     D RNK KRD 
   323  139 B G  S <  S+     0   0    0  161   37        G G  G    G                      GG       GGGGG G     G TGG GTG 
   324  140 B A        -     0   0   14  162   79        A S  A    S                      EE       SAAAS A     N nNI VnL 
   325  141 B I  E     -L  319   0G   1  161   27        I I  I    I                      II       IIIII I     I lII IlI 
   326  142 B K  E     -L  318   0G  36  162    2        K K  K    K                      KK       KKKKK K     K KKK KKK 
   327  143 B L  E     +L  317   0G   4  162   20        L L  L    L                      LL       LLLLL L     I LLL LLL 
   328  144 B A        +     0   0   14  162   13        A A  A    A                      AA       AAAAA A     A AAA AAA 
   329  145 B D    >   +     0   0   44  162    0        D D  D    D                      DD       DDDDD D     D DDD DDD 
   330  146 B F  G >   +     0   0    1  162    4        F F  F    F                      FF       FFFFF F     F FFF FFF 
   331  147 B G  G 3  S+     0   0   13  162    0        G G  G    G                      GG       GGGGG G     G GGG GGG 
   332  148 B L  G <  S+     0   0   73  162    1        L L  L    L                      LL       LLLLL L     L LLL LLL 
   333  149 B A    <   +     0   0    0  162   14        A A  A    A                      AA       AAAAA A     A AAA AAA 
   334  150 B R  E     -M  308   0H  96  162    0        R R  R    R                      RR       RRRRR R     R RRR RRR 
   335  151 B A  E     -M  307   0H  56  162   34        A A  A    A                      AA       AAAAA A     A AAA AAA 
   336  152 B F  S    S+     0   0   74  162    5        F F  F    F                      FF       FFFFF F     F FFF FFF 
   337  153 B G        +     0   0   50  162   43        G G  G    G                      GG       GGGGG G     G GGG GGG 
   338  154 B V  B     -N  364   0I  28  160   29        V V  V    V                      VV       VVVVV V     I ILI IIV 
   339  155 B P        -     0   0   72  162   23        P P  P    P                      PP       PPPPP P     P PPP PPP 
   340  156 B V        +     0   0   42  162   42        V V  V    V                      VV       VLLLV M     V VLV VVV 
   341  157 B R        -     0   0  158  158   40        R R  R    R                      RR       RRRRR R     R RRR RRR 
   342  158 B T        -     0   0   51  161   73        T T  T    T                      AT       TTTTT T     A TTV VTT 
   343  159 B Y    >   -     0   0   63  162   23        Y Y  Y    Y                      YY       YYYYY Y     Y FYY YFF 
   344  160 B X  T 3  S+     0   0   15  162   26        T T  T    T                      TT       TTTTT T     T TTT TTT 
   345  161 B H  T 3  S+     0   0   63  162   42        H H  H    H                      HH       HHHHH H     H HHH HHH 
   346  162 B E    <   +     0   0   76  162   26        E E  E    E                      EE       EEEEE E     E EEE EEE 
   347  163 B V        +     0   0   72  162    8        V V  V    V                      VV       VVVVV V     V VVV VVV 
   348  164 B V        -     0   0   78  162    9        V V  V    V                      VV       VVVVT V     V VVV VVV 
   349  165 B T        -     0   0   62  161    2        T T  T    T                      TT       TTTT. T     T TTT TTT 
   350  166 B L    >   +     0   0   15  161    6        L L  L    L                      LL       LLLL. L     L LLL LLL 
   351  167 B W  T 3  S+     0   0   88  161    0        W W  W    W                      WW       WWWW. W     W WWW WWW 
   352  168 B Y  T 3  S+     0   0   35  161    0        Y Y  Y    Y                      YY       YYYY. Y     Y YYY YYY 
   353  169 B R    <   -     0   0   73  161    0        R R  R    R                      RR       RRRR. R     R RRR RRR 
   354  170 B A    >>  -     0   0    1  161   24        A A  A    A                      AA       AAAA. A     A AAA AAA 
   355  171 B P  H 3> S+     0   0    0  161    1        P P  P    P                      PP       PPPP. P     P PPP PPP 
   356  172 B E  H 34 S+     0   0    8  161   10        E E  E    E                      EE       EEEE. E     E EEE EEE 
   357  173 B I  H X4 S+     0   0   15  161   18        I I  I    I                      II       IIII. I     I IIV III 
   358  174 B L  H 3< S+     0   0    3  161    1        L L  L    L                      LL       LLLL. L     L LLL LLL 
   359  175 B L  T 3< S-     0   0    0  161    6        L L  L    L                      LL       LLLL. L     L LLL LLL 
   360  176 B G    <   +     0   0    7  161   11        G G  G    G                      GG       GGGG. G     G GGG GGG 
   361  177 B C        -     0   0   26  161   52        C C  C    C                      CC       CCSC. S     A SAG SST 
   362  178 B K  S    S-     0   0  122  161   62        K K  K    K                      KK       KKKK. K     R HKA QHR 
   363  179 B Y  S    S-     0   0  142  154   79        Y Y  Y    Y                      YY       YFFF. F     Q HFR RHY 
   364  180 B Y  B     -N  338   0I  48  161    0        Y Y  Y    Y                      YY       YYYY. Y     Y YYY YYY 
   365  181 B S    >   -     0   0   46  161   34        S S  S    S                      SS       SSSS. S     A SSS SSS 
   366  182 B T  T 3> S+     0   0   41  161   32        T T  T    T                      TT       TTTT. T     C TTT TTT 
   367  183 B A  T 34 S+     0   0    7  161   53        A A  A    A                      AA       AAAA. A     P PPP PPE 
   368  184 B V  T X> S+     0   0   11  161   12        V V  V    V                      VV       VVVV. V     V VVI VVV 
   369  185 B D  H 3> S+     0   0    0  161    0        D D  D    D                      DD       DDDD. D     D DDD DDD 
   370  186 B I  H 3< S+     0   0    2  161   35        I I  I    I                      II       IVVV. V     I IVI III 
   371  187 B W  H <> S+     0   0    1  161    0        W W  W    W                      WW       WWWW. W     W WWW WWW 
   372  188 B S  H  X S+     0   0    6  161    9        S S  S    S                      SS       SSSS. S     S SSS SSS 
   373  189 B L  H  X S+     0   0    7  161   42        L L  L    L                      LL       LIIV. I     I VII VVI 
   374  190 B G  H >> S+     0   0    0  161    3        G G  G    G                      GG       GGGG. G     G GGG GGA 
   375  191 B C  H 3X S+     0   0    0  161   23        C C  C    C                      CC       CCCC. C     C CCT CCG 
   376  192 B I  H 3X S+     0   0    0  161    0        I I  I    I                      II       IIII. I     I III III 
   377  193 B F  H XX S+     0   0    0  161   12        F F  F    F                      FF       FFFF. F     F FFF FFF 
   378  194 B A  H 3X S+     0   0    1  161    9        A A  A    A                      AA       AAAA. A     A AAA AAS 
   379  195 B E  H 3X S+     0   0   13  161    0        E E  E    E                      EE       EEEE. E     E EEE EEE 
   380  196 B M  H << S+     0   0    2  161    8        M M  M    M                      MM       MMMM. M     M MMM MMM 
   381  197 B V  H  < S+     0   0    5  161   71        V V  V    V                      VV       hVVV. V     V IHA MIA 
   382  198 B T  H  < S-     0   0   17  160   71        T T  T    T                      TT       tTTT. T     T STT TST 
   383  199 B R  S  < S+     0   0  102  161   67        R R  R    R                      RR       RRRRR G     T QLK KQH 
   384  200 B R  S    S-     0   0  173  161   52        R R  R    R                      RR       RRRKR K     R KKR RKK 
   385  201 B A        -     0   0   31  161   27        A A  A    A                      AA       AAAAA P     P PAP PPV 
   386  202 B L  S    S+     0   0   32  161    9        L L  L    L                      LL       LLLLL L     L LLL LLL 
   387  203 B F  S    S-     0   0    4  161    5        F F  F    F                      FF       FFFFF F     F FFF FFF 
   388  204 B P        -     0   0   32  161   49        P P  P    P                      PP       PPPPP P     P PPH HPK 
   389  205 B G        +     0   0   11  161    6        G G  G    G                      GG       GGGGG G     G GGG GGG 
   390  206 B D  S    S+     0   0   57  161   47        D D  D    D                      DD       DDDDD D     D DDD DDD 
   391  207 B S  S >> S-     0   0    2  161   37        S S  S    S                      SS       SSSSS S     S SSS SSS 
   392  208 B E  H 3> S+     0   0   26  161   32        E E  E    E                      EE       EEEEE E     E EEE EEE 
   393  209 B I  H 3> S+     0   0   14  161   54        I I  I    I                      II       IIIII I     I III III 
   394  210 B D  H <> S+     0   0   42  161   18        D D  D    D                      DD       DDDDD D     D DDD DDD 
   395  211 B Q  H  X S+     0   0    0  161   20        Q Q  Q    Q                      QQ       QQQQQ Q     E QQQ QQQ 
   396  212 B L  H >X S+     0   0    0  161   16        L L  L    L                      LL       LLLLL L     L LLL LLL 
   397  213 B F  H 3X S+     0   0   32  161   69        F F  F    F                      FF       FFFFF F     F FFF FFF 
   398  214 B R  H 3X S+     0   0   86  161   46        R R  R    R                      RR       RRRRR R     R KRR RKQ 
   399  215 B I  H   -     0   0   83  157   61        D D  D    D                      DD       DSSSD S     N YDT TTD 
   408  224 B E  T  4 S+     0   0   80  157   23        E E  E    E                      EE       EEEEE E     E EEE DEE 
   409  225 B V  T  4 S+     0   0  124  158   64        V V  T    V                      TT       VAAAV A     H DDD EDK 
   410  226 B V  T  4 S+     0   0   51  159   76        V V  V    V                      VV       VTMTV T     V TSI TTV 
   411  227 B W  S >< S-     0   0   10  161    4        W W  W    W                      WW       WWWWW W     W WWW WWW 
   412  228 B P  T 3  S+     0   0   82  161   13        P P  P    P                      PP       PPPPP P     P PPP PPP 
   413  229 B G  T 3  S+     0   0   31  162   44        G G  G    G                      GG       GGGGG G     G GGG GGG 
   414  230 B V    X   +     0   0    0  162   37        V V  V    V                      VV       VVVVV V     V VVV VVV 
   415  231 B T  T 3  S+     0   0   73  162   66        T T  T    T                      TT       TTTTT S     S TTT TTS 
   416  232 B S  T 3  S+     0   0   89  159   77        S S  S    S                      SS       SQQQS Q     E SQQ SSR 
   417  233 B M  S X  S-     0   0   23  159   29        M M  M    M                      ML       MLLLM L     L LLM LLL 
   418  234 B P  T 3  S+     0   0   62  159   37        P P  P    P                      PP       PPPPP P     P PPP PPP 
   419  235 B D  T 3  S+     0   0   21  162   34        D D  D    D                      DD       DDDDD D     D DDD DDD 
   420  236 B Y    <   -     0   0   28  162   11        Y Y  Y    Y                      YY       YYYYY F     F YYY YYF 
   421  237 B K    >   -     0   0   46  162   56        K K  K    K                      KK       KKKKK Q     K KKK KKK 
   422  238 B P  T 3  S+     0   0   98  162   71        P P  A    P                      PP       PGGGP D     T SPP PSS 
   423  239 B S  T 3   +     0   0   91  162   85        S S  S    S                      TS       SSSSS S     T ASS TAT 
   424  240 B F  S <  S-     0   0    8  121    7        F F  F    F                      FF       FFFFF F     F FFF FFF 
   425  241 B P        -     0   0   47  151   15        P P  P    P                      PP       PPPPP P     P PPP PPP 
   426  242 B K        -     0   0  158  154   67        K K  K    K                      KK       KKKKK R     Q KRS NKN 
   427  243 B W        -     0   0   64  155   20        W W  W    W                      WW       WWWWW W     W WWW WWW 
   428  244 B A        -     0   0   91  161   77        A A  A    A                      AA       ATTTA T     K KEK KKQ 
   429  245 B R        -     0   0  116  151   71        R R  R    R                      RR       RRRRR R     R PPT TPR 
   430  246 B Q        -     0   0   77  156   72        Q Q  Q    Q                      QQ       QKKRQ R     Q TQn NTQ 
   431  247 B D    >>  -     0   0   86  155   74        D D  D    D                      DE       DSGGD G     D DSq QDK 
   432  248 B F  H 3> S+     0   0   19  161   47        F F  F    F                      LL       FILLF L     L LLL LLL 
   433  249 B S  H 34 S+     0   0   77  161   78        S S  S    S                      SS       SEEES E     A ETK AES 
   434  250 B K  H <4 S+     0   0   98  162   78        K K  K    K                      KK       KEEEK E     K SKT SSL 
   435  251 B V  H  < S-     0   0   16  161   73        V V  V    V                      VV       VIIIV I     L FLS AFF 
   436  252 B V    ><  +     0   0    0  162   51        V V  V    V                      VA       VVVVV V     V VVV VVN 
   437  253 B P  T 3  S+     0   0   61  162   53        P P  P    P                      PP       PPPPP P     P PPK QPP 
   438  254 B P  T 3  S+     0   0   59  162   74        P P  P    P                      LL       PSGDP S     G NGN RNQ 
   439  255 B L  S <  S-     0   0   18  162   32        L L  L    L                      LL       LLLLL L     L LLM LLL 
   440  256 B D        -     0   0   77  162   43        D D  D    D                      DD       DDEED G     D DDD DDN 
   441  257 B E  S    S+     0   0  150  162   67        E E  E    E                      EE       EPPPE P     P PPD NPE 
   442  258 B D  S >> S+     0   0   52  162   79        D D  D    D                      DD       DEEED E     T DDQ TNE 
   443  259 B G  H 3> S+     0   0    0  162   15        G G  G    G                      GG       GGGGG G     G GGA GGG 
   444  260 B R  H 34 S+     0   0   53  162   64        R R  R    R                      RR       RKKKR K     L VEL LIL 
   445  261 B S  H <> S+     0   0   38  162   29        S S  S    S                      EE       SDDDS D     D DDD DDD 
   446  262 B L  H >X S+     0   0    1  162    1        L L  L    L                      LL       LLLLL L     L LLL LLL 
   447  263 B L  H 3X S+     0   0    0  162    7        L L  L    L                      LL       LLLLL L     L LIL LLL 
   448  264 B S  H 34 S+     0   0   40  161   78        S S  S    S                      GG       SM VS L     E SLQ QST 
   449  265 B Q  H X< S+     0   0   74  161   69        Q Q  Q    Q                      EE       QQ QQ H     Q KKK QKK 
   450  266 B M  H 3< S+     0   0    1  161   28        M M  M    M                      MM       ML LM L     M MLT MML 
   451  267 B L  T 3< S+     0   0    8  161    8        L L  L    L                      LL       LL LL L     L LLL LLL 
   452  268 B H    <   -     0   0   47  161   85        H H  H    H                      NK       HQ QH Q     R LII ILV 
   453  269 B Y  S    S+     0   0    7  161   37        Y Y  Y    Y                      YY       YY YY Y     Y MAY YMY 
   454  270 B D    >>  -     0   0   13  161   34        D D  D    D                      DD       DD DD D     A DDD DDR 
   455  271 B P  T 34 S+     0   0   35  161    4        P P  P    P                      PP       PP PP P     P PPP PPP 
   456  272 B N  T 34 S+     0   0  126  161   75        N N  N    N                      NN       NN SN S     S TEA ATE 
   457  273 B K  T <4 S+     0   0  118  161   70        K K  K    K                      KK       KR QK Q     A KAN NKD 
   458  274 B R  S  < S-     0   0   11  161    1        R R  R    R                      RR       RR RR R     R RRR RRR 
   459  275 B I        -     0   0   18  161   17        I I  I    I                      LL       II II I     I III IIL 
   460  276 B S     >  -     0   0   73  161   38        S S  S    S                      SS       SS SS S     S NPS SNT 
   461  277 B A  H  > S+     0   0    5  161    5        A A  A    A                      AA       AA AA A     A AAA AAA 
   462  278 B K  H  > S+     0   0  168  161   58        K K  K    K                      KK       KK KK K     T RIK KRK 
   463  279 B A  H  > S+     0   0   50  161   71        A A  A    A                      NN       AA AA T     R AQA KAA 
   464  280 B A  H  < S+     0   0    1  161   16        A A  A    A                      AA       AA AA A     A AAA AAA 
   465  281 B L  H  < S+     0   0   45  161   39        L L  L    L                      LL       LL LL L     L LLL LLL 
   466  282 B A  H  < S+     0   0   69  161   81        A A  A    A                      VV       AT AA A     R EKI NES 
   467  283 B H  S >< S-     0   0   16  161    4        H H  H    H                      HH       HH HH H     H HHH HHH 
   468  284 B P  G >  S+     0   0   74  161   39        P P  P    P                      RR       PH PP P     P DRP IDA 
   469  285 B F  G 3  S+     0   0    7  161    4        F F  F    F                      FF       FY YF Y     Y YYY YYF 
   470  286 B F  G X  S+     0   0    4  160    1        F F  F    F                      FF       FF FF F     F FFF FFF 
   471  287 B Q  T <  S+     0   0  147  154   70        Q Q  Q    Q                      RR       Q   Q         KRD AKR 
   472  288 B D  T 3  S+     0   0  127  149   41        D D  D    D                      DD       D   D         DDD NDN 
   473  289 B V    <   +     0   0   41  123   44        V V  V    V                      VV       V   V         LVL LIV 
   474  290 B T        -     0   0   95  103   63        T T  T    T                      ST       T   T         GSD DGQ 
   475  291 B K        -     0   0  110   89   74        K K  K    K                      ML       K   K          MK K I 
   476  292 B P        -     0   0   28   75   78        P P  P    P                      PA       P   P          QA S V 
   477  293 B V        -     0   0   97   48   78        V V  V    V                      LI       V   V          R    K 
   478  294 B P        -     0   0   16   42   83        P P  P    P                      PP       P   P          P    P 
   479  295 B H              0   0  170   36   76        H H  H    H                      HN       H   H                 
   480  296 B L              0   0   78   25    3        L L  L    L                      LL       L   L                 
## ALIGNMENTS   71 -  140
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....8....:....9....:....0....:....1....:....2....:....3....:....4
     1   21 A E              0   0  205   67   16         E      E        EE        EGE                               E  
     2   22 A D    >   +     0   0   66   69   46         E      D        EE        GEE                               E  
     3   23 A E  B 3  S+a   38   0A 100   72   33         G      E        YY        EEE                               H  
     4   24 A Q  T 3  S+     0   0  153   73   71         E      Q        QQ        RPL                               L  
     5   25 A T  S <  S-     0   0   77   75   47         E      T        LL        TAT                               T  
     6   26 A P        -     0   0   85   78    8         P      P        PP        PPP                               P  
     7   27 A I        -     0   0   17   79   35         L      I        VV        FLL                               F  
     8   28 A H        -     0   0  136   79   55         P      Q        QQ        HPH                               Q  
     9   29 A I        -     0   0   14   79   14         L      I        VV        ILI                               I  
    10   30 A S  E     -B   25   0B  11   79   45         S      S        TT        SSS                               S  
    11   31 A W  E     -B   24   0B  86   80    8         W      W        WW        WWW                               W  
    12   32 A L  E     -B   23   0B   9   81    7         L      L        LL        LLL                               L  
    13   33 A S  E     -B   22   0B  39   81   58         P      P        PP        DPP                               P  
    14   34 A L    > > +     0   0    0   82   17         L      L        LL        PLL                               L  
    15   35 A S  G > 5 +     0   0   64   81   20         S      S        SS        SPS                               S  
    16   36 A R  G 3 5S+     0   0  161   82   90         P      R        MM        PPI                               I  
    17   37 A V  G < 5S-     0   0    4   82   48         A      V        VV        VAV                               V  
    18   38 A N  T < 5S+     0   0  141   82   69         Y      N        NN        HYG                               D  
    19   39 A C      < -     0   0   29   79   49         S      C        SS        YSC                               C  
    20   40 A S  S    S+     0   0   84   79   48         S      S        TT        PSP                               S  
    21   41 A Q        -     0   0   37   82   44         A      Q        QQ        QAQ                               L  
    22   42 A F  E     -B   13   0B 105   82   68         F      F        FF        FFF                               F  
    23   43 A L  E     -B   12   0B   0   83   11         L      L        LL        LLL                               L  
    24   44 A G  E     -Bc  11 117B   0   82    5         G      G        GG        GAG                               G  
    25   45 A L  E     +Bc  10 118B   1   82   26         V      L        II        LVI                               I  
    26   46 A C        -     0   0    2   81   35         C      C        CC        CCC                               C  
    27   47 A A        -     0   0   44   79   57         S      A        AA        SSA                               P  
    28   48 A L    >   -     0   0    4   79    5         L      L        LL        LLL                               L  
    29   49 A P  T 3  S+     0   0    0   79    0         P      P        PP        PPP                               P  
    30   50 A G  T 3  S+     0   0    0   79    3         G      G        GG        GGG                               G  
    31   51 A C    <   -     0   0    4   77    8         C      C        CC        CCC                               C  
    32   52 A K        +     0   0   37   79   28         R      K        KK        RRK                               K  
    33   53 A F  B >  S-F   36   0C  25   82   27         F      F        FF        FFY                               F  
    34   54 A K  T 3  S-     0   0   81   82    8         K      K        KK        KKK                               K  
    35   55 A D  T 3  S+     0   0  118   82   22         D      D        DD        DDE                               D  
    36   56 A V  B <   +F   33   0C  58   82   61         V      I        VV        VII                               I  
    37   57 A R        +     0   0   75   82   27         R      R        RR        GRR                               R  
    38   58 A R  B     -a    3   0A  48   82    0         R      R        RR        RRR                               R  
    39   59 A N     >  -     0   0   64   82   37         N      N        NN        NNC                               N  
    40   60 A V  H  > S+     0   0   15   81   36         L      .        LL        LLL                               L  
    41   61 A Q  H  > S+     0   0   84   83   46         Q      .        QQ        QQQ                               L  
    42   62 A K  H  > S+     0   0   98   83   47         K      .        KK        KKK                               R  
    43   63 A D  H  X S+     0   0    3   83    3         D      .        DD        DDD                               D  
    44   64 A T  H  X S+     0   0    2   84   69         I      .        II        LII                               V  
    45   65 A E  H  X S+     0   0   97   84   37         D      .        EE        GDE                               G  
    46   66 A E  H  X S+     0   0   57   85   48         E      .        AA        EEE                               E  
    47   67 A L  H  X>S+     0   0    0   85   16         L      .        LL        PLL                               L  
    48   68 A K  H ><5S+     0   0   86   84   56         K      .        WW        KKQ                               Q  
    49   69 A S  H 3<5S+     0   0   89   84   73         S      .        RR        SNN                               N  
    50   70 A C  H 3<5S-     0   0   52   84   96         Y      .        HH        CCQ                               Q  
    51   71 A G  T <<5 +     0   0   37   83   20         G      .        SS        GGG                               G  
    52   72 A I      < +     0   0    1   83   23         I      .        II        ATV                               V  
    53   73 A Q        +     0   0   64   83   49         Q      .        QQ        RRQ                               Q  
    54   74 A D  E     -de  82 116B   9   83   27         D      .        DD        DDD                               D  
    55   75 A I  E     -de  83 117B   0   83   16         V      .        VV        LVV                               V  
    56   76 A F  E     -de  84 118B   0   83   19         F      .        FF        FFF                               F  
    57   77 A V  E     -de  85 119B   0   83   24         V      .        VV        VVV                               V  
    58   78 A F        +     0   0    0   83   11         L      .        FF        FLF                               F  
    59   79 A C  S    S-     0   0    0   83   26         C      .        CC        CCC                               C  
    60   80 A T    >>  -     0   0   36   83   12         T      .        TT        TTT                               T  
    61   81 A R  H 3> S+     0   0  157   83   39         K      .        KK        RKR                               R  
    62   82 A G  H 3> S+     0   0   53   83   18         G      .        GG        GGG                               G  
    63   83 A E  H <> S+     0   0   14   83    0         E      .        EE        EEE                               E  
    64   84 A L  H  <>S+     0   0    1   83    7         L      .        MM        LLL                               L  
    65   85 A S  H ><5S+     0   0   67   83   67         L      .        GG        ALS                               H  
    66   86 A K  H 3<5S+     0   0  141   83   42         K      .        KK        RKK                               K  
    67   87 A Y  T 3<5S-     0   0    6   83    5         Y      .        YY        YYY                               Y  
    68   88 A R  T < 5S+     0   0  130   83   21         R      .        RR        RRR                               R  
    69   89 A V    > < +     0   0    0   83    6         V      .        VV        VVV                               V  
    70   90 A P  T >  S+     0   0   69   83   21         P      .        PP        PPP                               P  
    71   91 A N  T >> S+     0   0   63   83   70         N      .        GG        DNS                               S  
    72   92 A L  H <> S+     0   0    0   83    5         L      .        LL        LLL                               L  
    73   93 A L  H <> S+     0   0    5   83   29         I      .        LL        PIL                               L  
    74   94 A D  H <> S+     0   0   77   83   36         D      .        EE        DDE                               E  
    75   95 A L  H  < S+     0   0   16   83   85         A      .        SS        AAV                               T  
    76   96 A Y  H ><>S+     0   0    2   83   14         Y      .        YY        YYY                               Y  
    77   97 A Q  H ><5S+     0   0   89   83   58         Q      .        QQ        RQQ                               R  
    78   98 A Q  T 3<5S+     0   0  140   83   50         E      .        QQ        REQ                               Q  
    79   99 A C  T < 5S-     0   0   25   83   90         C      .        QQ        PCR                               Q  
    80  100 A G  T < 5S+     0   0   47   83    7         G      .        GG        GGG                               G  
    81  101 A I      < -     0   0    8   83   33         I      .        FF        FIF                               L  
    82  102 A I  E     -d   54   0B  73   83   83         C      .        TT        ACR                               V  
    83  103 A T  E     -d   55   0B  33   83   58         V      .        VV        VVV                               V  
    84  104 A H  E     -d   56   0B  26   83   20         H      .        HH        HHH                               H  
    85  105 A H  E     +d   57   0B  55   84   13         H      I        HH        RHH                               H  
    86  106 A H        -     0   0   16   84   68         Y      Q        YY        HYM                               L  
    87  107 A P        -     0   0   64   84    4         P      K        PP        PPP                               P  
    88  108 A I        -     0   0    3   84   36         I      D        FF        FIF                               F  
    89  109 A A    >   -     0   0   68   84   52         P      T        PP        PPL                               P  
    90  110 A D  T 3  S+     0   0   41   85    4         D      D        DD        DDD                               D  
    91  111 A G  T 3  S+     0   0   22   85   11         G      G        GG        GGG                               G  
    92  112 A G  S <  S-     0   0   18   85   66         D      G        NN        DDD                               G  
    93  113 A T        -     0   0   52   86   59         A      T        VV        AAA                               T  
    94  114 A P        -     0   0    7   86    0         P      P        PP        PPP                               P  
    95  115 A D    >>  -     0   0  108   86   46         D      D        DD        ADE                               E  
    96  116 A I  H 3> S+     0   0   38   86   44         I      I        II        VIL                               L  
    97  117 A A  H 3> S+     0   0   48   86   56         T      A        SS        ATN                               Q  
    98  118 A S  H <> S+     0   0   24   86   77         T      N        SS        GTQ                               Q  
    99  119 A C  H  X S+     0   0    1   86   50         C      C        CC        CCC                               C  
   100  120 A C  H  X S+     0   0   14   86   75         C      C        SS        RCC                               C  
   101  121 A E  H  X S+     0   0   96   86   73         T      E        KK        ATQ                               Q  
   102  122 A I  H  X S+     0   0    1   86   21         I      I        II        III                               I  
   103  123 A M  H  X S+     0   0    0   86   16         L      M        LL        LLL                               L  
   104  124 A E  H >X S+     0   0   96   86   37         E      E        EE        DED                               E  
   105  125 A E  H 3X S+     0   0   55   86   28         E      A        EE        EEE                               G  
   106  126 A L  H 3X S+     0   0    0   86   13         L      L        LL        LLL                               L  
   107  127 A T  H S+     0   0    5   86   61         C      C        CC        CCS                               N  
   110  130 A L  H ><5S+     0   0    2   85   13         L      L        LL        LLL                               L  
   111  131 A K  H 3<5S+     0   0  152   85   70         E      K        EE        DEK                               N  
   112  132 A N  T 3<5S-     0   0   98   85   48         S      N        NN        ASN                               N  
   113  133 A Y  T < 5 +     0   0  170   85   75         N      N        DD        DND                               N  
   114  134 A R      < -     0   0   87   85   42         R      R        KK        RRR                               R  
   115  135 A K        -     0   0   89   84   29         K      K        KK        KKR                               K  
   116  136 A T  E     - e   0  54B   0   85   43         T      T        TT        TTT                               T  
   117  137 A L  E     -ce  24  55B   0   85   20         I      L        LL        VIV                               V  
   118  138 A I  E     +ce  25  56B   0   85   17         I      I        II        III                               I  
   119  139 A H  E     - e   0  57B   0   85    9         H      H        QQ        PHH                               H  
   120  140 A S        -     0   0    0   86    6         C      C        CC        VCC                               C  
   121  141 A Y  S    S+     0   0   26   86   27         Y      Y        YY        NYY                               Y  
   122  142 A G  S    S-     0   0   23   86    4         G      G        GG        GGG                               G  
   123  143 A G  S    S+     0   0    2   87    3         G      G        GG        GGG                               G  
   124  144 A L  S    S+     0   0   43   87    7         L      I        LL        LLL                               L  
   125  145 A G  S >> S+     0   0    4   87    3         G      G        GG        GGG                               G  
   126  146 A R  H 3> S+     0   0    2   88    6         R      R        RR        RRR                               R  
   127  147 A S  H 3> S+     0   0    0   86   21         S      S        SS        SSS                               S  
   128  148 A C  H <> S+     0   0    0   87   47         C      C        CC        CCG                               G  
   129  149 A L  H  X S+     0   0    1   89   10         L      L        LL        LLL                               L  
   130  150 A V  H  X S+     0   0    1   84   26         I      V        II        VII                               I  
   131  151 A A  H  X S+     0   0    0   89   15         A      A        AA        AAA                               A  
   132  152 A A  H >X S+     0   0    0   89    6         A      A        AA        AAA                               A  
   133  153 A C  H 3X S+     0   0    1   89    9         C      C        CC        CCC                               C  
   134  154 A L  H 3X S+     0   0    0   89   13         L      L        LL        LLL                               L  
   135  155 A L  H >  -     0   0   38   89   67         T      S        FF        ATT                               T  
   144  164 A P  H 3> S+     0   0   24   89   28         P      P        PP        IPP                               P  
   145  165 A E  H 3> S+     0   0  108   89   49         Q      Q        EE        QQN                               N  
   146  166 A Q  H <> S+     0   0   93   88   52         Q      Q        QQ        EQK                               K  
   147  167 A A  H  X S+     0   0    0   88   29         A      A        AA        VAA                               A  
   148  168 A I  H  X S+     0   0    4   88   14         I      I        II        III                               I  
   149  169 A D  H  X S+     0   0   77   88   51         D      D        DD        DDE                               E  
   150  170 A S  H  X S+     0   0    6   88   83         S      S        LL        GSI                               L  
   151  171 A L  H  X>S+     0   0    0   88   22         L      L        LL        LLL                               L  
   152  172 A R  H  X5S+     0   0   48   88   22         R      R        RR        RRR                               R  
   153  173 A D  H  <5S+     0   0  137   88   37         D      D        EG        NEQ                               E  
   154  174 A L  H  <5S+     0   0   35   88   40         L      L        LL        PLH                               H  
   155  175 A R  H  <5S-     0   0   62   88    6         R      R        RR        RRR                               R  
   156  176 A G    ><< -     0   0   33   86    7         G      G        GG        GGG                               G  
   157  177 A S  T 3  S+     0   0   80   87   58         S      S        AA        SSG                               G  
   158  178 A G  T 3   +     0   0   16   87   45         R      G        GG        GRG                               G  
   159  179 A A  S <  S+     0   0    0   88    2         A      A        AA        AAA                               A  
   160  180 A I  S    S+     0   0    1   88    5         I      I        II        III                               I  
   161  181 A Q        +     0   0   20   88   11         Q      Q        QQ        QQQ                               Q  
   162  182 A T  S  > S-     0   0   21   88   21         T      T        TT        TTT                               T  
   163  183 A I  H  > S+     0   0    0   88   37         I      I        VV        RIV                               V  
   164  184 A K  H  > S+     0   0   65   88   20         K      K        KK        KKR                               K  
   165  185 A Q  H  > S+     0   0   10   85    0         Q      Q        QQ        QQQ                               Q  
   166  186 A Y  H  X S+     0   0   39   84   24         Y      Y        YY        YYY                               Y  
   167  187 A N  H  X S+     0   0    8   84   14         N      N        NN        NNN                               N  
   168  188 A Y  H >X S+     0   0   20   84    4         F      Y        YY        YYF                               F  
   169  189 A L  H >X S+     0   0    1   84   19         I      L        LL        LIL                               L  
   170  190 A H  H 3< S+     0   0   72   84   27         H      H        HH        HHH                               H  
   171  191 A E  H  S+     0   0  118   83   40         E      D        EE        DEE                               E  
   175  195 A K  H  < S+     0   0   92   81   54         N      K        NN        NNK                               K  
   176  196 A L  H >< S+     0   0   43   79   52         V      L        MM        LVY                               Y  
   177  197 A A  H 3< S+     0   0   61   78   41         A      A        AA        AAT                               S  
   178  198 A A  T >< S+     0   0   57   78   43         A      A        NN        AAA                               A  
   179  199 A H  T <   +     0   0   85   78   52         H      H        YY        HQY                               Y  
   180  200 A L  T 3   +     0   0  131   74   46         L      L        LL        LL                                Q  
   181  201 A S    <   +     0   0   82   73   63         A      S        AA        AE                                E  
   182  202 A S              0   0  120   72   57         T      S        TT        TA                                T  
   183  203 A R              0   0  282   67   29         Q      R        KK        KQ                                K  
   184      ! !              0   0    0   0     0  
   185    1 B M              0   0  221  130    9   M MMMM MMMMMM M LMMMMM  M MMMMMM   LLIMMMMMMMMMVMMMMMMMLLMMLMLMMMM  M
   186    2 B E        -     0   0  105  150   38   DDDEED DEEEEE EEDEEEDD  D EEEDED   DNNEDEEEDEEEGEEEEEEDAAEETETEEEE  E
   187    3 B N  S    S+     0   0   43  157   69   QNDNQQ DQQDDQ QQNDDDQQ  Q RRDQRQ   NDDNDNNNNNNNDNDDEDNKNNKNNNNKRRN  N
   188    4 B F  B     -G  207   0D  42  158    2   YFYYYY YYYYYY YYFYYYYY  Y YYFYYY   YFFYFYYYFYYYFYFFFFYYYYYYYYYYYYY  Y
   189    5 B Q        -     0   0   79  158   54   EDTQEE LEEMLE EEQTVTEE  E ESEEQE   QEQQLQQQIVQEKQQEEEQEKKQQKQKHQQQ  Q
   190    6 B K        +     0   0  106  158   47   KKKKKK KKKKKK KKRKKKKK  K KKKKTK   KKRKKKKKRKKKKKKKKKKRRRKKRKRGKKK  K
   191    7 B V        +     0   0   77  158   35   VVIIVV IEVIIV QVAIIIVI  V LIITLV   ILLIIIIIIVIVMIIIIIILLLILLLLLLLL  L
   192    8 B E        -     0   0  116  158   22   EEEEEE EEEEEE EEEEEEEG  E GEEEGE   EEEEEEEEEEEAIEEEEEEEEEEEEEEEEEE  E
   193    9 B K  E     +I  203   0E  98  158   30   KKKKKK KKKKKK KKKKKKKK  K KKKKRK   KKKKKKKKKKKKKKKKKKKRKKKKKKKKKKK  K
   194   10 B I  E     -     0   0E  32  158   17   IIIIII IIIIII IIIIIIII  I IVIIII   VIVIIIIIIIIIIIIIIIIAVVIVVVVIIII  V
   195   11 B G  E     -I  202   0E  23  159    5  GGGGGGG GGGGGG GGGGGGGG  G GGGGGG   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG  G
   196   12 B E        +     0   0  129  159   13  EEEEEEE EEEEEE EEEEEEEE  E EEEEEE   EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE  E
   197   13 B G        -     0   0   50  162    0  GGGGGGG GGGGGG GGGGGGGG  GGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG
   198   14 B T  S    S-     0   0  141  162   11  TTSTTMT TTTTTT TTTTTTTT  TTTTTTTT   TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT TT
   199   15 B Y  S    S+     0   0   59  162    0  YYYYYYY YYYYYY YYYYYYYY  YYYYYYYY   YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YY
   200   16 B G        -     0   0   20  162    5  GGGGGGG GGGGGG GGGGGGGG  GGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG
   201   17 B V        -     0   0   10  162   60  VVVVVVV VVVVVV VVIVVVVV  VVVVVVVV   VVVVVVVVVIVVIVVVVVVVVVVVVVVVVVV VV
   202   18 B V  E     -I  195   0E  40  162    0  VVVVVVV VVVVVV VVVVVVVV  VVVVVVVV   VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VV
   203   19 B Y  E     -I  193   0E  49  162    2  YYYYYYY YYYYYY YYYYYYYY  YYYYYYFY   YYYYYYYYYYYYYYYYYYYFYYYYYYYYYYY YY
   204   20 B K        +     0   0   76  162    6  KKKKKKK KRKKKK KKKKKKKK  KKKKKKKK   KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KK
   205   21 B A        -     0   0    1  162   21  AAAGAAA GAAGGA GGAGGGGA  GGAAGGAA   AAAAGAAAGGAAAAGGGGAAAAAAAAAAAAA AA
   206   22 B R        -     0   0  133  162   51  RRRRRRR RRRRRR LKRRRRKF  KRRKRKKK   KLLRKRRRKKRKRRRRRRRRLLRRVRVQKKR RR
   207   23 B N  B  >  -GH 188 211D  45  162   44  DDHHEDD NDDHHD DHSHHHDV  DHEDNDDD   DDDDNDDDHDESDENNNNDDDDEDDDDNDDD DD
   208   24 B K  T  4 S+     0   0  112  161   76  RKRKLRR KRRKKR KRNKKKRR  RKIVRRKR   ITTLKLLLKKLLTLKRRRLRMLLLLLLSRRL LL
   209   25 B L  T  4 S-     0   0  132  162   86  VVIKTVV TVVSSA AHSTSTQE  HTATLHVY   NKKTITSSKRTRKTVLILSYRRAARARDVVA NT
   210   26 B T  T  4 S-     0   0   98  162   53  TTSTHTT TTTTTT TTTTTTTT  TTTTTTST   THNHTHNNTDHDTHTTTTHTQNHNHNHGTTN HT
   211   27 B G  B  <  +H  207   0D   7  162   55  NNGSPNN GNNGGN NNgGGGNK  NGGGGNQN   GnnPGphhGGPDGpGGGGqNGGPnGgGEGGg Nk
   212   28 B E        -     0   0  148  159   62  EEDRnEE QEEQQE EEdQQQEE  EQQQQERE   NrrnQrrrEKnAKrQQQQrEqqnrqrqSEEr Rq
   213   29 B V        -     0   0   95  142   49  ATLLiTT VTTVVT TT.VVVTI  TVMVITVT   IVIiFIIIIIiMDIIIIIIIviiIiIi.VVI Ii
   214   30 B V        -     0   0    9  161   26  IIVVVII VIIVVI IIVVVVIV  IVIVVILI   VVVVVVVVVVVVVVVVVVVVVVVVVVVFIIV VV
   215   31 B A        -     0   0   12  162    8  AAAAAAA AAAAAA AAAAAAAA  AAAAAAAA   AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AA
   216   32 B L        -     0   0   12  162   17  LLLLLLL MLLLML LLLMMMLL  LMLLMLLL   LLLLMLLLMLLLLLMMMMLLLLLLLLLLLLL LL
   217   33 B K        -     0   0   23  162   11  KKKKKKK KKKKKK KKKKKKKK  KKKKKKKK   KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KK
   218   34 B K        +     0   0   12  162   19  KKRKKKK KKKKKK KKKKKKKK  KKKKKKQK   KKKKKKKKKKKRKKKKKKKKKKKKKKKKKKK KK
   219   35 B I        -     0   0   12  162   37  IIIIIII IIIIII IIIIIIII  IIIIIIII   IIIIIIIIIIIIIIIIIIIIIIVIIIIIIII II
   220   36 B R        +     0   0  100  162   20  RRPRRRR RRRRRR RRRRRRRR  RRRRRRRR   RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR
   221   37 B L        -     0   0   33  162   32  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL
   222   38 B D        -     0   0   96  162   36  EEDEEEE EEEEEE EEEEEEEE  EEEEEEEE   EEEEEEEEEEEDDEEEEEEEEEEEEEEEEEE EE
   223   39 B T  S    S+     0   0   75  161   78  QQISAQQ SQQSSQ QQGSSSQQ  QSQASQQQ   ASSASAAASSAQSASSSSAQSSTASASKAAA AA
   224   40 B E  S    S+     0   0  158  161   30  EEEEEEE EEEEEE EEEEEEEE  EEEEDEEE   EEEEEEEEEEEDEEDDDDEEEEDEEEEEEEE EE
   225   41 B T  S    S-     0   0   43  161   36  DDSEDDD EDDEED DDTEEEDD  DEDDDDED   DDDDDDDDDDDDTDDDDDDDDDDDDDDDDDD DD
   226   42 B E  S    S-     0   0   70  160   11  EEEEEEE EEEEEE EEEEEEEE  EEEEEEEE   EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE EE
   227   43 B G  S    S-     0   0   77  160    1  GGGGGGG GGGGGG GGGGGGGG  GGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG
   228   44 B V  S    S-     0   0   85  160   22  VVVVVVV VVVVVV VVVVVVVV  VVVVVVVV   VVVVIVVVVVVVVVIVVVVVVVVVVVVIIIV VV
   229   45 B P     >  -     0   0   26  160    7  PPPPPPP PPPPPP PPPPPPPP  PPPPPPPP   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PP
   230   46 B S  H  >> +     0   0   87  160   38  SSSSSSS SSSSSS SSSSSSSS  SSSSSSSS   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SS
   231   47 B T  H  45S+     0   0   56  160   27  TTTTTTT TTTTTT TTTTTTTT  TTTTTTTT   TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT TT
   232   48 B A  H  >>S+     0   0    1  160   19  AAAAAAA AAAAAA AAAAAAAA  AAAAAAAA   STAAAAAAAAAAAAAAAAAAAATAAAAAAAA AA
   233   49 B I  H  X5S+     0   0  106  161   19  IIIIIII VIIVVI IIIIVIII  IIIIIIII   IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II
   234   50 B R  H  X5S+     0   0   38  161    1  RRRRRRR RRRRRR RRRRRRRR  RRRRRRRR   RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR
   235   51 B E  H  >X   -     0   0   25  160   36  HHHHDHH HHHHHH HHHHHHHH  HHHDHHHH   dDDDHDDDHHDHHDHHHHDHDDHDDDDHHHD DD
   245   61 B P  T 3  S+     0   0   91  160   63  RSPPPGG PGRPPR DRKPPPRG  RPPDRRER   DDDPPPPPPKPEKPPSSEPDDDPPDPDSCCP PP
   246   62 B N  T 3  S+     0   0   11  160   20  NNNNNNN NNNNNN NNNNNNNN  NNNNNNNN   NNNNNNNNNHNNNNNNNNNNNNNNNNNNNNN NN
   247   63 B I  S <  S-     0   0    2  160   12  IIVIIII VIIVVI IIVIVIII  IIVVIIII   IIIIIIIIIIIVIIIIIIIVIIIIIIIIIII II
   248   64 B V        -     0   0    9  160    3  VVVVVVV VVVVVV VVVVVVVV  VVVVVVVV   VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VV
   249   65 B K        -     0   0  116  161   55  RKRCRRR RKRRRR RRQSRSKR  RSLRCRCR   KARRKKRRSRRSQRSCSCRRRKRRRRRKRRR RR
   250   66 B L        -     0   0   17  162    9  LLLLLLL LLLLLL LLLLLLLL  LLFLLLLL   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL
   251   67 B L        -     0   0   68  162   78  QQLELQQ LHQLLQ HQFQLQQL  QQKLEQEQ   LYYLELFFMELLFLEEEEFYYYFFYLYYYYF FL
   252   68 B D        -     0   0   86  162   27  DDDDNDD DDDDDD DDDDDDDD  DDDDDDDD   DDDNDNNNDDNEDNDDDDNDDDNNDNDDNNN DN
   253   69 B V        -     0   0   39  162   15  VVVVIVV VVVVVV VVVVVVVV  VVVIVVVV   IIIIVIIIVVIVIIVVVVIVIIIIIIIVIII II
   254   70 B I  B     -J  261   0F  27  162   54  VVILVVV LIVLLV IVVLLLVV  VLVVLVVV   VVVVLVVVLLVIVVLLLLVLVVHVVVVIVVV VV
   255   71 B H        +     0   0  160  162   64  HHHMHHH MHHMMH HHIMMMHH  HMHHMHHH   HHHHMHHHMMHHVHMMMMHYHHTHHHHHHHH HH
   256   72 B T        -     0   0   56  162   75  SSSQASS QSSQQS SKSQQQNS  NQAAENEN   SSLAEAAAEEAEAAEEEEASSAEASASATTA AA
   257   73 B E  S    S+     0   0  161  162   40  GEDEDEE EEEEEE EEGDEDEE  DDDDEDDE   ENDDEDDDEGDEDDEEEEDDDDGDDDDKEED DD
   258   74 B N  S    S-     0   0   86  162   71  KKKNgKK SKKSSK KKNSSSKR  KSKANKRK   AssgSgggSsgTSgNNNNgRaaYgagaKRRg gg
   259   75 B K  S    S-     0   0   48  161   59  RRNKkRR KRRKRR RCNRRRCR  CRKKRCKC   KkkkRkkkKkkKSkRRRRkRkkKkkkkRKKk kk
   260   76 B L        -     0   0   26  161   13  LLLLLLL LILLLL IILLLLIL  ILLLIILI   LILLLLLLLILLLLLIIILLLLLLLLLLLLL LL
   261   77 B Y  B     -J  254   0F  23  161   53  YYYYYYY YWYYYY YYYYYYYY  YYYYYYYY   YYYYYYYYYYYYYYYYYYYYYYYYYYYITTY YY
   262   78 B L        -     0   0    0  162    5  LLLLLLL LLLLLL LLMLLLLL  LLLLLLLL   LLLLLLLLLLLLMLLLLLLLLLLLLLLLLLL LL
   263   79 B V        -     0   0   10  162    7  VVVVVVV VVVVIV VVIIIIVV  VIVVIIVV   VVVVIVVVIVVVVVIIIIVVVVVVVVVVVVV VV
   264   80 B F        -     0   0   20  162    4  FFFFFFF FFFFFF FFFFFFFF  FFFFFFFF   FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FF
   265   81 B E        -     0   0   55  162    2  EEEEEEE EEEEEE EEEEEEEE  EEEEEEEE   EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE EE
   266   82 B F        +     0   0   40  162   23  YYYFFYY FYYFFY FYYFFFYY  YFYFFYFY   FFFFFYFFYYFYYFFFFFYYFFHFFFFHYYF FF
   267   83 B L        -     0   0   30  162   43  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL
   268   84 B H  S    S-     0   0   89  162   42  DDNSDDD SDDSSD DDNSSSDD  DSDDSDDD   DDDDSDDDTSDDNDSSSSDDDDDDEDDDDDD DD
   269   85 B Q  E     -K  319   0G  36  162   76  LLQMLLL MLLMML LLMMMMLL  LMQVMLVL   MMLLMLLLMMLLMLMMMMLLLLSLLLLQQQL LL
   270   86 B D  E  >  -K  318   0G  20  162    2  DDDDDDD DDDDDD DDDDDDDD  DDDDDDDD   DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD
   271   87 B L  H  > S+     0   0    0  162    2  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLLLLLLLLLLLMLLLLLLLLLLLLLLLLLL LL
   272   88 B K  H  > S+     0   0   84  162   26  KKKKKKK KKKKKK KKKKKKKK  KKKKKKKK   KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KK
   273   89 B K  H  > S+     0   0   67  162   34  KKKRKKK KKKKKK KKKKKKKK  KKRRKKKK   KKKKKKKKKKKKKKKKKKKKRRKKRKRKKKK KK
   274   90 B F  H  < S+     0   0    9  162   40  HHLYYHH YFHYYF FHLYYYHH  HYFYYHHH   YYYYYYYYYYYHLYYYYYYQYYYYYYYLYYY YY
   275   91 B M  H  < S+     0   0   11  162   28  MMLMMMM LMMLLM MMMLLLMM  MLMMMMMM   MMMMMMMMMLMMMMMMMMMMMMMMMMMILLM MM
   276   92 B D  H >< S+     0   0   89  162   32  DDDDEDD DDDDDD DDDDDDDD  DDDEDDDD   DEEEDEEEDDEDDEDDDDEDEEDEEEEDDDE EE
   277   93 B A  T 3< S+     0   0   82  162   67  SLETATS SSSSSS SSKSSSSS  SSSQSSSS   TSKASAAASGASKATSSSAASSASSASVVVS AA
   278   94 B S  T >> S+     0   0   22  162   87  STSILCS ISSIIS CSKIIISC  SIVALSNS   IIILLLLLLFLSKLLLLLLAIILLVLVCCCL LL
   279   95 B A  T <4 S+     0   0   48  162   67  PPEPPPP PPPPPP PPKPPPQP  TPSNPAPP   GPQPGPPPGDPPKPPPPPPPPPPPPPPDEEP PP
   280   96 B L  T 34 S+     0   0  160  162   83  EDTNNDD SEESSE EDDPSPDE  DPAKPDQD   EEGVSVVVNKVHEVAAPVVFKKVTKVKGKKV VV
   281   97 B T  T <4 S-     0   0  122  162   83  FFGgMLF gFFggF FFVgggFF  FgLveFVF   kgesgsssgnsIIsededsNddnsdadGGGs ss
   282   98 B G     <  -     0   0   14  122   78  AS.fGAA fAVyyA A..yyf.S  .f.ph.Y.   ggggfggglrgS.glhlhg.ssggpgp...g gv
   283   99 B I        -     0   0   21  157   44  KKLVLKK MKKMMK KKFMMMKK  KM.ILKLK   LLLLMLLLMLLNFLMMMMLRLLLMLLLLLLL LM
   284  100 B P     >  -     0   0   67  162   62  DDEDGDD DSDDDD NNTDDDND  NDRTSNDN   GGGGDGGGDSGDTGDDDEGNGGGGGGGEEEG GD
   285  101 B L  H  > S+     0   0  104  162   85  LLKKDPL PPPPPQ PHPSPSHT  HSPPSHQH   PNGEPEEEPNERPDPPSSDLSDEDDDDSKKD ED
   286  102 B P  H  > S+     0   0   63  162   82  RHSMARR MARMMR TRQSMSRG  RSADQRTH   DDDAAAAADTAMKADKKEARDKAAKAKVPPM AN
   287  103 B L  H  > S+     0   0    1  162   60  QMLLMLL LLQLLQ LILLLLIV  ILLMLIVI   MMMMVMMMLLMVLMLLLLMLIIMVIIITIIV MM
   288  104 B I  H >X S+     0   0    5  162   28  VIVVVII VIVVVI IVIVVVVV  VVVVVVVV   VVVVVVVVVVVIVVVVVVVIIIIIIIVALLV VV
   289  105 B K  H 3X S+     0   0   34  162   19  KKKKKKK KKKKKK KKKKKKKK  KKKKKKKK   KKKKKKKKRKKKKKKRRRKKKKKKKKKKKKR KK
   290  106 B S  H 3X S+     0   0    3  162   60  MTSSKTM SSMSSM SSSSSSSS  SSSKSSHS   KKRKSKKKSSKGSKSSSSKVKKKRKKKSSSK KK
   291  107 B Y  H X S+     0   0    0  162   24  LLLTMLL LLLLLL LLMLLLLV  LLLTLLLL   SMMMLMMMLLMVMMMLLLMMMMMMMMMLLLM MM
   293  109 B F  H 3X S+     0   0   49  162   55  YYWYAYH YYYYYY YYYYYYYY  YYYYYYYY   YLLAYAAAYKAYHAYYFYAWRMSRMLMLYYF AM
   294  110 B Q  H 3X S+     0   0   22  162    3  QQQQQQQ QQQQQQ QQQQQQQQ  QQQQQQQQ   QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQ
   295  111 B L  H X S+     0   0    3  162   30  IIIIIII IVIIII VILIIIIL  IIILILII   LLLIIIVVIIIILIMIIIIIIIIIIVIIIII VV
   300  116 B A  H 3X S+     0   0   12  162   78  AAALRAA LAALLA AAGVYVAA  AVALLAAA   YYYRLRRRLLRACRLLLLRAAAYRARAAAAK RR
   301  117 B F  H 3< S+     0   0   45  162   23  YYHFYYY FYYFFY YYFFFFYY  YFYYFYYY   YHYYYYYYFFYFFYFFFFYFYYFYYYYYYYY YY
   302  118 B C  H X<>S+     0   0    2  162   35  CCCCCCC CCCCCC CCCCCCCC  CCCCCCCC   CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CC
   303  119 B H  H ><5S+     0   0   21  162    1  HHHHHHH HHHHHH HHHHHHHH  HHHHHHHH   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HH
   304  120 B S  T 3<5S+     0   0   79  162   63  SSTQSSS CSSCCS SSTSRSSS  SSSSRSSS   GAASQSTTQQSSTSKRRRSSASSSASAEQQS SA
   305  121 B H  T < 5S-     0   0   62  162   44  HHQRHHH RHHRRH HHNRRRHR  HRRHRHHH   HHHHRHHHRRHHNHRRRRHRHHRHHHHHHHH HH
   306  122 B R  T < 5S+     0   0  164  162   42  RRRRRRR RRRRRR RRRRRRRR  RRRRRRRR   RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR
   307  123 B V  E   < -M  335   0H   2  162   14  VVVVIVV VVVVVV FVIVVVVV  VVVIVVIV   IVIVIVVVVVIVIIVVVVVIIIVVIIIVVVV IV
   308  124 B L  E     -M  334   0H   0  162   13  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLLLLLLLLLLLLLLLLLLLLLLLILILLLL LL
   309  125 B H        +     0   0    2  162    2  HHHHHHH HHHHHH HHHHHHHH  HHHHHHHH   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HH
   310  126 B R        +     0   0   51  162    2  RRRRRRR RRRRRR RRRRRRRR  RRRRRRRR   RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR
   311  127 B D        +     0   0   22  162    0  DDDDDDD DDDDDD DDDDDDDD  DDDDDDDD   DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD
   312  128 B L        +     0   0    4  162    1  LLLLLLL LLLLLL LLLLLLLL  LLLLLLML   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL
   313  129 B K  S >  S-     0   0   28  162    0  KKKKKKK KKKKKK KKKKKKKK  KKKKKKKK   KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KK
   314  130 B P  G >  S+     0   0    4  162    1  PPPPPPP PPPPPP PPPPPPPP  PPPPPPPP   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PP
   315  131 B Q  G 3  S+     0   0   94  162   20  QQQQQQQ QQQQQQ QQQQQQQQ  QQQQQQQQ   QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ QQ
   316  132 B N  G <  S+     0   0    9  162    0  NNNNNNN NNNNNN NNNNNNNN  NNNNNNNN   NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NN
   317  133 B L  E <   - L   0 327G   0  162   13  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL
   318  134 B L  E     -KL 270 326G  36  162    0  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL
   319  135 B I  E     -KL 269 325G   0  162   16  IIIIIII IIIIII IIVIIIII  IIIIILII   IIIIIIIIIIIIVIIIIIIIIIIIIIIIIII II
   320  136 B N    >   -     0   0   25  162   46  DDDDDDD DDDDDD DDDDDDDD  DDDDDDDD   NDDDDDDDDDDDDDNDDDDDNNNDNNNNNND DD
   321  137 B T  T 3  S+     0   0   70  162   68  RRDNRRR NRRNNR RRTDNDRP  RDRKRRRR   KKKRKRRRKQRTSRKKKKRRKRRRRRRRRRK RK
   322  138 B E  T 3  S-     0   0   89  158   70  SRAKDRR KRRKKS RRAKKKRR  RKTYNRIR   SEEETEEEKKDTVDDNNSESEDDDNDNEEEE ED
   323  139 B G  S <  S+     0   0    0  161   37  TTGGGTT GTTGGS TTGGGGTT  NGGDGNTT   GGGGGGGGGGGNGGGGGGGRGGGGGGGGGGG GC
   324  140 B A        -     0   0   14  162   79  nnNVNnn VnnVVn nnNTVTnn  nTMNInnn   DNNNINNNVTNnNNIIILNnNNSNNDNEEEN NN
   325  141 B I  E     -L  319   0G   1  161   27  llIILll IllIIv llIIIIll  lILLIlml   LLLLILLLIILlILIIIILlLLLLLLLLLLL LL
   326  142 B K  E     -L  318   0G  36  162    2  KKKKKKK KKKKKK KKKKKKKK  KKKKKKKK   KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK KK
   327  143 B L  E     +L  317   0G   4  162   20  LLLLLLL LLLLLL LLLLLLLL  LLLLVLLL   IVLLVLIIVVLLLLVVVVLLLLLLLLLILLL LL
   328  144 B A        +     0   0   14  162   13  AAAAAAA AAAAAA AAAAAAAA  AAAAAAAA   GAAAAAAAAAAAAAAAAAAAGGAAGAGAGGA AA
   329  145 B D    >   +     0   0   44  162    0  DDDDDDD DDDDDD DDDDDDDD  DDDDDDDD   DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD
   330  146 B F  G >   +     0   0    1  162    4  FFFFFFF FFFFFF FFFFFFFF  FFFFFFFF   FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FF
   331  147 B G  G 3  S+     0   0   13  162    0  GGGGGGG GGGGGG GGGGGGGG  GGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG
   332  148 B L  G <  S+     0   0   73  162    1  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL
   333  149 B A    <   +     0   0    0  162   14  AAAAAAA AAAAAA SAAAAAAG  AAAAGAAA   AAAAGAAAGAAAAAGGGGAAAAAAAAAAAAA AA
   334  150 B R  E     -M  308   0H  96  162    0  RRRRRRR RRRRRR RRRRRRRR  RRRRRRRR   RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR
   335  151 B A  E     -M  307   0H  56  162   34  AASAAAA AAAAAA AAAAAAAA  AAAASAAA   AAAAAAAAAAAAAASSSSAAAAAAAAAAAAA AA
   336  152 B F  S    S+     0   0   74  162    5  FFIFFFF FFFFFF FFFFFFFF  FFFFFFFF   FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FF
   337  153 B G        +     0   0   50  162   43  GGSGGGG GGGGGG GGNGGGGG  GGGGGGGG   GGGGGGGGGGGGNGNGGGGGGGGGGGGGGGG GG
   338  154 B V  B     -N  364   0I  28  160   29  IILIVII VIIVVI IIVIVIII  IIIIIIII   IVVVVVVVIIVIVVIIIIVIVVVVVVVIIIV VV
   339  155 B P        -     0   0   72  162   23  PPPPPPP PPPPPP PPPPPPPP  PPPPPPPP   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PP
   340  156 B V        +     0   0   42  162   42  VVIVLVV VVVVVV VVMIVIVV  VIVMVVVV   LLLLVLLLVVLVMLVVVVLVLLLLLLLAVVL LL
   341  157 B R        -     0   0  158  158   40  RRRRRRR RRRRRR RRRRRRRR  RRRRRRRR   RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR
   342  158 B T        -     0   0   51  161   73  TTGVTTT VTTVVT TTAVVVTT  TVHTITQT   TAATVTTTVVTAATNIIITAAATTATARSST TT
   343  159 B Y    >   -     0   0   63  162   23  FFYYYFF YFFYYF FFYYYYFF  FYYYYFYF   YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YY
   344  160 B X  T 3  S+     0   0   15  162   26  TTTTTTT TTTTTT TTTTTTTT  TTTTTTTT   TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT TT
   345  161 B H  T 3  S+     0   0   63  162   42  HHHHHHH HHHHHH HHHHHHHH  HHHHHHHH   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HH
   346  162 B E    <   +     0   0   76  162   26  EEEEEEE EEEEEE EEEEEEEE  EEEEEEEE   EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE EE
   347  163 B V        +     0   0   72  162    8  VVVVVVV VVVVVV VVVVVVVV  VVVVIVVV   VVVVVVVVVVVVVVIIIIVVIIVVIVIVVVV VV
   348  164 B V        -     0   0   78  162    9  VVVVVVV VVVVVV VVVVVVVV  VVVVVVIV   VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV VV
   349  165 B T        -     0   0   62  161    2  TTTTTTT TTTTTT TKTTTTTT  TTTTTTTT   TTTTLTTTTTTTTTTTTTTTTTTTTTTTTTT TT
   350  166 B L    >   +     0   0   15  161    6  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL
   351  167 B W  T 3  S+     0   0   88  161    0  WWWWWWW WWWWWW WWWWWWWW  WWWWWWWW   WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WW
   352  168 B Y  T 3  S+     0   0   35  161    0  YYYYYYY YYYYYY YYYYYYYY  YYYYYYYY   YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YY
   353  169 B R    <   -     0   0   73  161    0  RRRRRRR RRRRRR RRRRRRRR  RRRRRRRR   RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR
   354  170 B A    >>  -     0   0    1  161   24  AAAASAA AAAAAA AASSASAA  ASAAAAAA   ASAAAAAAAASAASAAAAAAASSAASAAAAA SS
   355  171 B P  H 3> S+     0   0    0  161    1  PPPPPPP PPPPPP PPPPPPPP  PPPPPPPP   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PP
   356  172 B E  H 34 S+     0   0    8  161   10  EEEEEEE EEEEEE EEEEEEEE  EEEEEEEE   EEEEEEEEEEEEEEEEEEEEEEEEEEEDDDE EE
   357  173 B I  H X4 S+     0   0   15  161   18  IIIIIII VIIVVI IIIVVVII  IVIVVIII   VIIIVIIIIVIIIIVVVVIIVVIIVIVIVVI II
   358  174 B L  H 3< S+     0   0    3  161    1  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL
   359  175 B L  T 3< S-     0   0    0  161    6  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLLLLLLLLLLLLLLLLLLLLLLLLLLMMML LL
   360  176 B G    <   +     0   0    7  161   11  GGGGGGG GGGGGG GGGGGGGG  GGGGGGGG   GGGGGGGGGGGGSGGGGGGGGGGGGGGGGGG GG
   361  177 B C        -     0   0   26  161   52  SSSSGSS AASAAS AATSSSAS  ASASSAIA   SGGGSGGGAAGVTGSSSSGSGGGGGGGSSSG GG
   362  178 B K  S    S-     0   0  122  161   62  PHSPRCR SRRSAR KRKAPARR  RARRPRKR   RKKRQRRRNQRRKRPPPPRKKKPRKRKKRRR RR
   363  179 B Y  S    S-     0   0  142  154   79  RHVRQHH RQHRRH QHFRRRHH  HRKHRHHQ   HQQQRQQQRRQTYQRRRRQTQQQQQQQKKKQ QQ
   364  180 B Y  B     -N  338   0I  48  161    0  YYYYYYY YYYYYY YYYYYYYY  YYYYYYYY   YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY YY
   365  181 B S    >   -     0   0   46  161   34  SSGSSSS SSSSSS SSSSSSSS  SSSSSSSS   SSSSSSSSTSSSASASSSSSSSSSSSSSSSS SS
   366  182 B T  T 3> S+     0   0   41  161   32  TTPTTTT TTTTTT TTTTTTTT  TTTTCTTT   TTTTCTTTCTTTTTCCCCTTTTTTTTTTTTT TT
   367  183 B A  T 34 S+     0   0    7  161   53  PPAPGPP PPPPPP PPGPPPPP  PPPAPPPP   AGGGPGGGSPGPGGPPPPGPGGSGGGGPPPG GG
   368  184 B V  T X> S+     0   0   11  161   12  VVVVVVV VVVVVV VVVVVVVV  VIVIVVVV   IVVVIVVVIVVVMVVVVVVVVVVVVVVIVVV VV
   369  185 B D  H 3> S+     0   0    0  161    0  DDDDDDD DDDDDD DDDDDDDD  DDDDDDDD   DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD
   370  186 B I  H 3< S+     0   0    2  161   35  IIIMMVV VVVVIV VMIIVIMV  VIIMIVLV   MMMMIMMMMIMVIMIIIIMITIMMVMVIIIM MM
   371  187 B W  H <> S+     0   0    1  161    0  WWWWWWW WWWWWW WWWWWWWW  WWWWWWWW   WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WW
   372  188 B S  H  X S+     0   0    6  161    9  SSASSSS SSSSSS SSSSSSSS  SSSSSSSS   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SS
   373  189 B L  H  X S+     0   0    7  161   42  VVIICVV IVVIIV VVLITIVA  VIIVIVIV   VIVVVVIIVICILAIIIIIIIICVIVIVVVV VV
   374  190 B G  H >> S+     0   0    0  161    3  GGGGGGG GGGGGG GGGGGGGG  GGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG
   375  191 B C  H 3X S+     0   0    0  161   23  CCCCACC TCCTTC CCCTTTCC  CTCCCCCC   CCCACAAACCACCACCCCACCCACCCCCCCC AC
   376  192 B I  H 3X S+     0   0    0  161    0  IIIIIII IIIIII IIIIIIII  IIIIIIII   IIIIIIIIIIIIIIIIIIIIIIIIIIIIIII II
   377  193 B F  H XX S+     0   0    0  161   12  FFFFFFF FFFFFF FFFFFFFF  FFFFFFFF   VFFFFFFFFFFMFFFFFFFFFFFFFFFFFFF FF
   378  194 B A  H 3X S+     0   0    1  161    9  AAAAAAA AAAAAA AAAAAAAA  AAAAAAAA   AAGAFAAAAVAAAASAAAAAAAAAAAAAAAA AA
   379  195 B E  H 3X S+     0   0   13  161    0  EEEEEEE EEEEEE EEEEEEEE  EEEEEEEE   EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE EE
   380  196 B M  H << S+     0   0    2  161    8  MMMMMMM LMMLLM MMMLLLMM  MLMMMMMM   MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MM
   381  197 B V  H  < S+     0   0    5  161   71  VIYVCVV AVVAAI VVIAAAVV  VAVvAVVV   ASVCSCCCAVCVICAAAACVCCCCCCCVAAC CC
   382  198 B T  H  < S-     0   0   17  160   71  NSTTTTN TNNTTN NNMTTTNN  NTMrTNNN   TNVTSTTTTNTNMTTTTTTNNNTTNTNNNNT TT
   383  199 B R  S  < S+     0   0  102  161   67  QQKKRQQ KQRKKQ QQRKKKQQ  QKRGRQQQ   RRRRKRRRKRRHKRRRRRRNRRRRRRRGGGR RR
   384  200 B R  S    S-     0   0  173  161   52  RKKRKRR KKRKKR KKRKKKKQ  KKAHKKKK   QKKKKKRRKRKARKKKKKKKSKKKKKKRGGK KK
   385  201 B A        -     0   0   31  161   27  PPAPPPP PPPPPP PPSPPPPP  APPPPPPP   PPAPPPPPPPPPAPPPPPPPPPPPPPPPPPP PP
   386  202 B L  S    S+     0   0   32  161    9  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLILLLLLLLLLLLLLLLLLIILLLLLLLLL LL
   387  203 B F  S    S-     0   0    4  161    5  FFFFFFF FFFFFF FFFFFFFF  FFFFFFFF   FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FF
   388  204 B P        -     0   0   32  161   49  PPPHPPP HPPHHP PPPHHHPP  PHPPQPPP   PAPPQPPPQHPPPPQQQQPPSSPPSPSPAAP PP
   389  205 B G        +     0   0   11  161    6  GGGGGGG GGGGGG GGGGGGGG  GGGGGGGG   GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GG
   390  206 B D  S    S+     0   0   57  161   47  DDDDDDD DDDDDD DDDDDDDD  DDDDDDDD   DDDDDDDDDDDDDDDDDDDDDDDDDDDVTTD DD
   391  207 B S  S >> S-     0   0    2  161   37  SSSSSSS SSSSSS SSSSSSSS  SSSSSSSS   SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS SS
   392  208 B E  H 3> S+     0   0   26  161   32  EEEEEEE EEEEEE EEEEEEEE  EEEEEEEE   EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE EE
   393  209 B I  H 3> S+     0   0   14  161   54  IIIIIII IIIIII IIIIIIII  IIIIIIII   IIIIIIIIIIIIIIIIIIIIIIIIIIITAAI II
   394  210 B D  H <> S+     0   0   42  161   18  DDDDDDD DDDDDD DDDDDDDD  DDDDDDDD   DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DD
   395  211 B Q  H  X S+     0   0    0  161   20  EQQQEEE QEEQQE EEQQQQEE  EQQQQEEE   EQQEQEEEQQEEQEQQQQEQQQQEQEQQQQE EE
   396  212 B L  H >X S+     0   0    0  161   16  LLLLILL LLLLLL LLLLLLLL  LLLILLLL   IIIILIIILLILLILLLLILIIIIIIILLLI II
   397  213 B F  H 3X S+     0   0   32  161   69  FFFFFFF FFFFFF FFYFFFFF  FFHFFFYF   FFFFFFFFFFFFYFFFFFFYFFFFFFFMDDF FF
   398  214 B R  H 3X S+     0   0   86  161   46  KKRRKRK RKKRRK KKRRRRKS  KRKKRKKK   RKRKRKKKRRKKRKRRRRKKKKKKKKKRRRK KK
   399  215 B I  H   -     0   0   83  157   61  NYSTDTN NTNNNN NNDNNNNN  TNTSTTSN   DTTDTDDDTTDGDDTTTTDDNNDTNTNNTTT DN
   408  224 B E  T  4 S+     0   0   80  157   23  EEEDEEE NEENNE EEENNNEE  KNEEEEEE   EEEEEEEEEEEEEEEEEEEEEEEEEEESAAE EE
   409  225 B V  T  4 S+     0   0  124  158   64  DDKENED EQEDDE QESEDEEN  EEEDDGAE   DEANESRREQVTNAEDDDRTSSDDSDSQEEE NQ
   410  226 B V  T  4 S+     0   0   51  159   76  TTTTTTT VTTVIT STKVVVTT  TVMNITNT   VIVTITIIITALKIIIIITMVISVVVVNIIN TD
   411  227 B W  S >< S-     0   0   10  161    4  WWWWWWW WWWWWW WWWWWWWW  WWWWWWWW   WWWWWWWWWWWWWWWWWWWWWWWWWWWWYYW WW
   412  228 B P  T 3  S+     0   0   82  161   13  PRPPPPP PPPPPP PPPPPPPP  PPEPPPPP   PPPPPPPPPPPPPPPPPPPVPPPPPPPPPPP PP
   413  229 B G  T 3  S+     0   0   31  162   44  GGGGGGG DGGDEG GGGEDEGG  GENGGGGG   GDEGGGGGGDGEGGGGGGGGDDGGDGDDAAG GG
   414  230 B V    X   +     0   0    0  162   37  VVVVVVV VVVVVV VVVVVVVV  VVVVVVVV   VVIVVVVVVVVAIVVVVVVCIIVVIVIVIIV VV
   415  231 B T  T 3  S+     0   0   73  162   66  TTETTTT ESTEET SATEEEAT  AESSTASS   RTNTSTTTTATKSTTTTTTSVVTTVTVFVVT ST
   416  232 B S  T 3  S+     0   0   89  159   77  SSKASSS SSASSS CSQSSSSS  SSEQSTQS   GYYSSSSSQQSQQSSSSSSAYYSSYSYKDDS SS
   417  233 B M  S X  S-     0   0   23  159   29  LLLLFLL LLLLLL LLLLLLLL  LLLLLLLL   LLLFLFFFLLFLLFLLLLFLLLFYLYLLLLY FF
   418  234 B P  T 3  S+     0   0   62  159   37  PPPPPPP PPPPPP PPPQPQPP  PQPPPPPP   PSPPPPPPAPPPPPPPPPPPPPPPPPPPPPP PP
   419  235 B D  T 3  S+     0   0   21  162   34  DDDDDDD DDDDDD DDDDDDDD  DDDDDDDD   DDDDDDDDDDDDEDDDDDDDDDDDDDDKDDD DD
   420  236 B Y    <   -     0   0   28  162   11  FYFYYFF YYFYYF FYFYYYYY  YYYYYYYY   YFYFYFFFYYYYYFYYYYFYFFYFFFFYYYF FF
   421  237 B K    >   -     0   0   46  162   56  KKKKKKK KKKKKK KIKKKKKK  KKSKKKKK   KKKKKKKKKKKQKKKKKKKKKKKKKKKDRRK KK
   422  238 B P  T 3  S+     0   0   98  162   71  SSKNPSS NSSNNS TSANNNSS  SNTPNSDS   PPPAPVTTAPPEAPPNNNTDPPPSPSPPRRA SP
   423  239 B S  T 3   +     0   0   91  162   85  AATNTAA SATTTA ATKTTTAS  TTRTTTCA   TSSSTSSSTTTGNTTTTTSTNSSSTSSNDDS SS
   424  240 B F  S <  S-     0   0    8  121    7  FFFFFFF FFFFFF FFFFFFFF  FFFFFFFF   FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FF
   425  241 B P        -     0   0   47  151   15  PPPPPPP PPPPPP PPPPPPPP  PPPPPPPP   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PP
   426  242 B K        -     0   0  158  154   67  KKQKKKK KKKKKK RKKKKKKK  KKNHCKQK   QKRKNKKKNSKKVKCCCCKKQKKKKKKVVVK KK
   427  243 B W        -     0   0   64  155   20  WWWWWWW WWWWWW WWWWWWWW  WWWWWWWW   WWWWWWWWWWWWWWWWWWWWWWWWWWWYYYW WW
   428  244 B A        -     0   0   91  161   77  QKAKKPP KQPKKP QPEKMKPS  PKHSSPRP   HSKKnKKKKKKKVKTSSSRRRHKKQIQEPPQ RG
   429  245 B R        -     0   0  116  151   71  PPRTRAP SAPTSA AS.PEPPP  PPKATSPS   PKPR.RRRT.RA.R.TTTRPRRRRRRRPAAR RR
   430  246 B Q        -     0   0   77  156   72  KTQNQKK GEKGGK QV.GGGVK  VGRQNMRV   VQTE.EEENeEKKDqNNNEQKKDDRERLppD NT
   431  247 B D    >>  -     0   0   86  155   74  DDDQDND NEDNND DDASSSED  DSHDQDDD   ENRDnEDDNiEP.EnQQQDNDDNFDHDPnnY .D
   432  248 B F  H 3> S+     0   0   19  161   47  LLLLPVL LLLLLL LLTLLLLL  LLILLLLL   LLLTLTIILLTWTTLLLLILLLDSLNLWLLS MV
   433  249 B S  H 34 S+     0   0   77  161   78  KQFAHGA AAASSA AANASAAA  AAGGTAQA   GAERHRRRQPRENRKTTTRAKAESALAEAAK GA
   434  250 B K  H <4 S+     0   0   98  162   78  TARSTST STTSST TTVSSSTT  TSEDSTST   DDDKNKKKATASIADNNNKAQQHAQPQTHHD tN
   435  251 B V  H  < S-     0   0   16  161   73  VFFSLVV TVVMMQ IVPHMHVL  VHTHQVVV   VILLHLLLQLLLPLQQQQLAVILLVLVFLLL lI
   436  252 B V    ><  +     0   0    0  162   51  VVLVVVV VVVVVV VVTVVVVV  VVVVLVVV   IVTVVVVVVLVCEVLLLLVVVVICVCVIVVC VV
   437  253 B P  T 3  S+     0   0   61  162   53  PPPKPPP KPPKKP PPAKKKPP  PKKPKPPP   KPPPQPPPKPPPAPKKKKPPPPPHPQPKPPK TT
   438  254 B P  T 3  S+     0   0   59  162   74  NNPQGGN NNNNNN NTINNNTN  TNNVNTTT   GNTGNGGGTDGAIDNNNNGTSSGNSNSGTTD GN
   439  255 B L  S <  S-     0   0   18  162   32  LLMLLLL LLLLLL LLRLLLLL  LLLLLLLL   FLLLLLLLLMLLELMLLLLLLLLLLLLLLLL LL
   440  256 B D        -     0   0   77  162   43  DDDDEEE DGDDDE EDEDDDDD  EDDDDEDE   EDDEDEEEDDEDSEDDDDEGDDEGNDNDDDD ED
   441  257 B E  S    S+     0   0  150  162   67  PPKNEPS KSAKKP PSHEKEAT  PESESPPP   APNREREEENEENESADAEPPSREEEEDAAA PE
   442  258 B D  S >> S+     0   0   52  162   79  ADDVDLA NVANSA ASENNNSA  SNQDDALL   DHENVNNNNKNAEDANNNSQQHHHHQHTDDH AT
   443  259 B G  H 3> S+     0   0    0  162   15  GGAGGGG GGGGGG GGAGGGGG  GGGGGGGG   GGGGGGGGGAGGAGGGGGGGGGGGGGGGGGG GG
   444  260 B R  H 34 S+     0   0   53  162   64  LVILLII ILLIIL LLHLLLLF  ILLLIIIL   IVVLMLLLVILVYLLIVIIVIILLLLLIVVL LL
   445  261 B S  H <> S+     0   0   38  162   29  DDDDDDD DDNDDD DDEDDDDD  DDDDDDDD   DDDDDDAADDDDDDDNNDADDDRDDDDDDDE ED
   446  262 B L  H >X S+     0   0    1  162    1  LLLLLLL LLLLLL LLLLLLLL  LLLLLLLL   LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL LL
   447  263 B L  H 3X S+     0   0    0  162    7  LLLLLLL LLLLLL LLILLLLL  LLLLILLL   ILLLLLLLLLLLFLLIIILLLLLLLLLLLLL LL
   448  264 B S  H 34 S+     0   0   40  161   78  STTLESS TSSGAS SSMSASSG  SSSRQSAS   AEKDQDDDENDRMDQQQQEADDDEDEESEEE ED
   449  265 B Q  H X< S+     0   0   74  161   69  RKNRAKK KKSKKS KKSKKKKK  KKKARKRK   QQNAKAAAAKASKAKSRKARKKAAKMKKQQM ML
   450  266 B M  H 3< S+     0   0    1  161   28  MMLTLMM MMMMTT MMMMMMMM  MMMMMMLM   TLLMMMMMMMLLMLCMMMMMLLLMLMLMMML LL
   451  267 B L  T 3< S+     0   0    8  161    8  LLLLLLL LLLLLC LLLLLLLL  LLLLLVLL   LLLLLLLLLLLLLLLLLLLLLLLLVLVLLLL LL
   452  268 B H    <   -     0   0   47  161   85  HLKEEIC IRCIIR RRRIIVRC  RVITIRRC   VTVEIEEEIVEQVEIIIIEVAAEVTVTKQQV EV
   453  269 B Y  S    S+     0   0    7  161   37  LMYYYLL YFLYYL YLYYYYLL  LYYYYLYL   YYYYYYYYYYYYYYYYYYYYYYFYYYYLYYY YY
   454  270 B D    >>  -     0   0   13  161   34  DDDDDED DEDDDD EDDDNDDD  DDDDDDND   DDDDDDDDDNDSDDDDDDDTDDDDDDDDDDD DD
   455  271 B P  T 34 S+     0   0   35  161    4  PPPPPPP PPPPPP PPPPPPPP  PPPTPPPP   PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP PP
   456  272 B N  T 34 S+     0   0  126  161   75  SSNAASS PSSLPT SSNAPASS  SATTVSSS   AAAAVAAASAAENAVVIVAQIIAAIAINAAA AA
   457  273 B K  T <4 S+     0   0  118  161   70  KKKKRRR KKKKKR KKLKKKTK  KKKKHKER   HGSRKRRRAMRKGRHHHHRHNNRGHGHQKKG RG
   458  274 B R  S  < S-     0   0   11  161    1  RRRRRRR RRRRRR RRRRRRRR  RRRRRRRR   RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RR
   459  275 B I        -     0   0   18  161   17  IILIIII IIIIII IIIIIIII  IIIIIIII   IIIIIIIIIIIIIIIIIIIIIIMLIIIIIII II
   460  276 B S     >  -     0   0   73  161   38  TNSSSTT STTSST TNSSSSTT  TSNSSTTN   SSSSSSSSTSSSSSSSSSSTSSSSSSSTTTS SS
   461  277 B A  H  > S+     0   0    5  161    5  GAAAAAA AAAAAA AAAGAGAA  AGAAAAAA   AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AA
   462  278 B K  H  > S+     0   0  168  161   58  RRRKKRR RRRRRR RRKKRKRK  RKAKKRRR   KKKKKKKKRRKKKKKKQKKSRRKKKKKKAAK KK
   463  279 B A  H  > S+     0   0   50  161   71  SAKEQTS QQIQQG QADMEMAS  AMGRDAAT   RRRQDQQQDDQYNQKDDDQARRQARQRQDDA QQ
   464  280 B A  H  < S+     0   0    1  161   16  AAAAAAA AAAAAA AAAAAAAA  AAAAIAAA   AAAAAAAAAAAAAAIIIISAAAAAAAAAAAA AT
   465  281 B L  H  < S+     0   0   45  161   39  LLLLCLL MLVMML LLLLMLLL  LLLRLLLL   LLLCRCCCLLCTMCLLLLCLVVRVVCVIMMY CV
   466  282 B A  H  < S+     0   0   69  161   81  EETNMEE TEETTE EEKNTNEE  ENQTDEEE   QMLMRIIIQKMQIMEEMEVDVISNTNTEVVN AI
   467  283 B H  S >< S-     0   0   16  161    4  HHHHHHH HHHHHH HHHHHHHH  HHHHHHHH   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH HH
   468  284 B P  G >  S+     0   0   74  161   39  EDKSPEE PEEPPE EETPPPEE  DPPPPEPE   PPPPRPPPKQPRPPKPPPPPPPPPPPPPPPP PP
   469  285 B F  G 3  S+     0   0    7  161    4  YYYYYYY YYYYYY YYYYYYYY  YYYYYYWY   YYYYYYYYYYYWYYYYYYYYYYYYYYYYYYY YY
   470  286 B F  G X  S+     0   0    4  160    1   FFFFFF FFFFFF FFFFFFFF  FFFFFFFF   FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF FF
   471  287 B Q  T <  S+     0   0  147  154   70   KKQAKK DKKDDK KKHNDNKK  RSSDNRSK   DQQQRQQQDDQDDRDNQNRDQQREKEKKSSE AG
   472  288 B D  T 3  S+     0   0  127  149   41   DDDHDD DDDDDD DDDDDDDD  DDDGGD D   TEGAGAAAN  DDNGGGGSEQ HDDDDEDDP QG
   473  289 B V    <   +     0   0   41  123   44   LVL VI LIILLI LLVLLLLI  LLLLFL L   V   V   L  YV FFFF I   D Y  LLL  M
   474  290 B T        -     0   0   95  103   63   GTD GG DE DD  EEQDDDEG  EDN  E D   N   K   D  RE DQEQ R   D P  SS   N
   475  291 B K        -     0   0  110   89   74          K  KK  M HNKN R  HNH  H V       L   K  EH RAAS D   E R  PP   G
   476  292 B P        -     0   0   28   75   78          S  TS     QSQ    AQ   A S       P      H  RDGG Q   P Q  AA   D
   477  293 B V        -     0   0   97   48   78                    I I     I     L              I  VLLL M   M    LL   T
   478  294 B P        -     0   0   16   42   83                    K K     K                    G     V R   P    TT   R
   479  295 B H              0   0  170   36   76                    K K     K                    R     R          EE   H
   480  296 B L              0   0   78   25    3                    M M     M                                           
## ALIGNMENTS  141 -  210
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....5....:....6....:....7....:....8....:....9....:....0....:....1
     1   21 A E              0   0  205   67   16     E          DEAA              ED   E          E     E     E         
     2   22 A D    >   +     0   0   66   69   46     E          EEEE              EE   E          E     E     E         
     3   23 A E  B 3  S+a   38   0A 100   72   33     Q          DEEE              EQ   E          E     Q     Y         
     4   24 A Q  T 3  S+     0   0  153   73   71     L          LHQQ              TL   T          Q     L     Q         
     5   25 A T  S <  S-     0   0   77   75   47     T          TTTT              TT   T          T     T     L         
     6   26 A P        -     0   0   85   78    8     P          PPPP              PP   P          P     P     P        P
     7   27 A I        -     0   0   17   79   35     L          LLLL              FF   F          F     L     V        L
     8   28 A H        -     0   0  136   79   55     H          HQLL              QH   Q          Q     H     Q        Q
     9   29 A I        -     0   0   14   79   14     I          IIII              II   I          V     V     V        V
    10   30 A S  E     -B   25   0B  11   79   45     S          SSSS              SS   S          S     S     T        D
    11   31 A W  E     -B   24   0B  86   80    8     W          WWWW              WW   W          W     W     W        W
    12   32 A L  E     -B   23   0B   9   81    7     L          LLLL              LL   L          L     V     L        L
    13   33 A S  E     -B   22   0B  39   81   58     P          PSPP              SP   S          P     P     P        S
    14   34 A L    > > +     0   0    0   82   17     L          LLLL              LL   L          L     L     L        L
    15   35 A S  G > 5 +     0   0   64   81   20     S          SSSS              SS   S          .     S     S        S
    16   36 A R  G 3 5S+     0   0  161   82   90     V          AVVV              MM   M          S     V     M        S
    17   37 A V  G < 5S-     0   0    4   82   48     V          VVVV              VV   V          P     V     V        V
    18   38 A N  T < 5S+     0   0  141   82   69     E          EEEE              EE   E          A     E     N        G
    19   39 A C      < -     0   0   29   79   49     C          SSWW              CC   C          Y     C     S        C
    20   40 A S  S    S+     0   0   84   79   48     S          SSSS              SS   S          S     S     T        E
    21   41 A Q        -     0   0   37   82   44     Q          QQQQ              QQ   Q          Q     Q     Q        E
    22   42 A F  E     -B   13   0B 105   82   68     F          FFFF              SF   S          F     F     F        S
    23   43 A L  E     -B   12   0B   0   83   11     L          LLLL              LL   L          L     L     L        L
    24   44 A G  E     -Bc  11 117B   0   82    5     G          GGGG              GG   G          G     G     G        G
    25   45 A L  E     +Bc  10 118B   1   82   26     I          IIII              II   I          I     I     I        I
    26   46 A C        -     0   0    2   81   35     C          CCCC              CC   C          S     C     .        C
    27   47 A A        -     0   0   44   79   57     A          GSAA              SA   S          S     G     .        A
    28   48 A L    >   -     0   0    4   79    5     L          LLLL              LL   L          L     L     .        L
    29   49 A P  T 3  S+     0   0    0   79    0     P          PPPP              PP   P          P     P     .        P
    30   50 A G  T 3  S+     0   0    0   79    3     G          GGGG              GG   G          G     G     .        G
    31   51 A C    <   -     0   0    4   77    8     C          CCCC              CC   C          C     C     .        C
    32   52 A K        +     0   0   37   79   28     K          KRKK              RK   R          R     R     .        R
    33   53 A F  B >  S-F   36   0C  25   82   27     Y          YYYY              YY   Y          F     Y     .        F
    34   54 A K  T 3  S-     0   0   81   82    8     K          KKKK              KK   K          K     K     .        K
    35   55 A D  T 3  S+     0   0  118   82   22     D          NEDD              ED   E          N     D     .        E
    36   56 A V  B <   +F   33   0C  58   82   61     V          IVVV              NT   N          I     I     .        T
    37   57 A R        +     0   0   75   82   27     R          RRRR              RR   R          K     R     .        W
    38   58 A R  B     -a    3   0A  48   82    0     R          RRRR              RR   R          R     R     .        R
    39   59 A N     >  -     0   0   64   82   37     S          DNNN              NS   N          N     S     .        S
    40   60 A V  H  > S+     0   0   15   81   36     L          LLLL              LL   L          L     L     .        L
    41   61 A Q  H  > S+     0   0   84   83   46     E          QEQQ              QE   Q          Q     D     C        D
    42   62 A K  H  > S+     0   0   98   83   47     R          RKKK              KR   K          K     R     A        A
    43   63 A D  H  X S+     0   0    3   83    3     D          DDDD              DD   D          D     D     L        D
    44   64 A T  H  X S+     0   0    2   84   69     V          VVII              Vs   V          I     M     P        L
    45   65 A E  H  X S+     0   0   97   84   37     E          EGGG              Ae   A          D     E     E        E
    46   66 A E  H  X S+     0   0   57   85   48     E          EDEE              EE   E          E     E     A        D
    47   67 A L  H  X>S+     0   0    0   85   16     L          LLLL              ML   M          L     L     L        L
    48   68 A K  H ><5S+     0   0   86   84   56     Q          HCRR              CQ   C          K     Q     W        K
    49   69 A S  H 3<5S+     0   0   89   84   73     N          NAGG              DN   D          G     N     R        A
    50   70 A C  H 3<5S-     0   0   52   84   96     Q          QEQQ              QQ   Q          H     Q     H        Q
    51   71 A G  T <<5 +     0   0   37   83   20     G          GGGG              GG   G          G     G     S        S
    52   72 A I      < +     0   0    1   83   23     V          VVVV              VV   V          V     V     I        I
    53   73 A Q        +     0   0   64   83   49     Q          QEEE              EQ   E          L     Q     Q        R
    54   74 A D  E     -de  82 116B   9   83   27     E          DDEE              DE   D          D     E     D        D
    55   75 A I  E     -de  83 117B   0   83   16     V          VVVV              VV   V          V     V     V        I
    56   76 A F  E     -de  84 118B   0   83   19     F          LFFF              FF   F          F     F     F        F
    57   77 A V  E     -de  85 119B   0   83   24     V          VVVV              VI   V          V     V     V        V
    58   78 A F        +     0   0    0   83   11     F          FFFF              FF   F          L     F     F        L
    59   79 A C  S    S-     0   0    0   83   26     C          CCCC              CC   C          C     C     C        C
    60   80 A T    >>  -     0   0   36   83   12     S          TTTT              TT   T          T     T     T        T
    61   81 A R  H 3> S+     0   0  157   83   39     R          RRRR              RR   R          K     R     K        R
    62   82 A G  H 3> S+     0   0   53   83   18     A          GGGG              GG   G          G     A     G        G
    63   83 A E  H <> S+     0   0   14   83    0     E          EEEE              EE   E          E     E     E        E
    64   84 A L  H  <>S+     0   0    1   83    7     L          LLLL              LL   L          L     L     M        L
    65   85 A S  H ><5S+     0   0   67   83   67     H          SVQQ              VN   V          T     H     G        N
    66   86 A K  H 3<5S+     0   0  141   83   42     R          RRKK              RK   R          K     W     K        K
    67   87 A Y  T 3<5S-     0   0    6   83    5     Y          YYYY              YY   Y          Y     Y     Y        Y
    68   88 A R  T < 5S+     0   0  130   83   21     R          RRRR              RR   R          R     R     R        R
    69   89 A V    > < +     0   0    0   83    6     V          VVVV              VV   V          V     V     V        V
    70   90 A P  T >  S+     0   0   69   83   21     P          PPPP              PP   P          P     P     P        P
    71   91 A N  T >> S+     0   0   63   83   70     S          TCQQ              CS   C          H     S     G        R
    72   92 A L  H <> S+     0   0    0   83    5     L          LLLL              LL   L          L     L     L        L
    73   93 A L  H <> S+     0   0    5   83   29     L          LLII              LL   L          M     L     L        L
    74   94 A D  H <> S+     0   0   77   83   36     D          EEEE              EE   E          E     D     E        E
    75   95 A L  H  < S+     0   0   16   83   85     V          AHVV              VV   V          T     A     S        R
    76   96 A Y  H ><>S+     0   0    2   83   14     Y          YYYY              YY   Y          Y     Y     Y        Y
    77   97 A Q  H ><5S+     0   0   89   83   58     Q          ETKK              SR   S          Q     R     Q        E
    78   98 A Q  T 3<5S+     0   0  140   83   50     Q          RQQQ              QQ   Q          N     Q     R        D
    79   99 A C  T < 5S-     0   0   25   83   90     R          RRQQ              RR   R          Y     R     Q        A
    80  100 A G  T < 5S+     0   0   47   83    7     G          GGGG              GG   G          G     G     G        D
    81  101 A I      < -     0   0    8   83   33     F          LLLL              LF   L          I     F     F        F
    82  102 A I  E     -d   54   0B  73   83   83     C          TRSS              RA   R          T     S     T        T
    83  103 A T  E     -d   55   0B  33   83   58     V          VVVV              VV   V          V     V     V        V
    84  104 A H  E     -d   56   0B  26   83   20     H          QHHH              HH   H          H     H     H        H
    85  105 A H  E     +d   57   0B  55   84   13     H          HHHH              HH   H          H     H     H        H
    86  106 A H        -     0   0   16   84   68     M          WLRR              FT   F          H     M     Y        H
    87  107 A P        -     0   0   64   84    4     P          PPPP              PP   P          P     P     P        S
    88  108 A I        -     0   0    3   84   36     F          IFFF              FF   F          I     F     F        F
    89  109 A A    >   -     0   0   68   84   52     P          PPPP              PP   P          P     P     P        P
    90  110 A D  T 3  S+     0   0   41   85    4     D          DDDD              DD   D          D     D     D        D
    91  111 A G  T 3  S+     0   0   22   85   11     G          GGGG              GG   G          G     G     G        G
    92  112 A G  S <  S-     0   0   18   85   66     D          EGGG              GD   G          G     D     N        T
    93  113 A T        -     0   0   52   86   59     V          AATT              AA   A          T     V     V        S
    94  114 A P        -     0   0    7   86    0     P          PPPP              PP   P          P     P     P        P
    95  115 A D    >>  -     0   0  108   86   46     E          EEEE              EE   E          D     E     D        A
    96  116 A I  H 3> S+     0   0   38   86   44     L          LLLL              LL   L          I     L     I        M
    97  117 A A  H 3> S+     0   0   48   86   56     E          EPEE              YE   Y          A     E     S        A
    98  118 A S  H <> S+     0   0   24   86   77     Q          QQQQ              QQ   Q          R     Q     S        A
    99  119 A C  H  X S+     0   0    1   86   50     C          CCCC              CC   C          C     C     C        C
   100  120 A C  H  X S+     0   0   14   86   75     C          CCCC              SC   S          C     S     S        V
   101  121 A E  H  X S+     0   0   96   86   73     R          RRQQ              CQ   C          V     Q     K        K
   102  122 A I  H  X S+     0   0    1   86   21     I          IIII              VI   V          I     I     I        L
   103  123 A M  H  X S+     0   0    0   86   16     L          LLLL              LL   L          L     L     L        L
   104  124 A E  H >X S+     0   0   96   86   37     E          DEEE              ED   D          N     E     E        E
   105  125 A E  H 3X S+     0   0   55   86   28     E          EEEE              EE   E          E     E     E        E
   106  126 A L  H 3X S+     0   0    0   86   13     L          LLLL              LL   L          L     L     L        M
   107  127 A T  H S+     0   0    5   86   61     S          HSSS              CS   C          C     S     C        C
   110  130 A L  H ><5S+     0   0    2   85   13     L          LLLL              LL   L          L     L     L        L
   111  131 A K  H 3<5S+     0   0  152   85   70     E          EQQQ              QQ   Q          E     E     E        S
   112  132 A N  T 3<5S-     0   0   98   85   48     N          GNNN              NN   N          I     N     N        Q
   113  133 A Y  T < 5 +     0   0  170   85   75     N          GQNN              QN   Q          V     N     D        G
   114  134 A R      < -     0   0   87   85   42     R          RHRR              RR   R          M     R     K        K
   115  135 A K        -     0   0   89   84   29     R          KRRR              RR   R          E     R     K        K
   116  136 A T  E     - e   0  54B   0   85   43     T          TTVV              TT   T          D     T     T        T
   117  137 A L  E     -ce  24  55B   0   85   20     V          LVVV              VV   V          L     L     L        L
   118  138 A I  E     +ce  25  56B   0   85   17     I          IMMM              II   I          D     I     I        I
   119  139 A H  E     - e   0  57B   0   85    9     H          HHHH              HH   H          D     H     Q        H
   120  140 A S        -     0   0    0   86    6     C          CCCC              CC   C          P     C     C        C
   121  141 A Y  S    S+     0   0   26   86   27     Y          FYYY              YY   Y          V     Y     Y        Y
   122  142 A G  S    S-     0   0   23   86    4     G          GGGG              GG   G          S     G     G        G
   123  143 A G  S    S+     0   0    2   87    3     G          GGGG              GG   G          I     G     G        G
   124  144 A L  S    S+     0   0   43   87    7     L          LLLL              LL   L          A     L     L        L
   125  145 A G  S >> S+     0   0    4   87    3     G          GGGG              GG   G          P     G     G        G
   126  146 A R  H 3> S+     0   0    2   88    6     R          RRRR              RR   R          p     R     R        R
   127  147 A S  H 3> S+     0   0    0   86   21     S          SSSS              SS   S          k     S     S        S
   128  148 A C  H <> S+     0   0    0   87   47     G          AGGG              GG   G          C     G     C        C
   129  149 A L  H  X S+     0   0    1   89   10     L          LLLL              LL   L          l     L     L        L
   130  150 A V  H  X S+     0   0    1   84   26     I          IIMM              II   I          v     .     I        V
   131  151 A A  H  X S+     0   0    0   89   15     A          AAAA              AA   A          A     I     A        A
   132  152 A A  H >X S+     0   0    0   89    6     A          AAAA              AA   A          A     A     A        A
   133  153 A C  H 3X S+     0   0    1   89    9     C          CCCC              CC   C          C     A     C        C
   134  154 A L  H 3X S+     0   0    0   89   13     L          LLLL              LL   L          L     C     L        L
   135  155 A L  H >  -     0   0   38   89   67     T          TTTT              TT   T          N     T     F        D
   144  164 A P  H 3> S+     0   0   24   89   28     E          APPP              PA   P          P     E     P        P
   145  165 A E  H 3> S+     0   0  108   89   49     N          SSDD              SN   S          Q     N     E        Q
   146  166 A Q  H <> S+     0   0   93   88   52     K          DKKK              TK   T          Q     Q     Q        A
   147  167 A A  H  X S+     0   0    0   88   29     V          AAAA              AA   A          A     V     A        A
   148  168 A I  H  X S+     0   0    4   88   14     I          IIII              LI   L          I     I     I        L
   149  169 A D  H  X S+     0   0   77   88   51     E          KEEE              EE   E          D     E     D        Q
   150  170 A S  H  X S+     0   0    6   88   83     I          LIII              II   I          C     I     L        R
   151  171 A L  H  X>S+     0   0    0   88   22     L          LLLL              LL   L          M     L     L        V
   152  172 A R  H  X5S+     0   0   48   88   22     R          RRRR              RR   R          R     R     R        Q
   153  173 A D  H  <5S+     0   0  137   88   37     E          EEEE              EE   E          E     E     E        Q
   154  174 A L  H  <5S+     0   0   35   88   40     H          LLLL              LH   L          L     H     L        V
   155  175 A R  H  <5S-     0   0   62   88    6     R          RRRR              RR   R          R     R     R        R
   156  176 A G    ><< -     0   0   33   86    7     G          GGGG              GG   G          G     G     G        G
   157  177 A S  T 3  S+     0   0   80   87   58     G          RSAA              AG   A          S     G     A        H
   158  178 A G  T 3   +     0   0   16   87   45     G          GGGG              GG   G          G     G     G        G
   159  179 A A  S <  S+     0   0    0   88    2     A          AAAA              AA   A          A     A     A        A
   160  180 A I  S    S+     0   0    1   88    5     I          IIII              II   I          I     I     I        V
   161  181 A Q        +     0   0   20   88   11     Q          QQQQ              QQ   Q          Q     Q     Q        Q
   162  182 A T  S  > S-     0   0   21   88   21     T          TTTT              TT   T          T     T     T        T
   163  183 A I  H  > S+     0   0    0   88   37     V          VVVV              VV   V          L     V     V        V
   164  184 A K  H  > S+     0   0   65   88   20     K          KKKK              KK   K          K     K     K        R
   165  185 A Q  H  > S+     0   0   10   85    0     Q          QQQQ              QQ   Q                Q     Q        Q
   166  186 A Y  H  X S+     0   0   39   84   24     Y          YYYY              YY   Y                Y     Y        Y
   167  187 A N  H  X S+     0   0    8   84   14     N          NNNN              NN   N                N     N        N
   168  188 A Y  H >X S+     0   0   20   84    4     F          FFFF              FF   F                F     Y        F
   169  189 A L  H >X S+     0   0    1   84   19     L          LLLL              LL   L                L     L        L
   170  190 A H  H 3< S+     0   0   72   84   27     H          HHHH              HH   H                H     H        N
   171  191 A E  H  S+     0   0  118   83   40     E          EEEE              EE   E                E     E        K
   175  195 A K  H  < S+     0   0   92   81   54     K          KKRR              KK   K                K     N        N
   176  196 A L  H >< S+     0   0   43   79   52     Y          LFSS              FY   F                Y     M        L
   177  197 A A  H 3< S+     0   0   61   78   41     K          AAAA              ET   E                S     A        E
   178  198 A A  T >< S+     0   0   57   78   43     A          AAAA              AT   A                A     N        E
   179  199 A H  T <   +     0   0   85   78   52     Y          RYYY              YF   Y                Y     Y        Y
   180  200 A L  T 3   +     0   0  131   74   46     V           QQQ              QQ   Q                L     L        E
   181  201 A S    <   +     0   0   82   73   63     E           EAA              EE   E                E     A        A
   182  202 A S              0   0  120   72   57     S           TTT              TS   T                R     T        S
   183  203 A R              0   0  282   67   29     R           KKK              K    K                R     K         
   184      ! !              0   0    0   0     0  
   185    1 B M              0   0  221  130    9  MLM MLMMMMMMLM    LMMMMLMMM  MMM  MIM  M MLMMMML MM MM MMMM  M    MMM 
   186    2 B E        -     0   0  105  150   38  END EAEEDDEEVK    SEQQDQQQEEEQQL  QAQ  QEDDQQEDN EDEEE QEEEE D    DDD 
   187    3 B N  S    S+     0   0   43  157   69  KDN NNNNNNKNNG    RNKKSNKKNRRKKK  KNK SKRKRKKKNS KLAAK KKRNA AQQQSALL 
   188    4 B F  B     -G  207   0D  42  158    2  YFY FYYYYYYYYY    YYYYYYYYYYYYYY  YYY FYYYYYYYYF YFYFY YYYYF YFFFFFYY 
   189    5 B Q        -     0   0   79  158   54  QIQ SKQQQQQQKH    QQEEHSEEQQEDDD  EKE QEQENEEEQQ EEEEE EETEE EQKKQEEE 
   190    6 B K        +     0   0  106  158   47  KKR TRKKRRKKRK    KKKKKRKKKKKKKK  KKK RKKKRRKKKQ KKKKK KKKKK KQQQQKKK 
   191    7 B V        +     0   0   77  158   35  LLI VLLLIILLLL    LMLLLILLLLLMMM  LIL LLLLLLLLLL LLLLL LLQIL LLLLLLLL 
   192    8 B E        -     0   0  116  158   22  EEE EEEEEEEEEE    EEEEEEEEEEEEEE  EEE EEEEDEEEEE EEEEE DEEEE EEEEEEEE 
   193    9 B K  E     +I  203   0E  98  158   30  KKK KKKKKKKKKK    KKKKKKKKKKKKKK  KKK KKKKVKKKKK TKKKK KKKKK KKKKKKKK 
   194   10 B I  E     -     0   0E  32  158   17  IIV IVIIVVVIVI    LVIIIIIIVIIIII  III LIIVLIIVIL VVIVV IVAVV ILLLLVVV 
   195   11 B G  E     -I  202   0E  23  159    5  GGG GGGGGGGGGG    GGGGGGGGGGGGGG  GGG GGGGGGGGGG GGGGG GGGGG GGGGGGGG 
   196   12 B E        +     0   0  129  159   13  EEE EEEEEEEEEE    EEEEEEEEEESEEE  EEE EEEEEEEEQE EEQEE EEQEE EENNEEEE 
   197   13 B G        -     0   0   50  162    0  GGG GGGGGGGGGG    GGGGGGGGGGGGGG  GGG GGGGGGGGGG GGGGG GGGGG GGGGGGGG 
   198   14 B T  S    S-     0   0  141  162   11  TTT TTTTTTTTTT    TTTTTTTTTTTTTT  TTT TTTTTTTTAT TTTTT TTTTT TTTTTTTT 
   199   15 B Y  S    S+     0   0   59  162    0  YYY YYYYYYYYYY    YYYYYYYYYYYYYY  YYY YYYYYYYYCY YYYYY YYYYY YYYYYYYY 
   200   16 B G        -     0   0   20  162    5  GGG GGGGGGGGGG    GGGGGGGGGGGGGG  GGG AGGGGGGGGA GGGGG GGGGG GAAAAGGG 
   201   17 B V        -     0   0   10  162   60  VVV VVVVVVVVVV    KVTTVVTTVLVTTT  TVT TTLKVTTKAT KKKKK TKVKK KTTTTKKK 
   202   18 B V  E     -I  195   0E  40  162    0  VVV VVVVVVVVVV    VVVVVVVVVVVVVV  VVV VVVVVVVVIV VVVVV VVVVV VVVVVVVV 
   203   19 B Y  E     -I  193   0E  49  162    2  YYY YYYYYYYYYY    YYFFYYFFYYYFFF  FYF YFYYYFFYYF YYYYY FYYYY YYYYFYYY 
   204   20 B K        +     0   0   76  162    6  KKK KKKKKKKKKK    KKKKKKKKKKKKKK  KKK KKKKRKKKKK KRKRK KKKKR KKKKKRKK 
   205   21 B A        -     0   0    1  162   21  AGA AAAAAAAAAA    AAAAAGAAAAAGGG  AAA GAAAAAAAAG AAAAA AASAA AGGGGAAA 
   206   22 B R        -     0   0  133  162   51  QKR KLRKRRKRLQ    KRKKQIKKRRLRRR  KIK RKRKVKKQRR QRRRM KQWRR RRLLRRRR 
   207   23 B N  B  >  -GH 188 211D  45  162   44  DND DDDDDDDDDN    EDNNNDNNDDDNNN  NYN NNDDDNNDDN DEEED NDDDE DNNNNEEE 
   208   24 B K  T  4 S+     0   0  112  161   76  HVL RLLLLLSLLD    KLRRPKRRLNKRRR  RQR RRNKKRRRLR RKRKK RKNKK IRKKGKKK 
   209   25 B L  T  4 S-     0   0  132  162   86  TKS VRLSSSQLRH    ASEEHREEAQLDDD  EPE QEQTIEEAAH AATAA EAENA NTTTQAAA 
   210   26 B T  T  4 S-     0   0   98  162   53  GTH TPNHHHGNHG    TTTTGSTTNTNTTT  TDT TTTSTTTTNT TTTTT TTTTT TTTTTTTT 
   211   27 B G  B  <  +H  207   0D   7  162   55  EDN GggpNNRgAE    GpHHEGHHgGGMMM  HKH GQGGGQHGGG GGGGG LGNGG GGGGGGGG 
   212   28 B E        -     0   0  148  159   62  IQg QqrrggIrq.    RnEE.KEErEQEEE  ETE EEDQQEEQeE QKRMQ EQERK KQAEQTRR 
   213   29 B V        -     0   0   95  142   49  .Li EvIIii.IiI    .iIIMMIIIIIIII  ITI .IIVYIILi. LILIV IVFLI L....III 
   214   30 B V        -     0   0    9  161   26  SVV IVVVVVVVVF    .VVVFVVVVVVVVV  VVV MVVVVVVVVF VVVVV VVVVV VLYFFVVV 
   215   31 B A        -     0   0   12  162    8  AAA AAAAAAAAAA    MAAAAAAAAAAAAA  AAA VAAAAAAAAV AAAAA AAAAA AVVVVAAA 
   216   32 B L        -     0   0   12  162   17  LML LLLLLLLLLL    VLLLLMLLLLVLLL  LLL ALLLLLLLLA LLLLL LLLLL LAAAALLL 
   217   33 B K        -     0   0   23  162   11  KKK KKKKKKKKKK    AKKKKKKKKKKKKK  KKK LKKKKKKKKL KKKKK KKKKK KLLLLKKK 
   218   34 B K        +     0   0   12  162   19  KKK KKKKKKRKKK    LKRRKKRRKKKRRR  RKR KRKKKRRKKK KKKKK RKKKK KKKKKKKK 
   219   35 B I        -     0   0   12  162   37  III IIIIIIIIII    KIVVIIVVIIMVVV  VIV EVITVVVTIE TTTTT VTITT TEEEETTT 
   220   36 B R        +     0   0  100  162   20  RRR KRRRRRRRRR    KRRRRRRRRRTRRR  RRR IRRRRRRRRI RRRRR RRKRR RIVVIRRR 
   221   37 B L        -     0   0   33  162   32  LLL LLLLLLLLMV    ILLLVLLLLMQLLL  LVL HLMLLLLLLH LLLLL LLVLL LNKKHLLL 
   222   38 B D        -     0   0   96  162   36  EEE EEEEEEDEEE    REDDEEDDEDEDDD  DED LDDEDDDEEL EHEHE DEEEH ELLLLHPP 
   223   39 B T  S    S+     0   0   75  161   78  AST NSAATTAASE    LADDENDDDHLEEE  DGD DDHMRDEMAD MEMEM DMLME MDDDDEEE 
   224   40 B E  S    S+     0   0  158  161   30  EEE EEEEEEEEEE    EEDDEEDDDEEDDD  DDD SDEDTDDDES DDEDD DDEED ESSSSDDD 
   225   41 B T  S    S-     0   0   43  161   36  DDD PDDDDDDDDD    DDDDDDDDDDQDDD  DDD EDDEEDDEDE EDEED DDDED EEEEEEDD 
   226   42 B E  S    S-     0   0   70  160   11  EEE EEEEEEEEEE    DEEEEEEEEEEEEE  EEE EEEEEEEEEE EEEEE EEDEE EEEEEEEE 
   227   43 B G  S    S-     0   0   77  160    1  GGG GGGGGGGGGG    GGGGGGGGGGGGGG  GGG GGGGGGGGGG GGGGG GGGGG GGGGGGGG 
   228   44 B V  S    S-     0   0   85  160   22  IVV VVVVVVIVVI    VVVVIVVVVVVVVV  VVV TVVVIVVIVT IVVVI VIIVV VTTTTVVV 
   229   45 B P     >  -     0   0   26  160    7  PPP PPPPPPPPPP    PPPPPPPPPPPPPP  PPP PPPPPPPPPP PPPPP PPPPP PPPPPPPP 
   230   46 B S  H  >> +     0   0   87  160   38  SAS SSSSSSSSSS    SSSSSASSSSSSSS  SSS SSSPQSSPSS PPSPP SPGSP SSSSSSPP 
   231   47 B T  H  45S+     0   0   56  160   27  TTT TTTTTTTTTT    TTSSTTSSTTTSSS  STS TSTTTSSTTT TTTTT STTTT TTTTTTTT 
   232   48 B A  H  >>S+     0   0    1  160   19  AAA AAAAAAAAAA    AAAAAAAAAAAAAA  ASA AAAAAAAASA ATATA AAATT TAAAATAA 
   233   49 B I  H  X5S+     0   0  106  161   19  IVI LIIIIIIIII    LILLIILLIIILLL  LIL ILILLLLLII LLLLL LLLLL LIIIILLL 
   234   50 B R  H  X5S+     0   0   38  161    1  RRR RRRRRRRRRR    RRRRRRRRRRRRRR  RRR RRRRRRRRRR RRRRR RRRRR RRRRRRRR 
   235   51 B E  H  >X   -     0   0   25  160   36  HHH HDDDHHHDDH    HHHHHHHHDHNHHH  HHH HHHsHHHsHH sdsds HsHsd sHHHHddd 
   245   61 B P  T 3  S+     0   0   91  160   63  PPP PDPPPPPPDP    PPKKPPKKPPPKKK  KEK EKPLPEKVPE LPAPL KLPNP NEEEEPPS 
   246   62 B N  T 3  S+     0   0   11  160   20  NNN ANNNNNNNNN    NNNNNNNNNNHNNN  NNN NNNYNNNYNN YHFHY NYNHH HNNNNHHH 
   247   63 B I  S <  S-     0   0    2  160   12  IIV VIVIVVIIII    VVIIIIIIVIIIII  III IIIVIIVVII VIVIV IVIIV VIIIIIVV 
   248   64 B V        -     0   0    9  160    3  VVV VVVVVVVVVV    VLVVVVVVLVVVVV  VVV LVVVVVVVLV VVVVV VVVVV VVVVVVVV 
   249   65 B K        -     0   0  116  161   55  RSS RRKRSSSQRC    SRRRRARRRPQRRR  RKR SRPRNRRRRA RRRRR RREKR KTRRSRRR 
   250   66 B L        -     0   0   17  162    9  LLL LLLLLLLLLL    LLLLLLLLLLLLLL  LLL LLLLLLLLLL LLLLL LLLLL LLLLLLLL 
   251   67 B L        -     0   0   68  162   78  REL LYLLLLIFYR    FLHHCEHHLKRICI  HIH YHKLLYYLLH LLLML YLKLL IYYYYMLL 
   252   68 B D        -     0   0   86  162   27  DEN DDNNNNDNDD    DNDDDEDDNDDDDD  DDD DDDCDDDSND SDKDA DANCD ADDDDDDD 
   253   69 B V        -     0   0   39  162   15  VVI VIIIIIVIIV    VIVVVIVVIVVVVV  VVV IVVVVVVVIV VVVVV VVCVV VVVVVVLL 
   254   70 B I  B     -J  261   0F  27  162   54  IIV MVVVVVIVVI    LVLLIILLVVVLLL  LSL ILVEIVLEVI EKEKE LEVEK EIIIIKKK 
   255   71 B H        +     0   0  160  162   64  HMH LHHHHHHHHH    HHHHHLHHVYIHHH  HLH HHYHCHHQHH QQHQQ HQHHQ HHHHHQQQ 
   256   72 B T        -     0   0   56  162   75  TQA ASAAAASASS    CASSTESSADRSSS  SDS TSDLSSSAAT AGVGT SASLG VTTTTGGG 
   257   73 B E  S    S+     0   0  161  162   40  DED SDEDDDEDDE    QDDDEEDDDENDDD  DED EEEDDEDTDE TQEIT DTDEQ EEEEELQQ 
   258   74 B N  S    S-     0   0   86  162   71  RNg saggggRgaK    NgKKKNKKsSKKKK  KEK NKSkGRKkyS knenk KkAen eNNNNsnn 
   259   75 B K  S    S-     0   0   48  161   59  RRk kkkkkkCkkC    RkKKRRKKkRKKKK  KQK KKRfKKKvnK vvmvv KvKcv cKKKKvii 
   260   76 B L        -     0   0   26  161   13  LLL LLLLLLLLLL    LLLLLLLLLLLLLL  LLL LLLLLLLLLL LLLLL LLLLL LLLLLLLL 
   261   77 B Y  B     -J  254   0F  23  161   53  TYY FYYYYYTYYT    YYTTTYTTYYQTTT  TFT MTYYYTTYYM YYYYY VYWYY YNTTMYYY 
   262   78 B L        -     0   0    0  162    5  LLL LLLLLLLLLL    LLLLLLLLLLLLLL  LLL LLLLLLLLLL LLLLL LLLLL LLLLLLLL 
   263   79 B V        -     0   0   10  162    7  VIV VVVVVVVVVV    VVVVVIVVVIVVVV  VIV VVIVVVVVVV VVVVV VVIVV VVVVVVVV 
   264   80 B F        -     0   0   20  162    4  FFM FFMMMMFFFF    FMFFFFFFLFFFFF  FFF FFFFFFFFFF FFFFF FFFFF FFFFFFFF 
   265   81 B E        -     0   0   55  162    2  EEE EEEEEEEEEE    EEEEEEEEEDEEEE  EEE EEDEEEEEEE EEEEE EEEEE EEEEEEEE 
   266   82 B F        +     0   0   40  162   23  YFF YFFFFFFFFY    YFFFYFFFFFYHHH  YFY FHFYYYHFFY FYYYF HFWYY YYYYYYYY 
   267   83 B L        -     0   0   30  162   43  LLL LLLLLLMLLL    LLCCLLCCLVMCCC  CLC MCVLVCCLLM LMLVL CLVLM LMMMMMMM 
   268   84 B H  S    S-     0   0   89  162   42  DSD NDDDDDEDDD    DDDDDYDDDDEDDD  DSD DDDDEDDDDD DDDDD DDDSD SDDDDDDD 
   269   85 B Q  E     -K  319   0G  36  162   76  QML MLLLLLKLLQ    QLQQQMQQLLRQQQ  QCQ KQLTAQQTIG TTQTT QTQTT TKNKKTTT 
   270   86 B D  E  >  -K  318   0G  20  162    2  DDD DDDDDDDDDD    DDDDDDDDDDDDDD  DDD DDDDDDDDDD DDDDD DDDDD DDDDDDDD 
   271   87 B L  H  > S+     0   0    0  162    2  LLL LLLLLLLLLL    LLLLLLLLLLLLLL  LLL LLLLLLLLLL LLLLL LLLLL MLLLLVLL 
   272   88 B K  H  > S+     0   0   84  162   26  KKK KKKKKKKKKK    KKKKKKKKKKKKKK  KKK KKKKKKKKKK KKKKK KKKKK KKKKKKKK 
   273   89 B K  H  > S+     0   0   67  162   34  KKK RRKKKKKKRK    KKKKKKKKKKAKKK  KNK KKKKKKKKRK KKGKK KKRKK KKKKKKKK 
   274   90 B F  H  < S+     0   0    9  162   40  LFY LYYYYYVYYL    YYYYLYYYYYLYYY  YYY YYYFAYYFYY FFFFF YFYYF WFYYYFFF 
   275   91 B M  H  < S+     0   0   11  162   28  LLM MMMMMMLMML    MMFFLIFFMMLFFF  FLF MFMIIFFVMM VIMIV FVMMI MMMMMIII 
   276   92 B D  H >< S+     0   0   89  162   32  DDD DEEEDDDEED    DEDDDDDDEEDDDD  DDD EDEDEDDDED DRDRD DDNDR DDDDDRRR 
   277   93 B A  T 3< S+     0   0   82  162   67  VSS LGASSSESSV    SSSSVTSSSSISSS  SKS VSSSKSSATT ASLSA SASRS RTSSSSGA 
   278   94 B S  T >> S+     0   0   22  162   87  CIL TILLLLNLIC    VLCCCVCCLVSLLL  CQC RLVHQCLFLN YFTFY LYCIF NNRRYFHH 
   279   95 B A  T <4 S+     0   0   48  162   67  DPP KPPPPPKPPD    PPNNDPNNPPPNNN  NRN NNPRENNRPG RRGRR NRKGR GGTTTRRR 
   280   96 B L  T 34 S+     0   0  160  162   83  GDV GKVVVVTVKG    AVGGGDGGVQKGGG  GRG NGQKGGGKVE KQRQR GRSKQ RNVVNSQQ 
   281   97 B T  T <4 S-     0   0  122  162   83  Ggt PdsattGsdG    LsDDGsDDaLdEEE  DaD QELpGEEgsr gtgag EgNgt gkggptnn 
   282   98 B G     <  -     0   0   14  122   78  .mg .sgggg.gp.    .g...l..g.s...  .r. ...p...pga pnpnp .p.pn paggankk 
   283   99 B I        -     0   0   21  157   44  LMM LLLMMMLLLL    .LLLLMLLL.LIII  LLL LI.MYIILML LILIL ILLLI LLLLLIII 
   284  100 B P     >  -     0   0   67  162   62  EDD PGGGDDQNGE    CGDDENDDGDDDDD  DDD NDDPSDDPNK PPKPP DPDPP PEEEDPPP 
   285  101 B L  H  > S+     0   0  104  162   85  PTE IAEDEEDQAT    PAPPPKPPDRKMMM  PQP YLRPGQLTDP TIKQT PTPLP KTLLASAV 
   286  102 B P  H  > S+     0   0   63  162   82  SKK DDNAKKSNKS    QQEESEEEAMIAAA  EIE TEMAMQDNTM NKENH NQMEP PKNHAQHP 
   287  103 B L  H  > S+     0   0    1  162   60  TLV LIIMVVQVVT    LMIITLIIIQTVVV  TTI TVQLDVVVVL VTVTV VVLIT AQLLTTTT 
   288  104 B I  H >X S+     0   0    5  162   28  TQV VVIIVVIIVA    IVVVTQVVIVICCC  VVA IVVILVVIVI IVVVV VVIVI IVVVITVV 
   289  105 B K  H 3X S+     0   0   34  162   19  KKQ KKKKQQKQQK    KRKKRKKKKKKRRR  KKK KKKQKKKKRK KKQKK KKKKK KKKKKKKK 
   290  106 B S  H 3X S+     0   0    3  162   60  SSK SKKKKKIKKS    SKSSSSSSKKKSSS  SSS DSKSRSSNKS SSDCS SSSSG SWYYSSII 
   291  107 B Y  H X S+     0   0    0  162   24  LLM LMMMMMLMML    LTLLLLLLMIIMMM  MTM MMILIMLLMM LMMML MLMMM TMQQMMMM 
   293  109 B F  H 3X S+     0   0   49  162   55  FYL RMSSLLYWMY    YLFFYYFFSYHLLL  YFY HFNYYYYYYY YYYYY YYFYY YYWWWYYY 
   294  110 B Q  H 3X S+     0   0   22  162    3  QQD QQQQDDQQQQ    QQQQQQQQQQQQQQ  QQQ QQQQQQQQQQ QQQQQ QQQQQ QQQQQQQQ 
   295  111 B L  H X S+     0   0    3  162   30  ITI VITIIIVVIV    LILLIILLILILLL  LLL VLLVLLLVVI VVCMI LILVV LILLIMVV 
   300  116 B A  H 3X S+     0   0   12  162   78  ACK AARRKKARAA    ARGGSCGGRNQAAA  ASA AANAYAAAND AAAAA AAEAA ALAAAAAA 
   301  117 B F  H 3< S+     0   0   45  162   23  YFY YYYYYYHYYY    YYFFYFFFYYAFFF  FFF FFYHFFFHYF HFHFH FHFHF HFFFFFFF 
   302  118 B C  H X<>S+     0   0    2  162   35  CCC CCCCCCCCCC    SCCCCCCCCCCCCC  CCC CCCCCCCCCC CCICC CCCMC CCCCCCCC 
   303  119 B H  H ><5S+     0   0   21  162    1  HHH HHHHHHHHHH    HHHHHHHHHHHHHH  HHH HHHHHHHHHH HHHHH HHHHH HHHHHHHH 
   304  120 B S  T 3<5S+     0   0   79  162   63  EQS ASSASSQSSE    GSSSQQSSSQQSSS  SSS HSQSRASSSQ GGRGG SGGKG KDEEEGGG 
   305  121 B H  T < 5S-     0   0   62  162   44  HRR QHHHRRHRHH    HHRRHRRRRNRHHH  RRR NNNHHHRHHN HHHHH HHRHH HNNNNHRR 
   306  122 B R  T < 5S+     0   0  164  162   42  RRR RRRRRRRRRR    RRNNHRNNRRRNNN  NRN RNRGRNNGRR GGGGG NGGGG GRKKRGGG 
   307  123 B V  E   < -M  335   0H   2  162   14  VII VIIVIIIIII    IVVVIVVVIVIVVV  VVV VIVVIVVVIV VVVVV VVIVI VVIIVIVV 
   308  124 B L  E     -M  334   0H   0  162   13  LLL LLLLLLLLLL    LLLLLLLLLILLLL  LLL LLILILLLLL LLMLL LLMML MLLLLLLL 
   309  125 B H        +     0   0    2  162    2  HHH HHHHHHHHHH    HHHHHHHHHHHHHH  HHH HHHHHHHHHH HHHHH HHHHH HHHHHHHH 
   310  126 B R        +     0   0   51  162    2  RRR RRRRRRRRRR    RRRRRRRRRRRRRR  RRR RRRRRRRRRR RRRRR RRRRR RRRRRRRR 
   311  127 B D        +     0   0   22  162    0  DDD DDDDDDDDDD    DDDDDDDDDDDDDD  DDD DDDDDDDDDD DDDDD DDDDD DDDDDDDD 
   312  128 B L        +     0   0    4  162    1  LLL LLLLLLLLLL    LLLLLLLLLLLLLL  LLL LLLLLLLLLL LLLLL LLLLL LLLLLLLL 
   313  129 B K  S >  S-     0   0   28  162    0  KKK KKKKKKKKKK    KKKKKKKKKKKKKK  KKK KKKKKKKKKK KKKKK KKKKK KKKKKKKK 
   314  130 B P  G >  S+     0   0    4  162    1  PPP PPPPPPPPPP    PPPPPPPPPPPPPP  PPP PPPPPPPPPP PPPPP PPPPP PPPPPPPP 
   315  131 B Q  G 3  S+     0   0   94  162   20  QQQ QQQQQQQQQQ    QQQQQQQQQQQQQQ  QQQ QQQQAQQQAQ QHQHQ QQQQH QQQQQHHH 
   316  132 B N  G <  S+     0   0    9  162    0  NNN NNNNNNNNNN    NNNNNNNNNNNNNN  NNN NNNNNNNNNN NNNNN NNNNN NNNNNNNN 
   317  133 B L  E <   - L   0 327G   0  162   13  LLL LLLLLLLLLL    LLLLLLLLLIILLL  LLL LLILILLLLL LLLLL LLLLL LLLLLLLL 
   318  134 B L  E     -KL 270 326G  36  162    0  LLL LLLLLLLLLL    LLLLLLLLLLLLLL  LLL LLLLLLLLLL LLLLL LLLLL LLLLLLLL 
   319  135 B I  E     -KL 269 325G   0  162   16  IVI IIIIIIIIII    IIIIIVIIIVIIII  III IIVVLIIVII VMVMV IVVVM VIIIIMMM 
   320  136 B N    >   -     0   0   25  162   46  NDD DNDDDDNSNN    DDNNNDNNDDDNNN  NSN NNDDTNNDDN DDDDD NDSDD DNNNNDDD 
   321  137 B T  T 3  S+     0   0   70  162   68  RTK EKRRKKSKRR    RRRRRQRRRIKKKK  RPR TKIKSNKKKG KRKRK KKRDR DAKKAPRR 
   322  138 B E  T 3  S-     0   0   89  158   70  EKD EDDEDDDDDK    QDNNENNNEKQNNN  NEN NNKDGNNEEK EKaKE NEDsK sKKKQKKK 
   323  139 B G  S <  S+     0   0    0  161   37  GGG GGGGGGGGGG    GGGGGGGGGQGGGG  GTG GGQKNMGKGG KTnTK GKGhT cGGGGTTT 
   324  140 B A        -     0   0   14  162   79  AAN HNNNNNADNI    ANEEAAEENqNEEE  EgE QEqgVQEgNQ gmVmm EmTpm CQAQQmmm 
   325  141 B I  E     -L  319   0G   1  161   27  LIL ILLLLLLLLL    LLLLLILLLtTLLL  LlL LLtlLLLlLL llIll LlLll .LLLLlll 
   326  142 B K  E     -L  318   0G  36  162    2  KKK KKKKKKKKKK    KKKKKKKKKQKKKK  KKK KKQKKKKKKK KKKKK KKKKK KKKKKKKK 
   327  143 B L  E     +L  317   0G   4  162   20  LLL LLLLLLLLLL    LILLLLLLLIILLL  LLL LLIILLLILL IIVII LIIVI ILLILIII 
   328  144 B A        +     0   0   14  162   13  AAA AGAAAAAAGA    AGAAAAAAAAAAAA  AAA AAAAAAAAAG AAAAA AAAAA AAGGGAAA 
   329  145 B D    >   +     0   0   44  162    0  DDD DDDDDDDDDD    DDDDDDDDDDDDDD  DDD DDDDDDDDED DDDDD DDDDD DDDDDDDD 
   330  146 B F  G >   +     0   0    1  162    4  FFF FFFFFFFFFF    FFFFFFFFFFFFFF  FFF FFFLFFFLFF LLLLL FLFLL LFFFFLLL 
   331  147 B G  G 3  S+     0   0   13  162    0  GGG GGGGGGGGGG    GGGGGGGGGGGGGG  GGG GGGGGGGGGG GGGGG GGGGG GGGGGGGG 
   332  148 B L  G <  S+     0   0   73  162    1  LLL LLLLLLLLLL    LLLLLLLLLLLLLL  LLL LLLLLLLLLL LLLLL LLLLL LLLLLLLL 
   333  149 B A    <   +     0   0    0  162   14  AAA AAAAAAAAAA    AAAAAAAAAAAAAA  AGA AAAGAAAGAA GAGAS ASAGA GAAAAASS 
   334  150 B R  E     -M  308   0H  96  162    0  RRR RRRRRRRRRR    RRRRRRRRRRRRRR  RRR RRRRRRRRRR RRRRR RRRRR RRRRRRRR 
   335  151 B A  E     -M  307   0H  56  162   34  AAA AAAAAAAAAA    AAAAAAAAAAPAAA  AAA AAAAAAAAAA AAAAA AAAHA AAAAAAAS 
   336  152 B F  S    S+     0   0   74  162    5  FIF FFFFFFFFFF    VFFFFIFFFFFFFF  FFF FFFFFFFFFF FFFFF FFFFF FFFFFFFF 
   337  153 B G        +     0   0   50  162   43  GGG GGGGGGGGGA    SGGGAGGGGGQGGG  GNG GGGTQGGTGG TTSTT GTCTT SGGGGTTT 
   338  154 B V  B     -N  364   0I  28  160   29  ILV IVVVVVIVVI    IVIIIIIIVLVIII  III IILVVIIVVI VLVLV IVPIV IIIIILVV 
   339  155 B P        -     0   0   72  162   23  PPP PPPPPPPPPP    PPPPPPPPPPPPPP  PPP PPPPPPPPPP PPPPP PPPPP PPPPPPPP 
   340  156 B V        +     0   0   42  162   42  VVL VLLLLLVLLV    VLVVAIVVLLIVVV  VLV VVLLMVVMLV MIVMM VMVIL IVVVVMLL 
   341  157 B R        -     0   0  158  158   40  RRR RRRRRRRRRR    RRRRRRRRRKRKKK  RRR NRKKHRKKRN KKKKK KKRKK KNNNNKKK 
   342  158 B T        -     0   0   51  161   73  SVS AATTSSSTAS    VTCCSACCTTPCCC  CVC TCTSTCCSPT SKSKS CSPAK STTTTKKK 
   343  159 B Y    >   -     0   0   63  162   23  YYY YYYYYYYYYY    YYYYYYYYYYYYYY  YYY FYYYYYYYYF YYYYY YYLYY YFFFFYYY 
   344  160 B X  T 3  S+     0   0   15  162   26  TTT TTTTTTTTTT    TTSSTTSSTTTSSS  STS SSTTTSSTTS TTTTT STTTT TSSSSTTT 
   345  161 B H  T 3  S+     0   0   63  162   42  HHH HHHHHHHHHH    HHAAHHAAHHHAAA  AHA HAHHHAAHHN HHHHH AHHHH HNSSNHHH 
   346  162 B E    <   +     0   0   76  162   26  EEE EEEEEEEEEE    EEEEEEEEEEEEEE  EEE EEEEEEEEDE EEEEE EEEEE EEEEEEEE 
   347  163 B V        +     0   0   72  162    8  VIV VIVVVVVVIV    IVVVVIVVVVVVVV  VVV VVVIVVVIVV IIIII VIVII IVVVVIII 
   348  164 B V        -     0   0   78  162    9  VVV VVVVVVVVVV    VVVVVVVVVIVVVV  VVV VVIVVVVVVV VLVLV VVVVL VVVVVLLL 
   349  165 B T        -     0   0   62  161    2  TTT TTTTTTTTTT    TTTTTTTTTTTTTT  TTT TTTTTTTTTT TTTTT TTTTT TTTTTTTT 
   350  166 B L    >   +     0   0   15  161    6  LLL LLLLLLLLLL    LLLLLLLLLLLLLL  LLL LLLLLLLLLL LLLLL LLILL LLLLLLLL 
   351  167 B W  T 3  S+     0   0   88  161    0  WWW WWWWWWWWWW    WWWWWWWWWWWWWW  WWW WWWWWWWWWW WWWWW WWWWW WWWWWWWW 
   352  168 B Y  T 3  S+     0   0   35  161    0  YYY YYYYYYYYYY    YYYYYYYYYYYYYY  YYY YYYYYYYYYY YYYYY YYYYY YYYYYYYY 
   353  169 B R    <   -     0   0   73  161    0  RRR RRRRRRRRRR    RRRRRRRRRRRRRR  RRR RRRRRRRRRR RRRRR RRRRR RRRRRRRR 
   354  170 B A    >>  -     0   0    1  161   24  AAA AAAAAAAAAA    AAPPAAPPAAAPPP  PAP APAAAPPAAA ASAAA PAAAA AAAAAAAA 
   355  171 B P  H 3> S+     0   0    0  161    1  PPP PPPPPPPPPP    PPPPPPPPPPPPPP  PPP PPPPPPPPPP PPPPP PPPPP PPPPPPPP 
   356  172 B E  H 34 S+     0   0    8  161   10  DEE EEEEEEDEED    EEDDDEDDEEEDDD  DED DDEEEDDEED EEEEE DEEEE EDDDDEEE 
   357  173 B I  H X4 S+     0   0   15  161   18  VVV IVIIVVVIVV    VIVVVVVVIIVVVV  VVV VVIVIVVVLV VVVVV VVIVV VVVVVVVV 
   358  174 B L  H 3< S+     0   0    3  161    1  LLL LLLLLLLLLL    LLLLLLLLLLLLLL  LLL LLLLLLLLLL LLLLL LLLLL LLLLLLLL 
   359  175 B L  T 3< S-     0   0    0  161    6  MLL LLILLLMLLM    LLFFMLFFLLLFFF  FLF LFLLLFFLLL LLLLL FLLLL LLMMLLLL 
   360  176 B G    <   +     0   0    7  161   11  GGG GGGGGGGGGG    GGGGGGGGGGGGGG  GGG GGGGGGGGGG GGGGG GGGGG GGGGGGGG 
   361  177 B C        -     0   0   26  161   52  SSG AGGGGGSGGS    SGAASAAAGQAAAA  ACA SAQSEAASAS SAGAA AASAA SSSSSAAA 
   362  178 B K  S    S-     0   0  122  161   62  KPR KKRRRRKRKK    KRKKHTKKRRVKKK  KLK RKRTKKKTKR TTSTT KTKTT TRRRRTTA 
   363  179 B Y  S    S-     0   0  142  154   79  TRQ FQQQQQKQQK    SQLLKRLLQQELLL  LRL MLQHHLLHQT HHHHH LHTHH HTTTTHHH 
   364  180 B Y  B     -N  338   0I  48  161    0  YYY YYYYYYYYYY    YYYYYYYYYYYYYY  YYY YYYYYYYYYY YYYYY YYYYY YYYYYYYY 
   365  181 B S    >   -     0   0   46  161   34  SSS SSSSSSSSSS    SSSSSSSSSSSTTT  SSS NTSSTNTSSN SSSSS TSAAS SSSSNSSS 
   366  182 B T  T 3> S+     0   0   41  161   32  TMT TTTTTTTTTT    VTTTTMTTTTTTTT  TIT TTTTPTTTTT TTTTT TTPPM TTTTTTTT 
   367  183 B A  T 34 S+     0   0    7  161   53  PAG AGGGGGSGGE    PGSSPGSSGPPSSS  SPS SSPGASSGGS GAPAG SSPAA PSSSSAPP 
   368  184 B V  T X> S+     0   0   11  161   12  VVV VVVVVVVVVV    VVIIVVIIVVVIII  III IIVVVIIVVI VVVVV IVLVV VIIIIVVV 
   369  185 B D  H 3> S+     0   0    0  161    0  DDD DDDDDDDDDD    DDDDDDDDDDDDDD  DDD DDDDDDDDDD DDDDD DDDDD DDDDDDDD 
   370  186 B I  H 3< S+     0   0    2  161   35  IIM VTMMMMIMII    MMMMIIMMMIIMMM  MMM IMIMMMMIMI IVIMI MILIM MIIIIMMI 
   371  187 B W  H <> S+     0   0    1  161    0  WWW WWWWWWWWWW    WWWWWWWWWWWWWW  WWW WWWWWWWWWW WWWWW WWWWW WWWWWWWW 
   372  188 B S  H  X S+     0   0    6  161    9  SSS SSSSSSSSSS    SSSSSSSSSSSSSS  SAS SSSSSSSSSS SSSSS SSSSS SSSSSSSS 
   373  189 B L  H  X S+     0   0    7  161   42  VIV LIVVVVIVIV    VIAAVIAAALVAAA  AVA AALVVAAVVV VVVVI AIVIV VACCAVVV 
   374  190 B G  H >> S+     0   0    0  161    3  GGG AGGGGGGGGG    GGGGGGGGGGGGGG  GGG GGGGGGGGGG GGGGG GGGAA GGGGGGGG 
   375  191 B C  H 3X S+     0   0    0  161   23  CCT CCCCTTCCCC    CCCCCCCCCCCCCC  CAC CCCCCCCCCC CCCCC CCTCC CCCCCCCC 
   376  192 B I  H 3X S+     0   0    0  161    0  III IIIIIIIIII    IIIIVIIIIIIIII  III IIIIIIIIII IIIII IIIII IIIIIIII 
   377  193 B F  H XX S+     0   0    0  161   12  FFF FFFFFFFFFF    FFFFFAFFFFFLLL  FMF MFFFFFFFFM FFFFF FFLFF FMLLMFFF 
   378  194 B A  H 3X S+     0   0    1  161    9  AAA AAAAAAAAAA    GAAAAAAAAAYAAA  AAA AAAAAAAAAA AAAAA AAAAA AAAAAAAA 
   379  195 B E  H 3X S+     0   0   13  161    0  EEE EEEEEEEEEE    EEEEEEEEEEEEEE  EEE EEEEEEEEEE EEEEE EEEEE EEEEEEEE 
   380  196 B M  H << S+     0   0    2  161    8  MMM MMMMMMMMMM    MMLLMMLLMMLLLL  LIL MLMMLILMMM MLLLM LMMLL LMMMMLLL 
   381  197 B V  H  < S+     0   0    5  161   71  VAC ACCCCCICCI    LAaaVAaaCAIaaa  aAa YaAVAaaVCY VAAVV aVVAV VFIIFVIA 
   382  198 B T  H  < S-     0   0   17  160   71  NTS SNTTSSTTNN    NTaaNTaaTQTaaa  aTa MaQRRaaRVT RTRTR aRTRT RTTTTTTT 
   383  199 B R  S  < S+     0   0  102  161   67  GKR GRRRRRGRRG    KRGGGKGGRKKGGG  GLG GGKRRGGRRG RKKKK GKKKK KGGGGNTN 
   384  200 B R  S    S-     0   0  173  161   52  RKK RKKKKKKKKV    KKRRKVRRKRKRRR  RRR RRRQKRRQKR QQQQQ RQTQT TRKKRQTQ 
   385  201 B A        -     0   0   31  161   27  PPP TPPPPPPPPP    PPPPPPPPPPAPPP  PAP PPPAVPPAPP AAPAA PAPAA PPPPPAAP 
   386  202 B L  S    S+     0   0   32  161    9  LLL LILLLLLLIL    LLLLLLLLLLLLLL  LLL LLLLLLLLLL LLLIL LLMIL LLLLLILL 
   387  203 B F  S    S-     0   0    4  161    5  FFF FFFFFFFFFF    FFFFFFFFFFFFFF  FFF FFFFFFFFFF FFFFF FFFFF FFFFFFFF 
   388  204 B P        -     0   0   32  161   49  PQP PSPPPPPPSP    SPPPPQPPPCTPPP  PAP PPCPRPPPPP PPPAP PPPPP PPPPPQPA 
   389  205 B G        +     0   0   11  161    6  GGG GGGGGGGGGG    GGGGGGGGGGGGGG  GGG GGGGGGGGGG GGGGG GGGGG GGGGGGGG 
   390  206 B D  S    S+     0   0   57  161   47  TDD DDDDDDVDDV    DDNNVDNNDDDSSS  NDN SSDDDASDDT DDDDD SDDDD DSSTTDDD 
   391  207 B S  S >> S-     0   0    2  161   37  GSS SSSSSSTSSS    CSDDSSDDSSSDDD  DSD TDSSSDDSST SSSSS DSSSF CSNNTSSS 
   392  208 B E  H 3> S+     0   0   26  161   32  NEE EEEEEEDEEE    EEVVEEVVEEEVVV  VEV NVEEEVVEEN EEEEE VEEEE ENDENEEE 
   393  209 B I  H 3> S+     0   0   14  161   54  EII IIIIIIDIIQ    IIDDEIDDIIILLL  DID EDIFIDDLIE LLLLL DLILL LDEEELVV 
   394  210 B D  H <> S+     0   0   42  161   18  DDD DDDDDDDDDD    DDDDDDDDDDDDDD  DDD DDDQGDDQDD QQQQQ DQDQQ QDEEDQQQ 
   395  211 B Q  H  X S+     0   0    0  161   20  QEE QQEEEEQEQQ    QEQQQQQQEQQQQQ  QQQ QQQQQQQQKQ QQQQQ QQEQQ QQQQQQQQ 
   396  212 B L  H >X S+     0   0    0  161   16  LLI LIIIIILIIL    IILLLILLILLLLL  LLL LLLLLLLLIM LLLLL LLILL LLLLLLLL 
   397  213 B F  H 3X S+     0   0   32  161   69  IFF FFFFFFPFFK    FFKKNFKKFFFMLM  KYK QKFLFKKLFL LLLLL KLYLL LQKKLLLL 
   398  214 B R  H 3X S+     0   0   86  161   46  KRK RKKKKKKKKR    RKRRRRRRKKRKKK  RRR KRKHERRHKR HHHRH RHKHH HHLLKHHH 
   399  215 B I  H   -     0   0   83  157   61  QTD GNTNDDNTNN    DNTTNTTTTKNNTN  TST STKTtTTNTA TNSNT TTTSN NNTNSNNN 
   408  224 B E  T  4 S+     0   0   80  157   23  VEE EEEDEEPEEV    DEEEIEEEEEEEEE  ENE EEEEEDEEEE EEEEE DEEEE EEEEEEEE 
   409  225 B V  T  4 S+     0   0  124  158   64  SSD AAEQDDRDSG    SQEEEDEEESNDED  EKE RDSKGDEEDH EEDEE EESED ESAQREDQ 
   410  226 B V  T  4 S+     0   0   51  159   76  ETA LITEAAEVVT    IDQQTIQQVTTSSS  QIQ STTQSTTQVN QMVVD TDSVV VTTSSMVV 
   411  227 B W  S >< S-     0   0   10  161    4  HWW WWWWWWWWWW    WWWWWWWWWWWWWW  WWW WWWWWWWWWW WWWWW WWWWW WWWWWWWW 
   412  228 B P  T 3  S+     0   0   82  161   13  PKP PPPPPPPPPP    PPPPPHPPPPPPPP  QKQ PPPPPPPPPP PPPPP PPPPP PPPPPPPP 
   413  229 B G  T 3  S+     0   0   31  162   44  QGG ADSGGGQGDG    GGASQGAAGGGGGG  TGT GGGGGSDGGG GGGGG NGNGG GNGGGGGG 
   414  230 B V    X   +     0   0    0  162   37  LVV AIVVVVVVIV    VVMMLVMMVVVVVV  MVM IMVVVLFVVI VVVVV MVVVV VIVIIVVV 
   415  231 B T  T 3  S+     0   0   73  162   66  AST RVtsTTQTVV    TTTTSTTTTSTSTS  TEN STSSSSTTTS TSTST TTTTS SSSSSNGS 
   416  232 B S  T 3  S+     0   0   89  159   77  EQT RYicTTESYD    KSKKEQKKSTNHHH  KNK QQTSRQTDSQ DNRKA TADKK KSASSTKK 
   417  233 B M  S X  S-     0   0   23  159   29  LLY LLYFYYLYLL    LFLLLLLLYLLLLL  LFL FLLLLLLLYF LLLLL LLLLL LLLLFLLL 
   418  234 B P  T 3  S+     0   0   62  159   37  PPP PPPPPPPPPP    PPPPPPPPPPKSSS  PKP PPPRPPPRRP RMRKR PRDRM RPPPPKPP 
   419  235 B D  T 3  S+     0   0   21  162   34  HDD DDDDDDLDDA    EDDDSDDDDDDDDD  DDD EDDDDDDDDE DNDDD DDDDN DNKKENNN 
   420  236 B Y    <   -     0   0   28  162   11  WYF FFFFFFWFFY    YFYYYFYYFFYYYY  YWY YYFWYFYWFY WWWWW FWWWW WYYYYWWW 
   421  237 B K    >   -     0   0   46  162   56  NKK RKKKKKKKKN    VKKKNKKKKKKVVV  KKK KKKHRKKHKK HHHHH KHNHH HRNNKHHH 
   422  238 B P  T 3  S+     0   0   98  162   71  RAP ASPPPPQSPP    SSPPPMPPPSTAAA  PEP PSSVDPPESA EEEEE PEVEE ESPPQEEE 
   423  239 B S  T 3   +     0   0   91  162   85  DSS ASSSSSrSSD    TSYYESYYSTTLLL  YGY NFTYVMFFST FYFYF MFGFY FNNGTYYY 
   424  240 B F  S <  S-     0   0    8  121    7  FFF FFFFFFfFFM    FF..FF..FFF...  .F. F.F.F...FA ..... ..F.. .FFF.... 
   425  241 B P        -     0   0   47  151   15  PPP PPPPPPQPPD    PPPPSPPPPPPPPP  PPP PPPPPPPPPP PPPPP PPPPP PQPP.PPP 
   426  242 B K        -     0   0  158  154   67  QKK RQKKKKVKKQ    NKMMKQMMKRNSSS  MKM VLRQKLLQKR QQQQQ MQKQQ QVQQ.QQQ 
   427  243 B W        -     0   0   64  155   20  FWW WWWWWWFWWF    WWYYYWYYWWWFFF  YWY YYWWWYYWWY WWWWW YWWWW WYRHWWWW 
   428  244 B A        -     0   0   91  161   77  PRQ pRQQQQEIHE    PePPDKPPTpSPPP  PeP AHpEtHHKQA KKKKK QKPHG HAllpKnN 
   429  245 B R        -     0   0  116  151   71  P.R rRRRRRKRRK    GkAASEAARpPAPA  AsA TPpPkPPPRT PPPPA PARGP PPkkyPsP 
   430  246 B Q        -     0   0   77  156   72  LgD pKDDDDKDKQ    QqttQDttDtQiii  tgt QttQRsaQNQ QQQLQ nQIQQ QQdnaSKS 
   431  247 B D    >>  -     0   0   86  155   74  PsF tDP.FFPEEP    PessPGssYaGsss  sps DsaN.tgS.D ISDSR tRGDS DDmseS.K 
   432  248 B F  H 3> S+     0   0   19  161   47  WLS LLNMSSWSLW    YMLLLLLLDAFWWW  LFL LFALLFLLYL LLLLM LLLLF LLVILLLV 
   433  249 B S  H 34 S+     0   0   77  161   78  DAT LSQSTTSQAN    NVVVQRVVATKSSS  VAV SATAGGAEDR ESSST VTAHS SRLLRSSS 
   434  250 B K  H <4 S+     0   0   98  162   78  QeP PQKqPPSPKV    KnNNNkNNPlqQQQ  NDN LQlRQQQRqQ RSKTR QRRQK RVqqASSD 
   435  251 B V  H  < S-     0   0   16  161   73  VlL AVLlLLILVI    IgVVFlVVLdlLLL  V.V IVdAVVVSlI QAVAA VAEVA IIccISVL 
   436  252 B V    ><  +     0   0    0  162   51  VNC GVCCCCICVV    FVVVIDVVCINVVV  VDV LVIVLVTVCL VVIVV VVYFV FIKALVIV 
   437  253 B P  T 3  S+     0   0   61  162   53  PKP LPSTPPPSPP    PKPPPAPPTNRPPP  PWP PPTPPPPPNP PTPPP PPAPP PPESPPPH 
   438  254 B P  T 3  S+     0   0   59  162   74  KYN RSNNNNGNSK    RIKKNYKKNNDRRR  KPK QKNSENKSNQ SNQNT KTDRG TQPDQNSG 
   439  255 B L  S <  S-     0   0   18  162   32  LLL ALLLLLFLLL    CLLLLMLLLLVLLL  LML ILLLLLLLLI LLLLL SLLLL LILLVLLL 
   440  256 B D        -     0   0   77  162   43  DSD HDNDDDCDDG    EGNNGDNNDCDNNN  SCS DSCGHSNEND EDDDE TEGCE EDDDDDDD 
   441  257 B E  S    S+     0   0  150  162   67  PPE SPDEEEQAAG    PDAADPAADPQSAS  SDS PCPPPPSPKA PEAET TPEPE PNDDSKAA 
   442  258 B D  S >> S+     0   0   52  162   79  LEA SRANAAEERA    LETTLETTALLKKK  TLT LRLDDKREAT EDHAE KEIDT EVNTLADD 
   443  259 B G  H 3> S+     0   0    0  162   15  GGG AGGGGGGGGG    AGGGGGGGGGAGGG  GGG GGGGAGGGGG GGGGG MGGGG GAVLGGGA 
   444  260 B R  H 34 S+     0   0   53  162   64  TIL AILLLLILIV    LLRRIIRRLLIRRR  RKR LRLVIRRVLI VLIVI RIIIV VLIILLIL 
   445  261 B S  H <> S+     0   0   38  162   29  DDE ADDDEEDEDD    DIDDDKDDEDDDDD  DDD DDDDDDDDED DNDDD DDNDD DDDAQDDD 
   446  262 B L  H >X S+     0   0    1  162    1  LLL LLLLLLLLLL    LLLLLILLLLLLLL  LLL LLLLLLLLLL LLLLL LLMLL LLLLLLLL 
   447  263 B L  H 3X S+     0   0    0  162    7  LLL FLLLLLLLLI    ILLLLLLLLLLLLL  LLL LLLLLLLLLL LLLLL LLLML LLLLLLLL 
   448  264 B S  H 34 S+     0   0   40  161   78  SQD EDEEDDSESS    AEQQKRQQESTQQQ  QKQ NQSSSQQSDQ SSQSS QSEQF KLHHGSEE 
   449  265 B Q  H X< S+     0   0   74  161   69  RKY AKMLYYNMSK    KSNNCDNNMKRKKK  NKN RKKKKRRKMR KQKKK RKQKQ RSGGQKKK 
   450  266 B M  H 3< S+     0   0    1  161   28  MMM MLMMMMMMLM    MLLLMMLLMMMLLL  LFL MLMMMLLMTL MMMMM LMLMM MLLLLMMM 
   451  267 B L  T 3< S+     0   0    8  161    8  LLL LLLLLLLLLL    LLLLLLLLLILLLL  LLL LLILLLLLLL LLLLL LLLFV ILLLLLLL 
   452  268 B H    <   -     0   0   47  161   85  RII RAAVIICVSQ    QVRKKTKKVVKIVI  KIK QVTKKVVQIQ QQVEQ VQAEQ EQQQQQQQ 
   453  269 B Y  S    S+     0   0    7  161   37  FYC YYYYCCFYYL    YFCCLYCCYYLCCC  CYC LCYYYCCYYL YYYYF CFYYY YLLLLYYY 
   454  270 B D    >>  -     0   0   13  161   34  DDD EDDDDDDDDD    EDNNNDNNDDDRRR  NDN RNDDDNNDNR NDDED NDDDE DKNNREEE 
   455  271 B P  T 34 S+     0   0   35  161    4  SPP PPPPPPPPPP    PPPPPPPPPPPPPP  PPP PPPPPPPPPP PPPPP PPPPP PPPPPPPP 
   456  272 B N  T 34 S+     0   0  126  161   75  NGV EIAAVVNAIF    SAVVQAVVVYTNNN  VAV ESYSRAAAAE ASAAA SAKAS AEDDEAAS 
   457  273 B K  T <4 S+     0   0  118  161   70  QKT TNAGTTKSNQ    KGQQEQQQAAQQQQ  QSQ MMAEEHLNGL NKKKN HNAKK KNMMMKKK 
   458  274 B R  S  < S-     0   0   11  161    1  RRR RRRRRRRRRR    RRRRRRRRRRRRRR  RRR RRRRRRRRRR RRRRR RRRRR RRRRRRRR 
   459  275 B I        -     0   0   18  161   17  III IIIIIIIIII    IMIIIIIIIIIIII  III ILIIILLIII IIIII IILIL IILLCIII 
   460  276 B S     >  -     0   0   73  161   38  SAS PSSSSSSSSS    SSSSTSSSSTSSSS  SSS SSTSSDSSSS SSHSS SSSTF STSSSSSS 
   461  277 B A  H  > S+     0   0    5  161    5  AAA AAAAAAAAAA    AAAAAAAAAAAAAA  AAA AAAAAAAAAA AAAAA AAAAA AAAAAAAA 
   462  278 B K  H  > S+     0   0  168  161   58  RKK RRKKKKRKKR    KKEEKKEEKEKEEE  EKE AEEKKEDKKH KKTKK EKKKK KRKKQKKK 
   463  279 B A  H  > S+     0   0   50  161   71  QTA ARQQAADARD    EQEEDQEEQEQAAA  EAE DEEAESESQD AKEKA QARDK EQQQQMKK 
   464  280 B A  H  < S+     0   0    1  161   16  AIA AAAAAAAAAA    AAAAALAAAAAAAA  AAA AAAAASAAAA AAAAA AAAAA ASAAAAAA 
   465  281 B L  H  < S+     0   0   45  161   39  MLL LACCLLMCAL    LVLLLLLLCLLMMM  LLL LMLLLLMMCL MMLML MLLMM LLLLLMMM 
   466  282 B A  H  < S+     0   0   69  161   81  QKN TINTNNNNVC    LHQQLKQQYKNQQQ  QNQ RQKDQRAENQ EEEEE SEKRE KEHHAEEE 
   467  283 B H  S >< S-     0   0   16  161    4  HDH HHHHHHHHHH    HHHHHNHHHHHHHH  HHH HHHHHHHHHH HHHHH HHHHH HHHHHHHH 
   468  284 B P  G >  S+     0   0   74  161   39  PAP PPPPPPPPPE    PPPPPPPPRAQPPP  PPP APAPPPPPPP PPPPP IPPPP PPPPPPPP 
   469  285 B F  G 3  S+     0   0    7  161    4  YYY YYYYYYYYYY    YYYYYYYYYYYYFY  YYY WYYYWYYYYW YYYYY YYFYY YWWWWYYY 
   470  286 B F  G X  S+     0   0    4  160    1  FFF LFFFFFFFFF    FFFFFFFFFFFFFF  FFF FFFFFFFFFF FFFFF FFFFF FFFFFFFF 
   471  287 B Q  T <  S+     0   0  147  154   70  SDD AQEEDDKEEN    GDSSDDSSDDQTTT  AQA NSDDSSNDEH DDDDN ANDDD DAAAADDN 
   472  288 B D  T 3  S+     0   0  127  149   41  DDE DEDDEEDTGD    DNDDDDDDDDEDDD  DND DDDSDDDSGD SDSDS DSDDD DEEEEDDD 
   473  289 B V    <   +     0   0   41  123   44  LLI A Y IILYMV    L FFIVFFSLF     FFF LLLLLVLLFI LLLLL ILLLL  YYYLLVV 
   474  290 B T        -     0   0   95  103   63  PD  T D   DPAS    D   PD  PNQ      E  PPND SND   DEDPD NDDDD  H  NPDN 
   475  291 B K        -     0   0  110   89   74  DK  L P   PE E    T   ER  QN       P  QSNK EPK   KKKDK  KKKK  Q  AEKK 
   476  292 B P        -     0   0   28   75   78  N   V P   QQ N    S   EK  P        P   S S  AS   SDS S  SAET     R AE 
   477  293 B V        -     0   0   97   48   78  I   P     IH          LN  H            I    I                    S SL 
   478  294 B P        -     0   0   16   42   83  K   P      S          KF  T            R    K                    Q L  
   479  295 B H              0   0  170   36   76  R   P      R           Q  Q            N    N                    Q P  
   480  296 B L              0   0   78   25    3  L   L                  L                                           L  
## ALIGNMENTS  211 -  249
 SeqNo  PDBNo AA STRUCTURE BP1 BP2  ACC NOCC  VAR  ....:....2....:....3....:....4....:....5....:....6....:....7....:....8
     1   21 A E              0   0  205   67   16      Q     E          EEE  EE           
     2   22 A D    >   +     0   0   66   69   46      S     V          DDI  DV           
     3   23 A E  B 3  S+a   38   0A 100   72   33      E     D       D  EEDD ED        E  
     4   24 A Q  T 3  S+     0   0  153   73   71      Q     L       T  QQLK QL        TD 
     5   25 A T  S <  S-     0   0   77   75   47      P   T S T     Q  TTSS TS        DN 
     6   26 A P        -     0   0   85   78    8      PP PP P P     P  PPPP PP        KP 
     7   27 A I        -     0   0   17   79   35      FI IL L L     L  IIFF IL     L  LI 
     8   28 A H        -     0   0  136   79   55      RK KK E K     R  QHKQ QK     R  RR 
     9   29 A I        -     0   0   14   79   14      II II I I     I  IIII IV     I  IV 
    10   30 A S  E     -B   25   0B  11   79   45      DD DD S D     D  SSAD SD     D  DD 
    11   31 A W  E     -B   24   0B  86   80    8      WW WW W W     W  WWWW WW     M  FW 
    12   32 A L  E     -B   23   0B   9   81    7      LL LL L L     V  LLLL LL     L  II 
    13   33 A S  E     -B   22   0B  39   81   58      DD DD D D     D  SSDD PD     S  KP 
    14   34 A L    > > +     0   0    0   82   17      LL LL L L     L  LLLV LV     L  ST 
    15   35 A S  G > 5 +     0   0   64   81   20      SS SS T S     S  SSGS SS     E  DA 
    16   36 A R  G 3 5S+     0   0  161   82   90      MF FM C M     I  RRCE RS     G  KL 
    17   37 A V  G < 5S-     0   0    4   82   48      VF FF Y F     I  VVEY VY     K  IW 
    18   38 A N  T < 5S+     0   0  141   82   69      gG GG G G     G  NNVG NG     K  DP 
    19   39 A C      < -     0   0   29   79   49      pY YY F Y     Y  CCCI CF     .  .. 
    20   40 A S  S    S+     0   0   84   79   48      TP PP E P     P  SSDA SL     .  A. 
    21   41 A Q        -     0   0   37   82   44      LD DD T D     N  QQEE QG     G  HG 
    22   42 A F  E     -B   13   0B 105   82   68      NS SS P S     S  FFKK FS     R  SQ 
    23   43 A L  E     -B   12   0B   0   83   11      LV VV L V     V  LLLL LL     I  LLI
    24   44 A G  E     -Bc  11 117B   0   82    5      GG GG G G     G  G.AG GG     G  AGG
    25   45 A L  E     +Bc  10 118B   1   82   26      IL LL V L     I  L.II LI     L  LLL
    26   46 A C        -     0   0    2   81   35      SS SS T S     S  C.SS CT     T  TTT
    27   47 A A        -     0   0   44   79   57      SS SG S G     Q  ..AG .S     L  IFI
    28   48 A L    >   -     0   0    4   79    5      LL LL L L     M  ..LL .L     L  LAL
    29   49 A P  T 3  S+     0   0    0   79    0      PP PP P P     P  ..PP .P     P  PPP
    30   50 A G  T 3  S+     0   0    0   79    3      GG GG g G     G  ..GG .D     G  GgG
    31   51 A C    <   -     0   0    4   77    8      CC CC c C     C  ..CC ..     .  .q.
    32   52 A K        +     0   0   37   79   28      KR KK R K     K  ..RR ..     .  .P.
    33   53 A F  B >  S-F   36   0C  25   82   27      FF FF F F     F  ..FF ..     R  RGR
    34   54 A K  T 3  S-     0   0   81   82    8      KK KK K K     K  ..KD ..     K  KVK
    35   55 A D  T 3  S+     0   0  118   82   22      ED DD D D     N  ..ND ..     D  DTD
    36   56 A V  B <   +F   33   0C  58   82   61      TT TS V S     N  ..TT ..     R  YHR
    37   57 A R        +     0   0   75   82   27      WW WW W W     W  ..WW ..     D  SND
    38   58 A R  B     -a    3   0A  48   82    0      RR RR R R     R  ..RR ..     R  RRR
    39   59 A N     >  -     0   0   64   82   37      ND DD S D     N  ..SS ..     D  DSN
    40   60 A V  H  > S+     0   0   15   81   36      LV VT L T     L  ..VM ..     L  LVL
    41   61 A Q  H  > S+     0   0   84   83   46      DE EA Q A     K  ..KE ..     I  SEE
    42   62 A K  H  > S+     0   0   98   83   47      KR RH N R     N  ..HS ..     S  EAE
    43   63 A D  H  X S+     0   0    3   83    3      DD DD D D     D  ..DD ..     D  DDD
    44   64 A T  H  X S+     0   0    2   84   69      LI IL I L     L  ..LI ..     I  LMI
    45   65 A E  H  X S+     0   0   97   84   37      DE EE K E     E  ..KN ..     D  KQT
    46   66 A E  H  X S+     0   0   57   85   48      EY YY C Y     T  ..CG .D     T  EET
    47   67 A L  H  X>S+     0   0    0   85   16      VL LL L L     M  ..IL .L     I  ILI
    48   68 A K  H ><5S+     0   0   86   84   56      QK KK L K     T  ..RI .E     R  KAQ
    49   69 A S  H 3<5S+     0   0   89   84   73      AL LL S L     N  ..DS .A     E  ERK
    50   70 A C  H 3<5S-     0   0   52   84   96      QE EE E E     A  ..EQ .L     E  QQE
    51   71 A G  T <<5 +     0   0   37   83   20      GD DD G D     G  ..GG .D     G  QGG
    52   72 A I      < +     0   0    1   83   23      VV VV V V     I  ..IV .I     I  IAI
    53   73 A Q        +     0   0   64   83   49      QS SS Q S     Q  ..KE .H     S  DTT
    54   74 A D  E     -de  82 116B   9   83   27      DD DD D D     S  ..ED .D     T  CVH
    55   75 A I  E     -de  83 117B   0   83   16      VV VV V V     V  ..VV .V     V  VVI
    56   76 A F  E     -de  84 118B   0   83   19      LF FF V F     Y  ..FF .Y     V  VAL
    57   77 A V  E     -de  85 119B   0   83   24      VV VV C V     V  ..CV .V     S  SPC
    58   78 A F        +     0   0    0   83   11      LL LL L L     L  ..LL .L     L  LLL
    59   79 A C  S    S-     0   0    0   83   26      CC CC C C     L  ..CC .C     L  IIL
    60   80 A T    >>  -     0   0   36   83   12      TT TT S T     T  ..ST .T     T  TET
    61   81 A R  H 3> S+     0   0  157   83   39      PG GR K R     T  ..KR .K     E  KDE
    62   82 A G  H 3> S+     0   0   53   83   18      GG GG G G     G  ..GG .G     N  DFN
    63   83 A E  H <> S+     0   0   14   83    0      EE EE E E     E  ..EE .E     E  EEE
    64   84 A L  H  <>S+     0   0    1   83    7      LL LL L L     L  ..LL .L     Y  MFF
    65   85 A S  H ><5S+     0   0   67   83   67      VS ST S T     R  ..HN .S     A  DES
    66   86 A K  H 3<5S+     0   0  141   83   42      HL LL K L     K  ..KK .K     E  MME
    67   87 A Y  T 3<5S-     0   0    6   83    5      CY YY Y Y     Y  ..YY .Y     Y  YLY
    68   88 A R  T < 5S+     0   0  130   83   21      RR RR R R     R  ..RR .R     G  GGG
    69   89 A V    > < +     0   0    0   83    6      VV VV V V     A  ..VV .V     V  VMV
    70   90 A P  T >  S+     0   0   69   83   21      PP PP Q P     S  ..TR .s     P  PAK
    71   91 A N  T >> S+     0   0   63   83   70      DT TS W T     Q  ..GR .y     D  EGD
    72   92 A L  H <> S+     0   0    0   83    5      LL LL L L     L  ..LL .I     L  LYL
    73   93 A L  H <> S+     0   0    5   83   29      LL LL L L     L  ..LM .T     K  LHK
    74   94 A D  H <> S+     0   0   77   83   36      EA AT H T     D  ..QQ .E     E  DDH
    75   95 A L  H  < S+     0   0   16   83   85      AE EE E E     E  ..EE .L     A  VFQ
    76   96 A Y  H ><>S+     0   0    2   83   14      YY YY M Y     Y  ..FY .T     Y  YAY
    77   97 A Q  H ><5S+     0   0   89   83   58      AQ QE T E     N  ..AT .S     Q  KGE
    78   98 A Q  T 3<5S+     0   0  140   83   50      RN NS G S     S  ..ET .R     K  KQR
    79   99 A C  T < 5S-     0   0   25   83   90      RH HH A H     S  ..AA .D     S  QSH
    80  100 A G  T < 5S+     0   0   47   83    7      GG GG G G     G  ..DG .S     G  GGG
    81  101 A I      < -     0   0    8   83   33      LM MI L I     I  ..IL .V     M  VIL
    82  102 A I  E     -d   54   0B  73   83   83      LT TT T T     N  ..NS .N     D  ESN
    83  103 A T  E     -d   55   0B  33   83   58      VV VV V V     V  ..VV .V     S  CVV
    84  104 A H  E     -d   56   0B  26   83   20      HH HH H H     H  ..HH .H     V  LSY
    85  105 A H  E     +d   57   0B  55   84   13      HH HH H H     H  ..HH .H     F  HAH
    86  106 A H        -     0   0   16   84   68      EH HH F H     Y  ..YY .Y     Y  VCC
    87  107 A P        -     0   0   64   84    4      PP PP P P     P  ..PP .P     P  PPP
    88  108 A I        -     0   0    3   84   36      VV VF F F     F  ..FF .F     I  VIV
    89  109 A A    >   -     0   0   68   84   52      LP PQ P Q     P  ..PP .M     L  IVL
    90  110 A D  T 3  S+     0   0   41   85    4      DD DD D D     D  ..DA .D     D  DDD
    91  111 A G  T 3  S+     0   0   22   85   11      GG GG G G     G  ..GG .G     Q  QGQ
    92  112 A G  S <  S-     0   0   18   85   66      AL LT Q T     T  ..ML .Q     K  KQT
    93  113 A T        -     0   0   52   86   59      VP PA P A     V  ..TV .T     V  IVA
    94  114 A P        -     0   0    7   86    0      PP PP P P     P  ..PP .P     P  PpP
    95  115 A D    >>  -     0   0  108   86   46      DG GG T G     T  ..SS .L     D  VdV
    96  116 A I  H 3> S+     0   0   38   86   44      MI II T I     V  ..FP .L     R  KRF
    97  117 A A  H 3> S+     0   0   48   86   56      AG GE G E     D  ..PA .S     S  AAD
    98  118 A S  H <> S+     0   0   24   86   77      RQ QQ Q Q     I  ..NN .N     S  ERQ
    99  119 A C  H  X S+     0   0    1   86   50      CL LV L V     V  ..LC .L     L  IFA
   100  120 A C  H  X S+     0   0   14   86   75      CL LL M L     V  ..MM .L     E  EGI
   101  121 A E  H  X S+     0   0   96   86   73      AD DN K N     N  ..KK .K     V  REP
   102  122 A I  H  X S+     0   0    1   86   21      LI II I I     F  ..MM .M     L  ILA
   103  123 A M  H  X S+     0   0    0   86   16      LL LL L L     I  ..LL .I     L  NLL
   104  124 A E  H >X S+     0   0   96   86   37      DR RK E K     Y  ..DE .A     D  ADQ
   105  125 A E  H 3X S+     0   0   55   86   28      TE EE E E     D  ..EE .E     R  FEW
   106  126 A L  H 3X S+     0   0    0   86   13      MI II L I     L  ..LI .I     M  ILM
   107  127 A T  H S+     0   0    5   86   61      SA AV I V     D  ..NN .N     E  QAA
   110  130 A L  H ><5S+     0   0    2   85   13      LI II L I     L  ..LL .L     L  QLI
   111  131 A K  H 3<5S+     0   0  152   85   70      GQ QE N E     G  ..LN .M     S  KLS
   112  132 A N  T 3<5S-     0   0   98   85   48      AQ QQ N Q     N  ..NA .T     S  KDQ
   113  133 A Y  T < 5 +     0   0  170   85   75      GG GG K G     Q  ..GG .Q     G  HGN
   114  134 A R      < -     0   0   87   85   42      RN NK K K     R  ..NT .N     K  KKG
   115  135 A K        -     0   0   89   84   29      RR RR K R     K  ..KG .K     N  KNK
   116  136 A T  E     - e   0  54B   0   85   43      VV VA P A     T  ..CT .V     I  VVV
   117  137 A L  E     -ce  24  55B   0   85   20      LL LL I L     L  ..LL .L     L  LVL
   118  138 A I  E     +ce  25  56B   0   85   17      VV VV I V     I  ..VV .I     V  IVI
   119  139 A H  E     - e   0  57B   0   85    9      HH HH H H     H  ..HH .H     H  HHH
   120  140 A S        -     0   0    0   86    6      CC CC C C     C  ..CC .C     C  CCC
   121  141 A Y  S    S+     0   0   26   86   27      YF FF Y F     Y  ..YF .Y     V  VRV
   122  142 A G  S    S-     0   0   23   86    4      GG GG G G     G  ..GG .G     G  GGG
   123  143 A G  S    S+     0   0    2   87    3      GG GG G G     G  .GGG .G     G  GGG
   124  144 A L  S    S+     0   0   43   87    7      LL LL L L     L  .LLI .L     L  LLL
   125  145 A G  S >> S+     0   0    4   87    3      GG GG G G     G  .CGG .G     G  GGG
   126  146 A R  H 3> S+     0   0    2   88    6      RR RR R R     R  AARR .R     r  RRr
   127  147 A S  H 3> S+     0   0    0   86   21      ST TT S T     S  ..SS .S     g  SAg
   128  148 A C  H <> S+     0   0    0   87   47      CG GG C G     C  ..CS AS     T  GGT
   129  149 A L  H  X S+     0   0    1   89   10      LV VV V V     F  llLL lL     V  LLL
   130  150 A V  H  X S+     0   0    1   84   26      LV VV V V     L  vvVI vV     A  VT.
   131  151 A A  H  X S+     0   0    0   89   15      AA AA A A     V  AAAI AS     A  AAA
   132  152 A A  H >X S+     0   0    0   89    6      AA AA A A     A  AAAA AV     A  AAA
   133  153 A C  H 3X S+     0   0    1   89    9      CC CC C C     C  CCCC CC     Y  CCA
   134  154 A L  H 3X S+     0   0    0   89   13      FL LL F L     F  LLLL LL     L  YLY
   135  155 A L  H >  -     0   0   38   89   67      ST TT T T     S  SSSE ST     T  DKD
   144  164 A P  H 3> S+     0   0   24   89   28      PP PP P P     P  PPPW PV     S  APA
   145  165 A E  H 3> S+     0   0  108   89   49      EE EE E E     D  EEEK EE     E  IDK
   146  166 A Q  H <> S+     0   0   93   88   52      DH HY K Y     R  QQDD QD     Q  KDE
   147  167 A A  H  X S+     0   0    0   88   29      AA AV A V     V  AAVA AA     A  IAA
   148  168 A I  H  X S+     0   0    4   88   14      IV VV I V     I  IIII IV     I  VII
   149  169 A D  H  X S+     0   0   77   88   51      AR RR E R     D  DDKA DQ     R  RAS
   150  170 A S  H  X S+     0   0    6   88   83      AK KK K K     I  SSKK SK     R  ELL
   151  171 A L  H  X>S+     0   0    0   88   22      LV VV M V     F  LLVV LL     V  AVV
   152  172 A R  H  X5S+     0   0   48   88   22      CQ QQ K Q     R  RRRR RK     R  RRR
   153  173 A D  H  <5S+     0   0  137   88   37      EE EE E E     S  DDDQ DD     E  SKE
   154  174 A L  H  <5S+     0   0   35   88   40      LL LL L L     I  LLLL LL     V  STS
   155  175 A R  H  <5S-     0   0   62   88    6      RR RR R R     R  RRQK RR     R  RRR
   156  176 A G    ><< -     0   0   33   86    7      GG GG G G     G  GGGG GG     S  ..S
   157  177 A S  T 3  S+     0   0   80   87   58      RT TT P T     A  SSHS SS     E  .RE
   158  178 A G  T 3   +     0   0   16   87   45      AR RR R R     G  GGSR GS     R  .GR
   159  179 A A  S <  S+     0   0    0   88    2      AA AA A A     A  AAAA AA     A  AAA
   160  180 A I  S    S+     0   0    1   88    5      II II V I     I  IIVI II     I  III
   161  181 A Q        +     0   0   20   88   11      QQ QQ Q Q     Q  QQQQ QQ     E  EEE
   162  182 A T  S  > S-     0   0   21   88   21      TT TT T T     T  TTST TS     S  SNS
   163  183 A I  H  > S+     0   0    0   88   37      VV VV V V     V  IIVV IV     R  TAR
   164  184 A K  H  > S+     0   0   65   88   20      QK KK K K     K  KKKK KK     E  ERI
   165  185 A Q  H  > S+     0   0   10   85    0      QQ QQ Q Q     Q  QQQQ QQ     Q  QQQ
   166  186 A Y  H  X S+     0   0   39   84   24      YY YY F Y     Y  YYFY YF     E  EEE
   167  187 A N  H  X S+     0   0    8   84   14      NN NN N N     N  NNNN NN     S  KQE
   168  188 A Y  H >X S+     0   0   20   84    4      FF FF Y F     F  YYFF YF     F  FFF
   169  189 A L  H >X S+     0   0    1   84   19      LI II I I     I  LLIV LI     L  VIL
   170  190 A H  H 3< S+     0   0   72   84   27      HH HH N H     Q  HHNS HH     R  YRA
   171  191 A E  H  S+     0   0  118   83   40      EN NS Q S     K  DDDK DE        EEI
   175  195 A K  H  < S+     0   0   92   81   54      L  AL T L        KKMM KK        RQK
   176  196 A L  H >< S+     0   0   43   79   52      L  RR L R        LLLR LS          V
   177  197 A A  H 3< S+     0   0   61   78   41      E  DD A D        AAEE AA           
   178  198 A A  T >< S+     0   0   57   78   43      A  EM D V        AADE AE           
   179  199 A H  T <   +     0   0   85   78   52      H  FY F H        HHFY YY           
   180  200 A L  T 3   +     0   0  131   74   46      V  LL   L        LLKE L            
   181  201 A S    <   +     0   0   82   73   63      T  KG   G        SSKA S            
   182  202 A S              0   0  120   72   57      A  A    A        SSDT S            
   183  203 A R              0   0  282   67   29      R                RRKR R            
   184      ! !              0   0    0   0     0  
   185    1 B M              0   0  221  130    9  M MM  V             V         I    M   
   186    2 B E        -     0   0  105  150   38  E EE  G  Q Q QQQQQ  D       EEAEE DE   
   187    3 B N  S    S+     0   0   43  157   69  NRRR  R  Q Q QQQQQ  V    R  RKKRR KR   
   188    4 B F  B     -G  207   0D  42  158    2  YYYY  Y  Y Y YYYYY YF    Y  YYYYY YY   
   189    5 B Q        -     0   0   79  158   54  EEKQ  E  E E EEEEE ED    E  KHEKK RK   
   190    6 B K        +     0   0  106  158   47  RRKR  K  C C CCCCC PI    P  IIVII II   
   191    7 B V        +     0   0   77  158   35  LQLI  L  V V VVVVV EV    I  VVMVV LI   
   192    8 B E        -     0   0  116  158   22  EEDE  E  A A AAAAA EC    E  GGEGG GG   
   193    9 B K  E     +I  203   0E  98  158   30  KKKK  K  E E EEEEE VQ    V  FFRFF KF   
   194   10 B I  E     -     0   0E  32  158   17  VIIg  I  I I IIIII LI    I  IIVII II   
   195   11 B G  E     -I  202   0E  23  159    5  GGGg  G  G G GGGGG GG    G  SSGSS GS   
   196   12 B E        +     0   0  129  159   13  EEEE  E  E E EEEEE EE    E  SSSSS ES   
   197   13 B G        -     0   0   50  162    0  GGGG  G  G G GGGGG GG    G  GGGGG GG   
   198   14 B T  S    S-     0   0  141  162   11  TTTT  T  A A AAAAA TT    T  TTATT TT   
   199   15 B Y  S    S+     0   0   59  162    0  YYYY  Y  Y Y YYYYY YY    Y  YYYYY YY   
   200   16 B G        -     0   0   20  162    5  GGGG  G  G G GGGGG GG    G  GGAGG GG   
   201   17 B V        -     0   0   10  162   60  SVVV  T  K K KKKKK IQ    I  RRDRR MR   
   202   18 B V  E     -I  195   0E  40  162    0  VVVV  V  V V VVVVV VV    V  VVVVV VV   
   203   19 B Y  E     -I  193   0E  49  162    2  YYYY  F  F F FFFFF FY    F  YYYYY FY   
   204   20 B K        +     0   0   76  162    6  RRKK  R  K K KKKKK RK    K  KKRKK KK   
   205   21 B A        -     0   0    1  162   21  CAAS  G  A A AAAAA AA    A  AAGAA AA   
   206   22 B R        -     0   0  133  162   51  RRQR  R  R R RRRRR RK    L  EVREE EQ   
   207   23 B N  B  >  -GH 188 211D  45  162   44  QDDD  D  D D DDDDD ND    D  gGRGG sg   
   208   24 B K  T  4 S+     0   0  112  161   76  VTTL  R  L L LLLLL KK    I  gK.RR ag   
   209   25 B L  T  4 S-     0   0  132  162   86  HANK  D  K K KKKKK AD    S  RNLNN VI   
   210   26 B T  T  4 S-     0   0   98  162   53  TTGT  G  N N NNNNN TT    T  TGSGG EV   
   211   27 B G  B  <  +H  207   0D   7  162   55  GgNQ  S  g g ggggg gG    g  GqDrr dG   
   212   28 B E        -     0   0  148  159   62  Tt.K  E  r r rrrrr kE    a  Eenee pE   
   213   29 B V        -     0   0   95  142   49  I.LV  .  F F FFFFF .L    .  ..t.. t.   
   214   30 B V        -     0   0    9  161   26  VVCV  V  V V VVVVV YV    Y  FFVFF FF   
   215   31 B A        -     0   0   12  162    8  AAAA  A  A A AAAAA AA    A  AAAAA AA   
   216   32 B L        -     0   0   12  162   17  LLLL  L  L L LLLLL IL    I  IILII II   
   217   33 B K        -     0   0   23  162   11  KKKK  K  K K KKKKK KK    K  KKKKK KK   
   218   34 B K        +     0   0   12  162   19  KRKR  R  R R RRRRR KK    K  KKEKK LK   
   219   35 B I        -     0   0   12  162   37  IIII  I  V V VVVVV LV    I  FFIFF VF   
   220   36 B R        +     0   0  100  162   20  RRRR  K  R R RRRRR RR    R  KKHKK KK   
   221   37 B L        -     0   0   33  162   32  LLLL  L  V V VVVVV LL    L  PPDPP SP   
   222   38 B D        -     0   0   96  162   36  EDEE  D  Q Q QQQQQ DE    D  DDYDD HD   
   223   39 B T  S    S+     0   0   75  161   78  ETAT  D  T T TTTTT GN    G  KKQKK KK   
   224   40 B E  S    S+     0   0  158  161   30  EEEE  D  S S GGGGG FE    L  EESEE EE   
   225   41 B T  S    S-     0   0   43  161   36  DEDD  E  E E EEEEE SK    R  ggAgg gg   
   226   42 B E  S    S-     0   0   70  160   11  EEED  E  E E EEEEE EE    E  st.ss vt   
   227   43 B G  S    S-     0   0   77  160    1  GGGG  G  G G GGGGG GG    G  GG.GG VG   
   228   44 B V  S    S-     0   0   85  160   22  VVII  V  M M MMMMM VF    V  IL.II LL   
   229   45 B P     >  -     0   0   26  160    7  PPPP  P  P P PPPPP PP    P  SS.SS SS   
   230   46 B S  H  >> +     0   0   87  160   38  SCSS  S  L L LLLLL AI    P  QQ.QQ SQ   
   231   47 B T  H  45S+     0   0   56  160   27  TTTT  S  S S SSSSS TT    T  SS.SS AS   
   232   48 B A  H  >>S+     0   0    1  160   19  AAAA  A  T T TTTTT TA    A  AA.AA TA   
   233   49 B I  H  X5S+     0   0  106  161   19  LIIL  L  I I IIIII IV    I  IVFII VI   
   234   50 B R  H  X5S+     0   0   38  161    1  RRRR  R  R R RRPRR RR    R  RRRRR RR   
   235   51 B E  H  >X   -     0   0   25  160   36  hHH.  H  h h hhhhh nH    h  HHsHH HH   
   245   61 B P  T 3  S+     0   0   91  160   63  EAP.  K  P P PPPPP PP    P  PPPPP DL   
   246   62 B N  T 3  S+     0   0   11  160   20  gNN.  N  N N NNSNN NS    N  NNNNN NN   
   247   63 B I  S <  S-     0   0    2  160   12  iII.  V  V V VVVVV VI    V  VVVVV VV   
   248   64 B V        -     0   0    9  160    3  VVV.  V  V V VVVVV VV    V  VVVVV MV   
   249   65 B K        -     0   0  116  161   55  KKR.  R  R R RRRRR KN    Q  HRVHH HS   
   250   66 B L        -     0   0   17  162    9  LLLH  L  L L LLLLL LL    L  TLLTT LT   
   251   67 B L        -     0   0   68  162   78  LLMP  L  F F FFFFF LK    L  VVHAA HR   
   252   68 B D        -     0   0   86  162   27  DDDN  D  D D DDDDD DE    N  EEEEE DE   
   253   69 B V        -     0   0   39  162   15  VVVI  V  V V VVVVV VI    V  IIYII VI   
   254   70 B I  B     -J  261   0F  27  162   54  ICVV  L  C C CCCCC VV    L  IIFII HI   
   255   71 B H        +     0   0  160  162   64  HHHR  H  T T TTTTT CT    C  LLWLL VL   
   256   72 B T        -     0   0   56  162   75  VSTR  T  V V VVVVV SD    E  EEREE DE   
   257   73 B E  S    S+     0   0  161  162   40  DEDT  D  S S SSSSS DK    K  DDEDD PD   
   258   74 B N  S    S-     0   0   86  162   71  ESKA  K  r r rrrrr Hq    H  KRdKK rK   
   259   75 B K  S    S-     0   0   48  161   59  SRR.  K  k k kkkkk Ra    R  CCdCC sC   
   260   76 B L        -     0   0   26  161   13  LLL.  L  L L LLLLL VF    V  IIAII LI   
   261   77 B Y  B     -J  254   0F  23  161   53  STT.  T  T T TTTTT YY    Y  YFVYY AF   
   262   78 B L        -     0   0    0  162    5  LLLS  L  L L LLLLL LL    L  IMLII LI   
   263   79 B V        -     0   0   10  162    7  VVVC  V  V V VVVVV VV    V  VVVVV VV   
   264   80 B F        -     0   0   20  162    4  FFFF  F  F F FFFFF FF    F  FFLFF FF   
   265   81 B E        -     0   0   55  162    2  EEES  E  E E EEEEE EE    E  EEEEE EE   
   266   82 B F        +     0   0   40  162   23  FYYC  Y  H H HHHHH LY    L  YYFYY YY   
   267   83 B L        -     0   0   30  162   43  LMLL  C  V V VVVVV LM    L  ATLAA GA   
   268   84 B H  S    S-     0   0   89  162   42  DEDS  S  D D DDDDD DD    K  EEREE DE   
   269   85 B Q  E     -K  319   0G  36  162   76  LLQL  V  Q Q QQQQQ EH    E  HHTHH HH   
   270   86 B D  E  >  -K  318   0G  20  162    2  DDDW  D  D D DDDDD DD    D  DDDDD DD   
   271   87 B L  H  > S+     0   0    0  162    2  LLLT  L  L L LLLLL LL    L  LLLLL LL   
   272   88 B K  H  > S+     0   0   84  162   26  KKKW  K  T T TTTTT RM    R  LLALL HL   
   273   89 B K  H  > S+     0   0   67  162   34  KKET  I  T T TTTTT IG    V  QQTQQ DQ   
   274   90 B F  H  < S+     0   0    9  162   40  YYVS  W  Y Y YYYYY FL    F  IIVII II   
   275   91 B M  H  < S+     0   0   11  162   28  MMLR  L  L L LLLLL IL    I  IIVII II   
   276   92 B D  H >< S+     0   0   89  162   32  DDDG  K  D D DDDND KE    R  HHAHH VH   
   277   93 B A  T 3< S+     0   0   82  162   67  VQDT  K  K K KKKKK RS    R  HHDHH QH   
   278   94 B S  T >> S+     0   0   22  162   87  AECW  Y  V V VVVVV YG    H  HHAHH SH   
   279   95 B A  T <4 S+     0   0   48  162   67  AERN  H  P P PPPPP RL    R  NTANN KT   
   280   96 B L  T 34 S+     0   0  160  162   83  LGPT  T  E E EEEEE PV    P  QQKQQ QT   
   281   97 B T  T <4 S-     0   0  122  162   83  aNSt  s  P P PPPPP vE    l  ppapp Kp   
   282   98 B G     <  -     0   0   14  122   78  g.Gs  k  G G GGGGG a.    v  aapaa Pc   
   283   99 B I        -     0   0   21  157   44  LLLC  L  V V VVVVV VF    L  IILII LI   
   284  100 B P     >  -     0   0   67  162   62  PDES  H  P P PPPPP PN    P  PPPPP GP   
   285  101 B L  H  > S+     0   0  104  162   85  AAPR  A  T T TTTTT LE    L  AAAAA EA   
   286  102 B P  H  > S+     0   0   63  162   82  DAQV  P  E E EEEEE HL    R  RPGRR YP   
   287  103 B L  H  > S+     0   0    1  162   60  LTVL  E  T T TTTTT LH    L  TMETT TT   
   288  104 B I  H >X S+     0   0    5  162   28  VIVR  V  I I IIIII VV    V  IVLII RI   
   289  105 B K  H 3X S+     0   0   34  162   19  AQKS  S  K K KKKKK RA    K  KKKKK KR   
   290  106 B S  H 3X S+     0   0    3  162   60  KDSR  A  D D DDDDD ES    D  SSRSS SS   
   291  107 B Y  H X S+     0   0    0  162   24  MMLR  F  M M MMMMM TM    T  LLMLL ML   
   293  109 B F  H 3X S+     0   0   49  162   55  SRYA  Y  L L FFFFL RK    R  YFIYY YW   
   294  110 B Q  H 3X S+     0   0   22  162    3  QDQA  Q  Q Q QQQQQ QQ    Q  QQQQQ QQ   
   295  111 B L  H X S+     0   0    3  162   30  LVIL  L  L L LLLLL LL    L  LLLLL VL   
   300  116 B A  H 3X S+     0   0   12  162   78  ARAL  S  D D DDDDD WS    W  VLDVV DL   
   301  117 B F  H 3< S+     0   0   45  162   23  HFYF  Y  F F FFFFF TY    S  YYAYY YY   
   302  118 B C  H X<>S+     0   0    2  162   35  LCCI  C  L L LLLLL CC    C  LLCLL ML   
   303  119 B H  H ><5S+     0   0   21  162    1  HHHY  H  H H HHHHH HH    H  HHHHH HH   
   304  120 B S  T 3<5S+     0   0   79  162   63  SDQC  A  S S SSSSS NR    N  RSRKR DR   
   305  121 B H  T < 5S-     0   0   62  162   44  RRHW  K  H H HHHHH NK    S  NNHNN VN   
   306  122 B R  T < 5S+     0   0  164  162   42  RNRW  S  R R RRRRR RN    R  WWMWW WW   
   307  123 B V  E   < -M  335   0H   2  162   14  IVVP  V  V V VVVVV IF    I  VVVVV VV   
   308  124 B L  E     -M  334   0H   0  162   13  LLLC  L  V V VVVVV LL    I  MLLMM MM   
   309  125 B H        +     0   0    2  162    2  HHHR  H  H H HHHHH HH    H  HHHHH HH   
   310  126 B R        +     0   0   51  162    2  RRRS  R  R R RRRRR RR    R  RRRRR RR   
   311  127 B D        +     0   0   22  162    0  DDDD  D  D D DDDDD DD    D  DDDDD DD   
   312  128 B L        +     0   0    4  162    1  LLLL  L  L L LLLLL LI    L  LLLLL ML   
   313  129 B K  S >  S-     0   0   28  162    0  KKKK  K  K K KKKKK KK    K  KKKKK KK   
   314  130 B P  G >  S+     0   0    4  162    1  PPPP  P  P P PPPPP PC    P  PPPPP PP   
   315  131 B Q  G 3  S+     0   0   94  162   20  QPQQ  Q  Q Q QQQQQ GS    G  AASAA QA   
   316  132 B N  G <  S+     0   0    9  162    0  NNNN  N  N N NNNNN NN    N  NNNNN NN   
   317  133 B L  E <   - L   0 327G   0  162   13  LLLL  L  I I IIIII II    V  IILII II   
   318  134 B L  E     -KL 270 326G  36  162    0  LLLL  L  L L LLLLL LL    L  MLLMM LM   
   319  135 B I  E     -KL 269 325G   0  162   16  IIIV  I  V V VVVVV VM    V  VVIVV VV   
   320  136 B N    >   -     0   0   25  162   46  DSSN  H  T T TTTTT AN    A  TTSTT VT   
   321  137 B T  T 3  S+     0   0   70  162   68  KRRA  E  S S SSSSS nN    e  sseSS gs   
   322  138 B E  T 3  S-     0   0   89  158   70  QEDK  G  S N SSSSS eR    e  ...AA k.   
   323  139 B G  S <  S+     0   0    0  161   37  GKGG  .  G G GGGGG kG    e  gggGG gg   
   324  140 B A        -     0   0   14  162   79  NSTA  V  Q Q QQQQQ fQ    y  KALKK QS   
   325  141 B I  E     -L  319   0G   1  161   27  LLLL  L  I I IIIII vI    v  VVLII VV   
   326  142 B K  E     -L  318   0G  36  162    2  KKKK  K  K K KKKKK KK    K  KRKKK KK   
   327  143 B L  E     +L  317   0G   4  162   20  ILLI  L  L L LLLLL LL    L  IIIII LI   
   328  144 B A        +     0   0   14  162   13  AAAA  A  A A AAAAA AA    A  GGAGG GG   
   329  145 B D    >   +     0   0   44  162    0  DDDD  D  D D DDDDD DD    D  DDDDD DD   
   330  146 B F  G >   +     0   0    1  162    4  FFFF  F  F F FFFFF FF    F  LLFLL FL   
   331  147 B G  G 3  S+     0   0   13  162    0  GGGG  G  G G GGGGG GG    G  GGGGG GG   
   332  148 B L  G <  S+     0   0   73  162    1  LLLL  L  L L LLLLL LL    L  LLQLL LL   
   333  149 B A    <   +     0   0    0  162   14  AGAA  A  A A AAAAA AA    S  AAAAA AA   
   334  150 B R  E     -M  308   0H  96  162    0  RRRR  R  R R RRRRR RR    R  RRRRR RR   
   335  151 B A  E     -M  307   0H  56  162   34  AAAV  A  I I IIIII ML    T  LLILL IL   
   336  152 B F  S    S+     0   0   74  162    5  FFFF  V  Y Y YYYYY FY    F  FFLFF FF   
   337  153 B G        +     0   0   50  162   43  GGGS  G  S S SSSSS Es    E  yytyy kf   
   338  154 B V  B     -N  364   0I  28  160   29  VIIL  L  F F F..FF Md    M  llkll il   
   339  155 B P        -     0   0   72  162   23  PPPP  P  Q Q QFFQQ SK    S  QNEQQ KQ   
   340  156 B V        +     0   0   42  162   42  LVVI  V  M M MQQMM VS    V  SSLSS AS   
   341  157 B R        -     0   0  158  158   40  RKRK  R  . A .MM.. QR    E  LLGLL LL   
   342  158 B T        -     0   0   51  161   73  TKAK  Q  A . AAAAA TP    T  FFCFF SY   
   343  159 B Y    >   -     0   0   63  162   23  YFYY  Y  L L LLLLL YY    Y  SSLSS DM   
   344  160 B X  T 3  S+     0   0   15  162   26  TTTT  S  T T TTTTT TT    T  ggTgg vg   
   345  161 B H  T 3  S+     0   0   63  162   42  HHHH  N  S S SSSSS HN    H  kkSkk rk   
   346  162 B E    <   +     0   0   76  162   26  EEEE  E  V V VVVVV EK    E  VVCVV VV   
   347  163 B V        +     0   0   72  162    8  IVVV  V  V V VVVVV VV    V  VVVVV VV   
   348  164 B V        -     0   0   78  162    9  IVVV  V  V V VVVVV MI    M  VVGVV VV   
   349  165 B T        -     0   0   62  161    2  TTTT  T  T T TTTTT TT    T  TTTTT TT   
   350  166 B L    >   +     0   0   15  161    6  LLLL  L  L L LLLLL LL    L  IIRII LI   
   351  167 B W  T 3  S+     0   0   88  161    0  WWWW  W  W W WWWWW WW    W  WWWWW WW   
   352  168 B Y  T 3  S+     0   0   35  161    0  YYYY  Y  Y Y YYYYY YY    Y  YYFYY YY   
   353  169 B R    <   -     0   0   73  161    0  RRRR  R  R R RRRRR RR    R  RRRRR RR   
   354  170 B A    >>  -     0   0    1  161   24  PSAA  P  A A AAAAA SP    A  AAAAA AA   
   355  171 B P  H 3> S+     0   0    0  161    1  LPPP  P  P P PPPPP PP    P  PPPPP PP   
   356  172 B E  H 34 S+     0   0    8  161   10  EDDE  D  E E EEEEE EE    E  EEEEE EE   
   357  173 B I  H X4 S+     0   0   15  161   18  VVVI  V  V V VVVVV IL    I  LLLLL LL   
   358  174 B L  H 3< S+     0   0    3  161    1  LLLL  L  L L LLLLL IL    I  LLLLL LL   
   359  175 B L  T 3< S-     0   0    0  161    6  LLML  L  L L LLLLL LL    L  LLYLL LL   
   360  176 B G    <   +     0   0    7  161   11  GGGG  G  Q Q QQQQQ GG    N  GGGGG GG   
   361  177 B C        -     0   0   26  161   52  GSSQ  A  S S SSSSS DE    Q  SSSSS AS   
   362  178 B K  S    S-     0   0  122  161   62  RTNE  R  S S SSSSS RE    R  RRRRR KR   
   363  179 B Y  S    S-     0   0  142  154   79  HQTV  V  . . ..... HR    H  HHDHH HH   
   364  180 B Y  B     -N  338   0I  48  161    0  YYYY  Y  Y Y YYYYY YY    Y  YYYYY YY   
   365  181 B S    >   -     0   0   46  161   34  TGSS  T  A A AAAAA TG    S  TTGTT TT   
   366  182 B T  T 3> S+     0   0   41  161   32  TTTP  F  T T TTTTT PP    S  PPLPP KP   
   367  183 B A  T 34 S+     0   0    7  161   53  GPPP  T  P A PPPPP AA    S  AAEAA AA   
   368  184 B V  T X> S+     0   0   11  161   12  VVVV  V  V V VVVVV AI    A  VVVVV VI   
   369  185 B D  H 3> S+     0   0    0  161    0  DDDD  D  D D DDDDD DD    D  DDDDD DD   
   370  186 B I  H 3< S+     0   0    2  161   35  VIII  S  L L LLLLL VV    V  LLLLL LM   
   371  187 B W  H <> S+     0   0    1  161    0  WWWW  W  W W WWWWW WW    W  WWWWW WW   
   372  188 B S  H  X S+     0   0    6  161    9  SSSS  S  S S SSSSS SS    S  AASAA AA   
   373  189 B L  H  X S+     0   0    7  161   42  CVIV  A  V V VVVVV VC    L  VVLII VV   
   374  190 B G  H >> S+     0   0    0  161    3  AGGG  G  G G GGGGG GG    G  GGGGG GG   
   375  191 B C  H 3X S+     0   0    0  161   23  TCCV  C  C C CCCCC CC    C  CCCCC CC   
   376  192 B I  H 3X S+     0   0    0  161    0  IIII  I  I I IIIII II    I  IIIII II   
   377  193 B F  H XX S+     0   0    0  161   12  FFFF  F  F F FFFFF VL    V  FFFFF FF   
   378  194 B A  H 3X S+     0   0    1  161    9  AAAA  A  A A AAAAA AG    A  AAAAA VA   
   379  195 B E  H 3X S+     0   0   13  161    0  EEGE  E  E E EEEEE EE    E  EEEEE EE   
   380  196 B M  H << S+     0   0    2  161    8  MMTM  I  M M LMMMM ML    M  LLLLL LL   
   381  197 B V  H  < S+     0   0    5  161   71  SVPV  a  F F FFFFF IF    I  llLll il   
   382  198 B T  H  < S-     0   0   17  160   71  TI.L  s  R R RRRRR LT    L  dqTdd kk   
   383  199 B R  S  < S+     0   0  102  161   67  GG.K  G  R R RRRRR GR    G  RNLRR EQ   
   384  200 B R  S    S-     0   0  173  161   52  LA.K  T  K K KKKKK YK    N  WWQWW VW   
   385  201 B A        -     0   0   31  161   27  PP.P  P  P P PPPPP SP    S  PPPPP EP   
   386  202 B L  S    S+     0   0   32  161    9  LL.L  L  L L LLLLL LV    L  LGLLL GL   
   387  203 B F  S    S-     0   0    4  161    5  VF.F  F  F F FFFFF FF    F  LLFLL SL   
   388  204 B P        -     0   0   32  161   49  PA.P  P  R R RRRRR RQ    C  TAPTT NS   
   389  205 B G        +     0   0   11  161    6  GG.G  G  G G GGGGG GA    G  SSGAS AS   
   390  206 B D  S    S+     0   0   57  161   47  DK.D  Q  N N SSSSS ES    E  MMTMM PM   
   391  207 B S  S >> S-     0   0    2  161   37  SN.S  D  S S SSSSS NQ    N  PPAPP FP   
   392  208 B E  H 3> S+     0   0   26  161   32  ED.E  I  D D DDDDD WE    A  EEDEE QE   
   393  209 B I  H 3> S+     0   0   14  161   54  IA.I  E  V V VVVVV RM    K  HYIHH KY   
   394  210 B D  H <> S+     0   0   42  161   18  DD.D  D  D D DDDDD DA    D  PGDHP DS   
   395  211 B Q  H  X S+     0   0    0  161   20  QQ.Q  Q  Q Q QQQQQ QQ    Q  QQQQQ QQ   
   396  212 B L  H >X S+     0   0    0  161   16  IL.L  L  L L LLLLL LL    L  LLLLL LL   
   397  213 B F  H 3X S+     0   0   32  161   69  FL.Y  R  G G GGGGG DE    N  SQSSA DS   
   398  214 B R  H 3X S+     0   0   86  161   46  KR.R  I  K K KKKKK KS    K  SARSS KT   
   399  215 B I  H   -     0   0   83  157   61  TNGN  N  E E GGGGG TC    T  ..D.. T.   
   408  224 B E  T  4 S+     0   0   80  157   23  ENLD  D  E E EEEEE EP    E  ..E.. P.   
   409  225 B V  T  4 S+     0   0  124  158   64  QQPT  N  E E EEEEE QA    E  ..S.F Q.   
   410  226 B V  T  4 S+     0   0   51  159   76  TVQS  E  D D DDDDD TV    T  ..A.P TV   
   411  227 B W  S >< S-     0   0   10  161    4  WWWW  W  W W WWWWW WW    W  F.WFR WH   
   412  228 B P  T 3  S+     0   0   82  161   13  PPRP  P  P P PPPPP PP    P  P.APP ER   
   413  229 B G  T 3  S+     0   0   31  162   44  GSNG  T  N N RRRRR GR    G  RHGRQ GP   
   414  230 B V    X   +     0   0    0  162   37  LMNV  M  D D DDDDD VV    V  PICSS LI   
   415  231 B T  T 3  S+     0   0   73  162   66  KnFT  R  V V vvvvv TI    T  qhSqg eg   
   416  232 B S  T 3  S+     0   0   89  159   77  Qs.K  R  . . ppppp KQ    K  glKgg hk   
   417  233 B M  S X  S-     0   0   23  159   29  MK.L  L  . . RRRRR LL    L  LELLL VQ   
   418  234 B P  T 3  S+     0   0   62  159   37  PP.R  P  . . QQQQQ PP    P  EPPEE VN   
   419  235 B D  T 3  S+     0   0   21  162   34  DEKD  D  A A AAAAA GH    G  RWDRR QG   
   420  236 B Y    <   -     0   0   28  162   11  YFYY  Y  L L FFFFF YW    Y  WYYWW MY   
   421  237 B K    >   -     0   0   46  162   56  KLYA  R  P P HHHHH DA    N  YNAYY GP   
   422  238 B P  T 3  S+     0   0   98  162   71  AQPP  P  R R SSSSS RT    T  HAIHH RP   
   423  239 B S  T 3   +     0   0   91  162   85  SNPT  F  n n KKKKK NF    k  QciQQ EV   
   424  240 B F  S <  S-     0   0    8  121    7  FL.F  .  f f ..... FR    f  ..f.. ..   
   425  241 B P        -     0   0   47  151   15  PAMP  P  A T ..... KP    K  ..S.. R.   
   426  242 B K        -     0   0  158  154   67  QAKK  R  S S ..... VK    I  T.KTT K.   
   427  243 B W        -     0   0   64  155   20  WEWW  F  R R ..... YK    Y  L.VLL Y.   
   428  244 B A        -     0   0   91  161   77  rCKK  P  P P SSSSS hq    r  t.enn PE   
   429  245 B R        -     0   0  116  151   71  ...R  A  A A AAPPP .r    .  nkpnn TK   
   430  246 B Q        -     0   0   77  156   72  .e.K  e  Q Q QQQQQ .R    .  qnAqq qs   
   431  247 B D    >>  -     0   0   86  155   74  dq.I  n  P P PPPPP pR    p  psGpp eg   
   432  248 B F  H 3> S+     0   0   19  161   47  LF.M  W  I I IIIII LL    L  LYLII LE   
   433  249 B S  H 34 S+     0   0   77  161   78  RR.S  S  E E EEEEE PR    T  SSEGG KK   
   434  250 B K  H <4 S+     0   0   98  162   78  QtYE  E  K K KKKNK TE    T  ApASS nK   
   435  251 B V  H  < S-     0   0   16  161   73  LaIL  Q  F F FFFFF RD    R  GtCGG vA   
   436  252 B V    ><  +     0   0    0  162   51  LYVF  V  V V VVVVV LF    L  PALPP KA   
   437  253 B P  T 3  S+     0   0   61  162   53  PAPP  P  P P TTTST RS    P  EGPDD VE   
   438  254 B P  T 3  S+     0   0   59  162   74  EKGQ  T  D D DDDDD DF    G  TTNTT GN   
   439  255 B L  S <  S-     0   0   18  162   32  MLLL  L  I I IIIII YL    Y  PPRPP PP   
   440  256 B D        -     0   0   77  162   43  DGSD  S  D D DDDDD DP    D  GGSGG GG   
   441  257 B E  S    S+     0   0  150  162   67  DPEE  E  E E EEEEE EP    P  QKPPP RP   
   442  258 B D  S >> S+     0   0   52  162   79  REAS  T  M L LLQQL KH    K  EEDEE AE   
   443  259 B G  H 3> S+     0   0    0  162   15  AGGG  G  G G GGGGG AA    A  GGEGG GG   
   444  260 B R  H 34 S+     0   0   53  162   64  LILL  I  K K KKKKK VL    V  LFVLL AL   
   445  261 B S  H <> S+     0   0   38  162   29  HDDN  D  D D DDDDD ED    E  SDASS AD   
   446  262 B L  H >X S+     0   0    1  162    1  LLLL  L  L L LLLLL FL    F  LLLLL LL   
   447  263 B L  H 3X S+     0   0    0  162    7  LLLL  L  L L LLLLL IL    I  LLVLL LL   
   448  264 B S  H 34 S+     0   0   40  161   78  NRSE  K  L L LLLLL AD    A  KSKKK DK   
   449  265 B Q  H X< S+     0   0   74  161   69  GRQS  K  K K KKKKK YQ    F  QRKQQ LA   
   450  266 B M  H 3< S+     0   0    1  161   28  MLMM  M  C C CCCCC LM    L  LLLLL LL   
   451  267 B L  T 3< S+     0   0    8  161    8  LLLL  L  L L LLLLL LL    L  LLVLL SL   
   452  268 B H    <   -     0   0   47  161   85  QKTR  M  A A TTTTT VE    H  EECEE RT   
   453  269 B Y  S    S+     0   0    7  161   37  IYFY  P  F F FFFFF TL    T  YYYYY LY   
   454  270 B D    >>  -     0   0   13  161   34  DEED  N  N N NNNNN ND    N  DNDDD LD   
   455  271 B P  T 34 S+     0   0   35  161    4  PPAP  P  P P PPPPP PP    P  PPPPP EP   
   456  272 B N  T 34 S+     0   0  126  161   75  ESSC  H  A A AAAAA KE    K  QAAQQ YQ   
   457  273 B K  T <4 S+     0   0  118  161   70  KERT  S  K K KKKKK LR    S  KKKKK DQ   
   458  274 B R  S  < S-     0   0   11  161    1  RRRR  R  R R RRRRR RR    R  RRRRR PR   
   459  275 B I        -     0   0   18  161   17  ILII  L  I I IIIII PI    P  LIALL II   
   460  276 B S     >  -     0   0   73  161   38  STSS  T  S S SSSSS TT    T  TTTTT TT   
   461  277 B A  H  > S+     0   0    5  161    5  AAAA  A  A A AAAAA IA    I  AAAAA AA   
   462  278 B K  H  > S+     0   0  168  161   58  KAKK  D  Y Y YYYYY PE    S  EKMEE KE   
   463  279 B A  H  > S+     0   0   50  161   71  QQTE  Q  A V GSSGS DA    E  KEEKK EQ   
   464  280 B A  H  < S+     0   0    1  161   16  AAAA  A  A A AAAAA IA    I  AALAA AA   
   465  281 B L  H  < S+     0   0   45  161   39  LLML  L  L L LLLLL LL    F  LLLLL LL   
   466  282 B A  H  < S+     0   0   69  161   81  REQR  M  S S NASSS ER    D  LEHLL EQ   
   467  283 B H  S >< S-     0   0   16  161    4  HHHH  H  H H HHHHH HG    H  HHDHH HH   
   468  284 B P  G >  S+     0   0   74  161   39  HPSP  Q  P P PPPPP PP    P  PPKPP EK   
   469  285 B F  G 3  S+     0   0    7  161    4  YYYY  Y  Y Y YYYYY FW    F  YYYYY YY   
   470  286 B F  G X  S+     0   0    4  160    1  FFFF  F  F F FFFFF ML    L  FFFFF FF   
   471  287 B Q  T <  S+     0   0  147  154   70  QSDD  T  H H QQHHH KA    A  TSS   KT   
   472  288 B D  T 3  S+     0   0  127  149   41  A DD  M  G D DDDDD DP    S  VTE   ET   
   473  289 B V    <   +     0   0   41  123   44    IV  L  L L LLLLL  V       H E   IG   
   474  290 B T        -     0   0   95  103   63    DD  N  E E EEEEE          G P   VE   
   475  291 B K        -     0   0  110   89   74    PS  G  K K RRRRR          K L   RK   
   476  292 B P        -     0   0   28   75   78    AE  N  C F YGCRC          P P   SP   
   477  293 B V        -     0   0   97   48   78    L   S  K K KKKKK            V   L    
   478  294 B P        -     0   0   16   42   83    R   R  E E DEEEE            P   V    
   479  295 B H              0   0  170   36   76    E   T  N N NSNSN                C    
   480  296 B L              0   0   78   25    3        L  L L LLLLL                L    
## SEQUENCE PROFILE AND ENTROPY
 SeqNo PDBNo   V   L   I   M   F   W   Y   G   A   P   S   T   C   H   R   K   Q   E   N   D  NOCC NDEL NINS ENTROPY RELENT WEIGHT
    1   21 A   0   0   0   0   0   0   0   1   3   0   0   0   0   0   0   0   1  87   0   7    67    0    0   0.549     18  0.84
    2   22 A   3   0   1   0   0   0   0   1   0   0   1   0   0   0   0   1   1  29   3  58    69    0    0   1.187     39  0.54
    3   23 A   0   0   0   0   0   0   4   1   0   0   0   0   0   1   0   0   6  78   1   8    72    0    0   0.874     29  0.66
    4   24 A   0  12   0   0   0   0   0   0   1   4   0   5   1   3   1   1  64   4   0   1    73    0    0   1.355     45  0.29
    5   25 A   0   4   0   0   0   0   0   0   1   3   8  79   0   0   0   0   1   1   1   1    75    0    0   0.904     30  0.53
    6   26 A   0   0   1   0   0   0   0   0   0  96   1   0   0   0   0   1   0   0   0   0    78    0    0   0.205      6  0.91
    7   27 A   4  27  52   1  15   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0    79    0    0   1.214     40  0.65
    8   28 A   0   3   0   0   0   1   0   0   0   3   0   0   0  24   6   8  52   3   0   1    79    0    0   1.443     48  0.44
    9   29 A  15   3  80   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   1    79    0    0   0.670     22  0.85
   10   30 A   0   0   0   0   0   0   0   0   1   0  78   4   0   0   0   0   1   0   0  15    79    0    0   0.711     23  0.54
   11   31 A   0   0   0   1   1  96   0   0   0   0   0   0   0   0   0   1   0   0   0   0    80    0    0   0.201      6  0.92
   12   32 A   2  95   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    81    0    0   0.231      7  0.92
   13   33 A   0   0   0   0   0   0   0   0   2  53  28   1   0   0   0   1   0   0   0  14    81    0    0   1.165     38  0.42
   14   34 A   2  94   0   0   0   0   0   0   0   1   1   1   0   0   0   0   0   0   0   0    82    1    0   0.311     10  0.82
   15   35 A   0   0   0   0   0   0   0   1   1   2  91   1   0   0   0   0   0   1   0   1    81    0    0   0.445     14  0.79
   16   36 A   7   4   4  11   2   0   0   1   1   9   5   0   2   0  46   1   5   1   0   0    82    0    0   1.933     64  0.09
   17   37 A  80   1   2   0   5   1   4   0   2   1   0   0   0   0   0   1   0   1   0   0    82    0    0   0.893     29  0.52
   18   38 A   1   0   0   0   1   0   6  13   1   1   0   1   0   1   0   1   0  11  57   4    82    3    1   1.499     50  0.31
   19   39 A   0   0   1   0   3   4  10   0   0   1  15   0  66   0   0   0   0   0   0   0    79    1    0   1.121     37  0.50
   20   40 A   0   1   0   0   0   0   0   0   3   9  76   5   3   0   0   0   0   3   0   1    79    0    0   0.965     32  0.52
   21   41 A   0   2   0   0   0   0   0   4   2   0   0   1   0   1   0   1  76   6   1   5    82    0    0   1.046     34  0.56
   22   42 A   0   1   0   0  79   0   0   0   0   1  12   0   0   0   1   2   1   0   1   0    82    0    0   0.800     26  0.32
   23   43 A   6  92   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    83    1    0   0.340     11  0.88
   24   44 A   0   0   0   0   0   0   0  96   4   0   0   0   0   0   0   0   0   0   0   0    82    0    0   0.157      5  0.94
   25   45 A   5  67  28   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    82    1    0   0.772     25  0.73
   26   46 A   0   0   0   0   0   0   0   0   0   0  11   7  81   0   0   0   0   0   0   0    81    2    0   0.604     20  0.64
   27   47 A   0   1   3   0   1   0   0   6  62   1  24   0   0   0   0   0   1   0   0   0    79    0    0   1.128     37  0.42
   28   48 A   0  97   0   1   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0    79    1    0   0.136      4  0.94
   29   49 A   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0    79    0    0   0.000      0  1.00
   30   50 A   0   0   0   0   0   0   0  97   0   1   0   0   0   0   0   0   0   0   0   1    79    4    2   0.136      4  0.96
   31   51 A   0   0   0   0   0   0   0   0   0   0   1   0  97   0   0   0   1   0   0   0    77    0    0   0.138      4  0.91
   32   52 A   0   0   0   0   0   0   0   0   0   1   1   0   0   0  23  73   0   0   1   0    79    0    0   0.730     24  0.72
   33   53 A   0   0   1   0  82   0  12   1   0   0   0   0   0   0   4   0   0   0   0   0    82    0    0   0.650     21  0.72
   34   54 A   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0  98   0   0   0   1    82    0    0   0.132      4  0.91
   35   55 A   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   7  16  76    82    0    0   0.748     24  0.77
   36   56 A  62   0  17   0   0   0   1   0   0   0   2  10   0   1   2   0   0   0   4   0    82    0    0   1.234     41  0.38
   37   57 A   0   0   0   0   0  12   0   1   0   0   2   0   0   0  79   1   0   0   1   2    82    0    0   0.783     26  0.73
   38   58 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0    82    0    0   0.000      0  1.00
   39   59 A   1   0   0   0   0   0   0   0   0   0  10   0   1   0   0   0   0   0  79   9    82    1    0   0.729     24  0.62
   40   60 A  31  40  26   1   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0    81    0    0   1.225     40  0.64
   41   61 A   0   1   1   0   0   0   0   1   2   0   1   0   1   0   0   2  72  13   0   4    83    0    0   1.068     35  0.54
   42   62 A   0   0   0   0   0   0   0   0   4   0   2   1   0   2  11  75   0   2   2   0    83    0    0   0.991     33  0.53
   43   63 A   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  99    83    0    0   0.065      2  0.96
   44   64 A   8  11  23   4   0   0   0   0   0   2   1  51   0   0   0   0   0   0   0   0    84    0    1   1.386     46  0.30
   45   65 A   0   0   0   0   0   0   0   8   2   0   0   1   0   0   0   4   1  75   1   7    84    0    0   0.978     32  0.63
   46   66 A   0   0   0   0   0   0   5   2   4   0   0   4   2   0   0   0   0  80   0   4    85    0    0   0.853     28  0.52
   47   67 A   1  88   5   4   0   0   0   1   0   1   0   0   0   0   0   0   0   0   0   0    85    1    0   0.529     17  0.84
   48   68 A   0   1   1   0   0   4   0   0   1   0   0   1   4   1   5  73   8   1   0   0    84    0    0   1.139     38  0.44
   49   69 A   0   5   0   0   0   0   0   4   5   0  54   1   0   0   6   1   0   2  19   4    84    0    0   1.541     51  0.27
   50   70 A   0   1   0   0   0   0  23   0   1   0   1   0  37   7   0   0  19  11   0   0    84    1    0   1.606     53  0.04
   51   71 A   0   0   0   0   0   0   0  87   0   0   6   0   0   0   0   0   1   0   0   6    83    0    0   0.515     17  0.79
   52   72 A  24   0  71   0   0   0   0   0   2   0   0   2   0   0   0   0   0   0   0   0    83    0    0   0.765     25  0.77
   53   73 A   0   1   0   0   0   0   0   0   0   0   6   2   0   1   4   1  76   7   0   1    83    0    0   0.991     33  0.50
   54   74 A   1   0   0   0   0   0   0   0   0   0   1   1   1   1   0   0   0   8   0  86    83    0    0   0.608     20  0.73
   55   75 A  45   1  54   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    83    0    0   0.745     24  0.84
   56   76 A   4   4   0   0  89   0   2   0   1   0   0   0   0   0   0   0   0   0   0   0    83    0    0   0.485     16  0.81
   57   77 A  92   0   1   0   0   0   0   0   0   1   2   0   4   0   0   0   0   0   0   0    83    0    0   0.397     13  0.76
   58   78 A   0  28   0   0  72   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    83    0    0   0.590     19  0.89
   59   79 A   0   4   2   0   0   0   0   0   0   0   0   0  94   0   0   0   0   0   0   0    83    0    0   0.268      8  0.73
   60   80 A   0   0   0   0   0   0   0   0   0   0   4  95   0   0   0   0   0   1   0   0    83    0    0   0.220      7  0.88
   61   81 A   0   0   0   0   0   0   0   2   0   1   0   1   0   0  78  13   0   2   0   1    83    0    0   0.799     26  0.61
   62   82 A   0   0   0   0   1   0   0  93   2   0   0   0   0   0   0   0   0   0   2   1    83    0    0   0.356     11  0.82
   63   83 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0    83    0    0   0.000      0  1.00
   64   84 A   0  92   0   5   2   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0    83    0    0   0.370     12  0.93
   65   85 A   5   2   0   0   1   0   0   4   2   0  66   5   0   5   1   0   2   1   4   1    83    0    0   1.433     47  0.32
   66   86 A   0   5   0   2   0   1   0   0   0   0   0   0   0   1   7  81   0   2   0   0    83    0    0   0.795     26  0.58
   67   87 A   0   1   0   0   0   0  96   0   0   0   0   0   2   0   0   0   0   0   0   0    83    0    0   0.178      5  0.94
   68   88 A   0   0   0   0   0   0   0   5   0   0   0   0   0   0  95   0   0   0   0   0    83    0    0   0.193      6  0.79
   69   89 A  98   0   0   1   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0    83    0    0   0.130      4  0.94
   70   90 A   0   0   0   0   0   0   0   0   1  92   2   1   0   0   1   1   1   0   0   0    83    0    1   0.437     14  0.79
   71   91 A   0   1   0   0   0   1   1   6   0   0   7   5   4   1   2   0   4   1  61   5    83    0    0   1.547     51  0.30
   72   92 A   0  98   1   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0    83    0    0   0.130      4  0.94
   73   93 A   0  84   7   2   0   0   0   0   0   1   0   1   0   1   0   2   0   0   0   0    83    0    0   0.673     22  0.70
   74   94 A   0   0   0   0   0   0   0   0   4   0   0   2   0   2   0   0   2  23   2  64    83    0    0   1.103     36  0.64
   75   95 A  10  47   0   0   7   0   0   0  12   0   6   5   0   1   1   0   1  10   0   0    83    0    0   1.726     57  0.14
   76   96 A   0   0   0   1   1   0  95   0   1   0   0   1   0   0   0   0   0   0   0   0    83    0    0   0.260      8  0.86
   77   97 A   0   1   0   0   0   0   0   1   2   0   4   4   0  11   5   4  60   7   1   0    83    0    0   1.492     49  0.41
   78   98 A   0   0   0   0   0   0   0   1   0   0   4   1   0   2   7   2  72   4   4   2    83    0    0   1.160     38  0.50
   79   99 A   0   0   0   0   0   0  20   0   5   1   5   0  31  17  11   0   8   0   0   1    83    0    0   1.837     61  0.10
   80  100 A   0   0   0   0   0   0   0  95   0   0   1   0   0   0   0   0   0   1   0   2    83    0    0   0.243      8  0.92
   81  101 A   2  13  65   5  14   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    83    0    0   1.063     35  0.67
   82  102 A   6   1  46   0   0   0   0   0   4   0   6  18   7   0   5   0   0   1   5   1    83    0    0   1.767     58  0.16
   83  103 A  45   0   2   0   0   0   0   0   2   0   1  48   1   0   0   0   0   0   0   0    83    0    0   0.998     33  0.41
   84  104 A   1   1   0   0   0   0   1   0   0   0   1   0   0  94   0   0   1   0   0   0    83    0    0   0.325     10  0.79
   85  105 A   0   0   1   0   1   0   0   0   1   0   0   0   0  95   1   0   0   0   0   0    84    0    0   0.257      8  0.86
   86  106 A   1   2   0   4   4   1  14   0   0   0   0   1   4  64   2   0   1   1   0   0    84    0    0   1.361     45  0.32
   87  107 A   0   0   0   0   0   0   0   0   0  98   1   0   0   0   0   1   0   0   0   0    84    0    0   0.129      4  0.96
   88  108 A   8   0  63   0  27   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1    84    0    0   0.905     30  0.64
   89  109 A   1   5   1   1   0   0   0   0  26  62   0   1   0   0   0   0   2   0   0   0    84    0    0   1.093     36  0.47
   90  110 A   0   0   0   0   0   0   0   0   1   0   0   0   0   1   0   0   0   0   0  98    85    0    0   0.128      4  0.96
   91  111 A   0   0   0   0   0   0   0  96   0   0   0   0   0   0   0   0   4   0   0   0    85    0    0   0.153      5  0.88
   92  112 A   0   4   0   1   0   0   0  58   1   0   0   6   0   0   0   2   4   5   7  13    85    0    0   1.509     50  0.34
   93  113 A  12   0   1   0   0   0   0   0  22   3   1  60   0   0   0   0   0   0   0   0    86    0    0   1.109     37  0.41
   94  114 A   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0    86    0    1   0.000      0  1.00
   95  115 A   2   1   0   0   0   0   0   5   2   0   2   2   0   0   0   0   0  13   2  70    86    0    0   1.146     38  0.54
   96  116 A   3  14  71   2   3   0   0   0   0   1   0   1   0   0   2   1   0   0   0   0    86    0    0   1.083     36  0.56
   97  117 A   0   0   0   0   0   0   2   6  62   2   6   6   0   0   0   0   1   9   1   5    86    0    0   1.437     47  0.43
   98  118 A   0   0   1   0   0   0   0   1   1   0  50   5   3   0   7   1  21   1   8   0    86    0    0   1.583     52  0.23
   99  119 A   3   7   1   0   1   0   0   0   1   0   0   0  86   0   0   0   0   0   0   0    86    0    0   0.588     19  0.49
  100  120 A   2   6   1   3   0   3   1   1   0   0   9   0  69   0   1   0   0   2   0   0    86    0    0   1.261     42  0.24
  101  121 A   3   0   0   0   0   0   0   2   2   1   0   6   2   0   5  13   7  51   3   3    86    0    0   1.765     58  0.26
  102  122 A   5   5  85   3   1   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0    86    0    0   0.645     21  0.79
  103  123 A   0  45   2  51   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0    86    0    0   0.841     28  0.83
  104  124 A   0   0   0   0   0   0   1   0   2   0   0   0   0   0   2   2   3  76   2  10    86    0    0   0.967     32  0.62
  105  125 A   0   0   0   0   1   1   0   1   3   0   0   1   0   0   1   0   0  90   0   1    86    0    0   0.527     17  0.72
  106  126 A   0  86   8   6   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    86    0    0   0.499     16  0.86
  107  127 A   0   0   0   0   0   0   0   5  29   0   0  23   0   1  15   8  10   5   1   2    86    0    0   1.901     63  0.18
  108  128 A   7   1  41   0   0   0   2   2   7   0   3  21   0   0   1   3   0   5   2   3    86    0    0   1.925     64  0.20
  109  129 A   2   0   1   0   0   0   0   0   5   0  10   0  72   1   0   0   1   1   5   1    86    1    0   1.104     36  0.39
  110  130 A   0  93   6   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0    85    0    0   0.287      9  0.87
  111  131 A   0   2   0   1   0   0   0   2   0   0   4   1   0   0   2  48  12  22   4   1    85    0    0   1.596     53  0.29
  112  132 A   0   1   1   0   0   0   1   1   4   0   5   2   0   0   0   1   7   0  75   1    85    0    0   1.064     35  0.51
  113  133 A   1   0   1   0   0   0  21  14   0   0   0   0   0   1   0   4   6   0  46   6    85    0    0   1.571     52  0.24
  114  134 A   0   0   0   1   0   0   0   1   0   0   0   1   0   2  75  12   2   0   5   0    85    1    0   0.943     31  0.58
  115  135 A   0   0   0   0   0   0   0   1   0   0   0   0   0   0  17  79   0   1   2   0    84    0    0   0.683     22  0.71
  116  136 A  11   1   1   0   0   0   0   0   4   1   0  80   1   0   0   0   0   0   0   1    85    0    0   0.796     26  0.56
  117  137 A  13  78   6   2   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0    85    0    0   0.768     25  0.80
  118  138 A  11   0  84   4   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1    85    0    0   0.611     20  0.83
  119  139 A   0   0   0   0   0   0   0   0   0   1   0   0   0  93   0   0   5   0   0   1    85    0    0   0.316     10  0.90
  120  140 A   1   0   0   0   0   0   0   0   0   1   1   0  97   0   0   0   0   0   0   0    86    0    0   0.190      6  0.94
  121  141 A   5   0   0   0   8   0  85   0   0   0   0   0   0   0   1   0   0   0   1   0    86    0    0   0.590     19  0.73
  122  142 A   0   0   0   0   0   0   0  98   0   0   1   0   0   0   1   0   0   0   0   0    86    0    0   0.127      4  0.96
  123  143 A   0   0   1   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0    87    0    0   0.063      2  0.96
  124  144 A   1  93   5   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0    87    0    0   0.311     10  0.92
  125  145 A   0   0   0   0   0   0   0  98   0   1   0   0   1   0   0   0   0   0   0   0    87    0    0   0.125      4  0.96
  126  146 A   0   0   0   0   0   0   0   0   2   1   0   0   0   0  97   0   0   0   0   0    88    2    3   0.170      5  0.94
  127  147 A   0   0   0   0   0   0   0   2   1   0  91   5   0   0   0   1   0   0   0   0    86    0    0   0.422     14  0.78
  128  148 A   0   0   0   0   0   0   0  18   2   0   2   2  75   0   0   0   0   0   0   0    87    0    0   0.789     26  0.52
  129  149 A   7  92   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    89    5    5   0.308     10  0.90
  130  150 A  70   2  21   2   0   0   0   0   2   0   0   1   0   0   0   0   0   0   0   0    84    0    0   0.898     29  0.73
  131  151 A   2   0   2   0   0   0   0   0  93   0   2   0   0   0   0   0   0   0   0   0    89    0    0   0.321     10  0.84
  132  152 A   1   0   0   0   0   0   0   1  97   0   0   0   0   0   0   0   0   0   1   0    89    0    0   0.184      6  0.94
  133  153 A   0   0   0   0   1   0   1   0   2   0   0   0  96   0   0   0   0   0   0   0    89    0    0   0.230      7  0.90
  134  154 A   0  93   0   0   3   0   2   0   0   0   0   0   1   0   0   0   0   0   0   0    89    0    0   0.315     10  0.87
  135  155 A   0  93   3   2   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0    89    0    0   0.315     10  0.90
  136  156 A   2  92   1   2   0   0   0   0   0   0   0   0   0   0   1   1   0   0   0   0    89    0    0   0.397     13  0.83
  137  157 A   0   1   0   1   0   1  56   0   1   0   2   0   0   1   4   1  25   1   4   0    89    1    0   1.387     46  0.03
  138  158 A   1  93   2   2   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0    88    0    0   0.340     11  0.89
  139  159 A   0   0   0   0   1   0   0   2   0   0  83   0   1   0   0   0   0   1   0  11    88    2    1   0.641     21  0.60
  140  160 A   8   1   0   0   0   0   0   2   2   1   1   0   0   0   1   0   0   6   0  77    87    0    0   0.947     31  0.53
  141  161 A   1   0   0   0   0   0   1   2   8   0  17  61   0   0   0   6   1   1   1   0    88    0    0   1.306     43  0.36
  142  162 A  34  13  28  20   1   0   0   1   1   0   0   0   0   0   0   0   0   0   0   1    89    0    0   1.518     50  0.53
  143  163 A   0   1   0   0   3   0   0   0   4   1  60  22   0   0   0   1   0   2   1   3    89    0    0   1.299     43  0.32
  144  164 A   1   0   1   0   0   1   0   0   4  89   1   0   0   0   0   0   0   2   0   0    89    0    0   0.532     17  0.71
  145  165 A   0   0   1   0   0   0   0   0   0   0   4   0   0   1   0   2  36  45   6   4    89    0    0   1.354     45  0.50
  146  166 A   0   0   0   0   0   0   2   0   1   0   0   2   0   2   1  10  70   3   0   7    88    0    0   1.138     37  0.47
  147  167 A  10   0   2   0   0   0   1   0  86   0   0   0   0   0   0   0   0   0   0   0    88    0    0   0.497     16  0.70
  148  168 A   7   5  85   2   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0    88    0    0   0.597     19  0.85
  149  169 A   0   0   0   0   0   0   0   0   3   0   2   0   0   0   7   2   2  17   0  66    88    0    0   1.133     37  0.49
  150  170 A   0   9  11   0   0   0   0   1   2   0  59   3   1   0   2   9   0   1   0   0    88    0    0   1.434     47  0.17
  151  171 A  13  83   0   2   1   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0    88    0    0   0.603     20  0.77
  152  172 A   0   0   0   0   0   0   0   0   0   0   0   0   2   0  89   3   6   0   0   0    88    0    0   0.471     15  0.77
  153  173 A   0   0   0   0   0   0   0   2   0   0   2   0   0   0   0   1   3  25   6  60    88    0    0   1.153     38  0.63
  154  174 A   9  80   1   0   0   0   0   0   0   1   2   1   0   6   0   0   0   0   0   0    88    0    0   0.802     26  0.59
  155  175 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0  97   1   1   0   1   0    88    2    1   0.186      6  0.93
  156  176 A   0   0   0   0   0   0   0  97   0   0   3   0   0   0   0   0   0   0   0   0    86    0    0   0.151      5  0.93
  157  177 A   0   0   0   0   0   0   0   6  10   2  69   5   0   2   3   0   0   2   0   0    87    0    0   1.173     39  0.42
  158  178 A   0   0   0   0   0   0   0  84   2   0   2   0   0   0  11   0   0   0   0   0    87    0    0   0.569     19  0.55
  159  179 A   1   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0    88    0    0   0.062      2  0.98
  160  180 A   3   0  95   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0    88    0    0   0.210      7  0.94
  161  181 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1  94   5   0   0    88    0    0   0.247      8  0.89
  162  182 A   0   0   1   0   0   0   0   0   0   0   6  92   0   0   0   0   0   0   1   0    88    0    0   0.341     11  0.78
  163  183 A  31   1  61   0   1   0   0   0   1   0   0   1   0   0   3   0   0   0   0   0    88    0    0   0.981     32  0.63
  164  184 A   0   0   1   0   0   0   0   0   0   0   0   0   0   0   3  91   1   3   0   0    88    0    0   0.419     13  0.79
  165  185 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  99   0   0   1    85    0    0   0.064      2  0.99
  166  186 A   0   0   0   0   4   0  92   0   0   0   0   0   0   0   0   0   0   5   0   0    84    0    0   0.344     11  0.75
  167  187 A   0   0   0   0   0   0   0   0   0   0   2   0   0   0   0   1   1   1  94   0    84    0    0   0.305     10  0.85
  168  188 A   0   0   0   0  35   0  65   0   0   0   0   0   0   0   0   0   0   0   0   0    84    0    0   0.644     21  0.96
  169  189 A   2  85  13   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    84    0    0   0.497     16  0.80
  170  190 A   0   0   0   0   0   0   1   0   1   0   1   0   0  89   2   0   1   0   4   0    84    0    0   0.520     17  0.72
  171  191 A   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   1  63   0  35    84    0    0   0.763     25  0.79
  172  192 A   0   1   0   0  98   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0    84    0    0   0.129      4  0.99
  173  193 A   0   0   0   0   0   0   0   0   1   0   0   0   0   0  96   0   0   1   1   0    83    0    0   0.195      6  0.85
  174  194 A   0   0   1   0   0   0   0   0   0   0   2   0   0   0   0   4   1  31   2  58    83    0    0   1.086     36  0.59
  175  195 A   0   4   2   2   0   0   0   0   1   0   0   1   0   0   5  72   1   0  11   0    81    0    0   1.099     36  0.45
  176  196 A   4  72   0   5   4   0   6   0   0   0   4   0   0   0   5   0   0   0   0   0    79    0    0   1.085     36  0.47
  177  197 A   0   0   0   0   0   0   0   0  79   0   3   3   0   0   0   1   0   8   0   6    78    0    0   0.800     26  0.59
  178  198 A   4   0   0   1   0   0   0   0  79   0   0   4   0   0   0   0   0   5   4   3    78    0    0   0.861     28  0.56
  179  199 A   0   0   0   0   5   0  32   0   0   0   0   0   0  60   1   0   1   0   0   0    78    0    0   0.934     31  0.48
  180  200 A   3  82   0   1   0   0   0   0   0   0   0   0   0   0   0   1   9   3   0   0    74    0    0   0.694     23  0.53
  181  201 A   1   0   0   0   0   0   0   3  16   0  64   1   0   0   0   3   0  11   0   0    73    0    0   1.137     37  0.36
  182  202 A   0   0   0   0   0   0   0   0   7   0  67  24   0   0   1   0   0   0   0   1    72    0    0   0.915     30  0.43
  183  203 A   0   0   0   0   0   0   0   0   0   0   0   0   0   0  73  24   3   0   0   0    67    0    0   0.676     22  0.71
  184          0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0     0    0    0   0.000      0  1.00
  185    1 B   2  12   2  84   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   130    0    0   0.571     19  0.91
  186    2 B   1   1   0   0   0   0   0   1   3   0   1   1   0   0   0   1  13  51   3  25   150    0    0   1.417     47  0.62
  187    3 B   3   2   0   0   0   0   0   1   4   0   4   0   0   0  13  17  16   1  29  11   157    0    0   1.948     65  0.31
  188    4 B   0   0   0   0  25   0  75   0   0   0   0   0   0   0   0   0   0   0   0   0   158    0    0   0.566     18  0.97
  189    5 B   2   2   1   1   0   0   0   0   0   0   3   3   0   3   1   9  33  39   1   3   158    0    0   1.663     55  0.45
  190    6 B   1   0   4   0   0   0   0   1   0   1   0   1   4   0  13  71   3   0   0   0   158    0    0   1.072     35  0.52
  191    7 B  26  42  23   4   0   0   0   0   1   0   0   1   0   0   0   0   2   1   0   0   158    0    0   1.373     45  0.64
  192    8 B   0   0   1   0   0   0   0   6   5   0   0   0   1   0   0   0   0  86   0   2   158    0    0   0.583     19  0.78
  193    9 B   2   0   0   0   3   0   0   0   0   0   0   1   0   0   3  87   1   4   0   0   158    0    0   0.603     20  0.70
  194   10 B  20   6  72   0   0   0   0   1   1   0   0   0   0   0   0   0   0   0   0   0   158    0    0   0.809     27  0.82
  195   11 B   0   0   0   0   0   0   0  97   0   0   3   0   0   0   0   0   0   0   0   0   159    0    0   0.140      4  0.95
  196   12 B   0   0   0   0   0   0   0   0   0   0   4   0   0   0   0   0   2  92   1   0   159    0    0   0.340     11  0.86
  197   13 B   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.000      0  1.00
  198   14 B   0   0   0   1   0   0   0   0   6   0   1  93   0   0   0   0   0   0   0   0   162    0    0   0.289      9  0.88
  199   15 B   0   0   0   0   0   0  99   0   0   0   0   0   1   0   0   0   0   0   0   0   162    0    0   0.038      1  1.00
  200   16 B   0   0   0   0   0   0   0  96   4   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.178      5  0.95
  201   17 B  63   1   3   1   0   0   0   0   1   0   1  13   0   0   3  14   1   0   0   1   162    0    0   1.253     41  0.39
  202   18 B  99   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.038      1  1.00
  203   19 B   0   0   0   0  17   0  83   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.460     15  0.98
  204   20 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   7  93   0   0   0   0   162    0    0   0.248      8  0.93
  205   21 B   0   0   0   0   0   0   0  22  76   0   1   0   1   0   0   0   0   0   0   0   162    0    0   0.629     20  0.78
  206   22 B   2   7   1   1   1   1   0   0   0   0   0   0   0   0  53  27   6   2   0   0   162    0    0   1.363     45  0.48
  207   23 B   1   1   0   0   0   0   1   3   0   0   2   0   0   7   1   0   1   9  28  49   162    0    0   1.439     48  0.56
  208   24 B   2  23   3   1   0   0   0   2   1   1   1   3   0   1  27  32   1   0   3   1   161    0    0   1.771     59  0.23
  209   25 B  11   8   3   0   0   0   1   1  14   1   8  11   0   4   6  10   4   9   5   4   162    0    0   2.549     85  0.13
  210   26 B   1   0   0   0   0   0   0   6   0   1   6  62   0  10   0   0   1   1  12   2   162    0    0   1.307     43  0.47
  211   27 B   0   1   0   2   0   0   0  57   1   5   1   0   0   6   2   2   4   2  16   2   162    0    0   1.568     52  0.45
  212   28 B   0   1   1   1   0   0   0   2   2   1   1   3   0   0  19   5  23  36   4   2   159    0    0   1.814     60  0.37
  213   29 B  18  11  44   4   6   0   1   0   1   1   0  14   0   0   0   0   0   1   0   1   142    0    0   1.657     55  0.50
  214   30 B  75   1  12   1   7   0   2   0   0   0   1   0   1   0   0   0   0   0   0   0   161    0    0   0.891     29  0.73
  215   31 B   4   0   0   1   0   0   0   0  96   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.196      6  0.92
  216   32 B   1  81   5   9   0   0   0   0   4   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.717     23  0.82
  217   33 B   0   4   0   0   0   0   0   0   1   0   0   0   0   0   0  96   0   0   0   0   162    0    0   0.196      6  0.89
  218   34 B   0   1   0   0   0   0   0   0   0   0   0   0   0   0  17  81   1   1   0   0   162    0    0   0.587     19  0.80
  219   35 B  15   1  67   1   4   0   0   0   0   0   0   9   0   0   0   1   0   4   0   0   162    0    0   1.099     36  0.63
  220   36 B   1   0   2   0   0   0   0   0   0   1   0   1   0   1  88   7   0   0   0   0   162    0    0   0.538     17  0.80
  221   37 B   7  82   1   2   0   0   0   0   0   3   1   0   0   2   0   1   1   0   1   1   162    0    0   0.811     27  0.68
  222   38 B   0   4   0   0   0   0   1   0   0   1   0   0   0   3   1   0   4  60   0  26   162    0    0   1.136     37  0.64
  223   39 B   0   3   1   5   0   0   0   2  16   0  19  14   0   1   1   4  13   8   2  11   161    0    0   2.269     75  0.21
  224   40 B   0   1   0   0   1   0   0   3   0   0   6   1   0   0   0   0   0  68   0  21   161    0    0   0.952     31  0.69
  225   41 B   0   0   0   0   0   0   0   4   1   1   2   9   0   0   1   1   1  22   0  60   161    0    0   1.233     41  0.63
  226   42 B   1   0   0   0   0   0   0   0   0   0   2   1   0   0   0   0   0  94   0   3   160    0    0   0.314     10  0.89
  227   43 B   1   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   0   0   160    0    0   0.038      1  0.98
  228   44 B  77   2  13   4   1   0   0   0   0   0   0   4   0   0   0   0   0   0   0   0   160    0    0   0.828     27  0.78
  229   45 B   0   0   0   0   0   0   0   0   0  96   4   0   0   0   0   0   0   0   0   0   160    0    0   0.160      5  0.92
  230   46 B   0   4   1   0   0   0   0   1   2   7  81   0   1   0   0   0   4   0   0   0   160    0    0   0.783     26  0.62
  231   47 B   0   0   0   0   0   0   0   0   1   0  16  83   0   0   0   0   0   0   0   0   160    0    0   0.481     16  0.73
  232   48 B   0   0   0   0   0   0   0   0  87   0   2  11   0   0   0   0   0   0   0   0   160    0    0   0.443     14  0.80
  233   49 B   5  21  73   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.737     24  0.80
  234   50 B   0   0   0   0   0   0   0   0   0   1   0   0   0   0  99   0   0   0   0   0   161    0    0   0.038      1  0.99
  235   51 B   0   0   0   0   0   0   0   1   1   0   0   0   0   0   0   0   0  99   0   0   161    0    0   0.075      2  0.98
  236   52 B  10   0  86   3   0   0   0   0   1   0   1   0   0   0   0   0   0   0   0   0   161    0    0   0.533     17  0.87
  237   53 B   0   0   0   0   0   0   0   1   9   0  78   1   9   0   0   1   0   0   0   1   161    0    0   0.797     26  0.69
  238   54 B   8  85   6   0   1   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.565     18  0.85
  239   55 B   0  93   0   4   0   0   0   0   0   0   0   0   3   0   0   0   0   0   0   0   161    0    0   0.316     10  0.85
  240   56 B   0   1   0   1   0   0   0   0   0   0   0   3   0   1  18  73   4   0   0   0   161    0    0   0.889     29  0.68
  241   57 B   0   3   0   6   0   0   0   0   0   0   0   0   0   4   0   0   1  83   1   2   161    0    0   0.707     23  0.68
  242   58 B   2  75   0  22   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.655     21  0.93
  243   59 B   1   0   0   0   0   0   0   1   4   1  12   2   0   8  11  25  16   5  14   1   161    0    0   2.128     71  0.29
  244   60 B   0   0   0   0   0   0   0   0   0   0   6   0   0  73   0   0   0   0   1  21   160    0    0   0.775     25  0.64
  245   61 B   1   4   0   0   0   0   0   3   1  53   4   0   1   0   6  10   0   8   1   8   160    0    0   1.686     56  0.36
  246   62 B   0   0   0   0   1   0   3   1   1   0   1   0   0   6   0   0   0   0  88   0   160    0    0   0.548     18  0.79
  247   63 B  30   0  70   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   160    0    0   0.611     20  0.88
  248   64 B  97   3   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   160    0    0   0.155      5  0.97
  249   65 B   1   1   0   0   0   0   0   0   2   1  10   1   4   2  55  17   3   1   2   0   161    0    0   1.545     51  0.45
  250   66 B   0  96   0   0   1   0   0   0   0   0   0   2   0   1   0   0   0   0   0   0   162    0    0   0.191      6  0.91
  251   67 B   1  34   4   2  11   0  12   0   1   1   0   0   1   7   4   3  10   7   0   0   162    0    0   2.128     71  0.22
  252   68 B   0   0   0   0   0   0   0   0   2   0   1   0   1   0   0   1   0   7  17  72   162    0    0   0.934     31  0.72
  253   69 B  69   1  28   0   0   0   1   0   0   0   0   0   1   0   0   0   0   0   0   0   162    0    0   0.730     24  0.85
  254   70 B  41  21  22   1   1   0   0   0   0   0   1   0   5   1   0   4   0   5   0   0   162    0    0   1.592     53  0.46
  255   71 B   2   5   1  12   0   1   2   0   0   1   0   6   2  63   1   0   6   0   0   0   162    0    0   1.394     46  0.36
  256   72 B   6   2   0   0   0   0   0   4  19   0  27  14   1   0   2   1   7  11   3   3   162    0    0   2.132     71  0.25
  257   73 B   0   1   1   0   0   0   0   2   0   1   5   3   0   0   0   2   3  42   1  40   162    0    0   1.408     47  0.60
  258   74 B   0   0   0   0   0   0   1  13   6   0  13   1   0   2  10  30   1   3  19   1   162    0    0   1.946     64  0.29
  259   75 B   5   0   1   1   1   0   0   0   1   0   2   0   9   0  22  56   1   0   2   1   161    0    0   1.402     46  0.40
  260   76 B   1  86  11   0   1   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.489     16  0.87
  261   77 B   1   0   1   2   3   1  70   0   1   0   1  19   0   1   0   0   1   0   1   0   161    0    0   1.042     34  0.46
  262   78 B   0  95   2   2   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   162    0    0   0.245      8  0.94
  263   79 B  87   0  12   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   162    0    0   0.410     13  0.93
  264   80 B   0   1   0   4  95   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.224      7  0.95
  265   81 B   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0  98   0   1   162    0    0   0.104      3  0.98
  266   82 B   0   1   0   0  49   1  39   0   0   0   0   0   1   9   0   0   0   0   0   0   162    0    0   1.053     35  0.77
  267   83 B   7  70   0  10   0   0   0   1   2   0   0   1   9   0   0   0   0   0   0   0   162    0    0   1.035     34  0.57
  268   84 B   0   0   0   0   0   0   1   0   0   0  15   2   0   6   1   1   0   6   3  65   162    0    0   1.191     39  0.58
  269   85 B   2  31   1  15   0   0   0   1   1   0   1   9   1   4   1   3  28   1   1   1   162    0    0   1.867     62  0.23
  270   86 B   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0  99   162    0    0   0.038      1  0.97
  271   87 B   1  98   0   1   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   162    0    0   0.141      4  0.97
  272   88 B   0   3   0   1   0   1   0   0   1   0   0   4   0   1   1  89   0   0   0   0   162    0    0   0.528     17  0.74
  273   89 B   1   0   1   0   0   0   0   1   1   0   0   6   0   0   8  78   3   1   1   1   162    0    0   0.931     31  0.65
  274   90 B   2   6   4   0  18   1  56   0   1   0   1   0   0  11   0   0   1   0   0   0   162    0    0   1.392     46  0.60
  275   91 B   3  17  11  60   8   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   162    0    0   1.196     39  0.72
  276   92 B   1   0   0   0   0   0   0   1   1   0   0   0   0   3   4   1   0  22   1  67   162    0    0   1.047     34  0.68
  277   93 B   6   2   1   0   0   0   0   2  16   0  49   6   0   3   2   9   2   1   0   1   162    0    0   1.746     58  0.32
  278   94 B   9  22  12   0   4   1   4   1   5   0  16   2  11   6   2   1   1   1   3   0   162    0    0   2.377     79  0.12
  279   95 B   0   1   0   0   0   0   0   5   7  48   1   4   0   1  10   4   1   4  12   3   162    0    0   1.833     61  0.33
  280   96 B  17   5   0   0   1   0   0  13   4   5   5   4   0   1   3  10   9  10   5   8   162    0    0   2.501     83  0.17
  281   97 B   2   4   1   1   9   0   0  20   4   9  13  10   0   0   1   2   1   7   4   9   162    0    0   2.418     80  0.16
  282   98 B   2   4   0   1   5   0   5  38  11  11   8   0   1   2   2   2   1   2   3   0   122    0    0   2.159     72  0.21
  283   99 B   6  47  17  16   2   0   1   0   0   0   0   0   1   0   1  10   0   0   1   0   157    0    0   1.546     51  0.55
  284  100 B   0   0   0   0   0   0   0  17   1  27   3   2   1   1   1   1   1   7   7  31   162    0    0   1.799     60  0.37
  285  101 B   1  16   1   2   0   0   1   1   9  21   6   9   0   3   2   6   4   8   1   9   162    0    0   2.438     81  0.14
  286  102 B   1   1   1   9   0   0   1   1  14  10   5   3   0   7   9   9   5  11   6   7   162    0    0   2.569     85  0.17
  287  103 B  16  33  13  13   0   0   0   0   1   0   0  17   0   1   0   0   4   1   0   1   162    0    0   1.777     59  0.39
  288  104 B  57   2  32   0   0   0   0   0   2   0   0   2   2   0   1   0   1   0   0   0   162    0    0   1.105     36  0.71
  289  105 B   0   0   0   0   0   0   0   0   1   0   1   0   0   0   9  84   5   0   0   0   162    0    0   0.616     20  0.81
  290  106 B   1   0   2   2   0   1   1   1   1   0  55   2   1   1   4  22   0   1   1   7   162    0    0   1.532     51  0.39
  291  107 B   0   7   4   4  51   1  33   0   0   0   0   1   0   0   0   0   0   0   0   0   162    0    0   1.211     40  0.76
  292  108 B   2  47   2  41   1   0   0   0   0   0   1   4   0   0   1   0   1   0   0   0   162    0    0   1.170     39  0.75
  293  109 B   0   9   1   4  17   5  46   0   6   0   4   0   0   2   4   1   0   0   1   0   162    0    0   1.775     59  0.45
  294  110 B   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0  97   0   0   2   162    0    0   0.153      5  0.96
  295  111 B   1  67  25   6   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   162    0    0   0.849     28  0.79
  296  112 B   8  62   4   1   1   0   0   0   0   0   0   4  19   0   0   0   0   0   1   0   162    0    0   1.216     40  0.40
  297  113 B   0   1   1   0   0   0   1   0   2   0   3   0   3   1  23  22  22  14   4   4   162    0    0   1.986     66  0.31
  298  114 B   1   0   0   0   0   0   0  88  11   0   1   0   0   0   0   0   0   0   0   0   162    0    0   0.422     14  0.87
  299  115 B  16  36  44   2   0   0   0   0   0   0   0   1   1   0   0   0   0   0   0   0   162    0    0   1.183     39  0.69
  300  116 B   4  11   0   0   0   1   4   3  46   0   2   1   2   0  11   2   1   1   4   6   162    0    0   1.932     64  0.21
  301  117 B   0   0   0   0  46   0  44   0   1   0   1   1   0   7   0   0   0   0   0   0   162    0    0   1.028     34  0.77
  302  118 B   0   8   1   1   0   0   0   0   0   0   1   0  89   0   0   0   0   0   0   0   162    0    0   0.447     14  0.64
  303  119 B   0   0   0   0   0   0   1   0   0   0   0   0   0  99   0   0   0   0   0   0   162    0    0   0.038      1  0.99
  304  120 B   0   0   0   0   0   0   0   7   7   0  51   4   3   1   7   2  10   4   1   2   162    0    0   1.756     58  0.37
  305  121 B   1   0   0   0   0   1   0   0   0   0   1   0   0  59  27   1   1   0  10   0   162    0    0   1.104     36  0.55
  306  122 B   0   0   0   1   0   4   0   9   0   0   1   0   0   1  74   1   0   0   9   0   162    0    0   0.947     31  0.58
  307  123 B  70   0  28   0   1   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   162    0    0   0.689     22  0.86
  308  124 B   4  83   6   6   0   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   162    0    0   0.652     21  0.86
  309  125 B   0   1   0   0   0   0   0   0   0   0   0   0   0  99   1   0   0   0   0   0   162    0    0   0.075      2  0.98
  310  126 B   0   0   0   0   0   0   0   0   0   0   1   0   0   0  99   0   1   0   0   0   162    0    0   0.075      2  0.98
  311  127 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   162    0    0   0.000      0  1.00
  312  128 B   0  98   1   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.104      3  0.99
  313  129 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   162    0    0   0.000      0  1.00
  314  130 B   0   0   0   0   0   0   0   0   0  99   0   0   1   0   0   0   0   0   0   0   162    0    0   0.038      1  0.98
  315  131 B   0   0   0   0   0   0   0   1   4   1   1   0   0   4   0   0  89   0   0   0   162    0    0   0.502     16  0.79
  316  132 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   162    0    0   0.000      0  1.00
  317  133 B   1  88  12   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.398     13  0.87
  318  134 B   0  98   0   2   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.116      3  0.99
  319  135 B  19   2  75   4   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.744     24  0.84
  320  136 B   1   0   0   0   0   0   0   0   1   0   5   8   0   1   0   0   0   0  31  54   162    0    0   1.165     38  0.53
  321  137 B   0   0   1   0   0   0   0   1   6   2  10   4   0   0  37  22   1   5   6   4   162    0    0   1.932     64  0.31
  322  138 B   1   1   1   0   1   0   1   1   3   0   8   2   0   0  10  18   4  21  14  15   158    0    0   2.179     72  0.30
  323  139 B   0   0   0   1   0   0   0  73   0   0   1  13   1   1   1   4   1   1   3   1   161    0    0   1.036     34  0.62
  324  140 B   6   2   4   6   1   0   1   2  10   1   4   4   1   1   0   2  10  10  34   2   162    0    0   2.265     75  0.20
  325  141 B   4  61  32   1   0   0   0   0   0   0   0   2   0   0   0   0   0   0   0   0   161    0    0   0.905     30  0.73
  326  142 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1  98   1   0   0   0   162    0    0   0.104      3  0.97
  327  143 B   7  74  19   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.721     24  0.80
  328  144 B   0   0   0   0   0   0   0  12  88   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.374     12  0.87
  329  145 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0  99   162    0    0   0.038      1  1.00
  330  146 B   0  12   0   0  88   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.361     12  0.95
  331  147 B   0   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.000      0  1.00
  332  148 B   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   162    0    0   0.038      1  0.98
  333  149 B   0   0   0   0   0   0   0  10  86   0   4   0   0   0   0   0   0   0   0   0   162    0    0   0.477     15  0.85
  334  150 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   162    0    0   0.000      0  1.00
  335  151 B   1   4   6   1   0   0   0   0  83   1   4   1   0   1   0   0   0   0   0   0   162    0    0   0.727     24  0.66
  336  152 B   1   1   2   0  91   0   5   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.391     13  0.94
  337  153 B   0   0   0   0   1   0   2  73   1   0   8   8   1   0   0   1   1   1   2   0   162    0    0   1.071     35  0.57
  338  154 B  40   9  44   1   3   0   0   0   0   1   0   0   0   0   0   1   0   0   0   1   160    0    0   1.207     40  0.70
  339  155 B   0   0   0   0   1   0   0   0   0  90   1   0   0   0   0   1   6   1   1   0   162    0    0   0.485     16  0.76
  340  156 B  49  28   6  10   0   0   0   0   2   0   4   0   0   0   0   0   1   0   0   0   162    0    0   1.355     45  0.58
  341  157 B   0   4   0   1   0   0   0   1   1   0   0   0   0   1  73  15   1   1   4   0   158    0    0   0.971     32  0.59
  342  158 B  10   0   2   0   2   0   1   1  15   2  11  39   9   1   1   5   1   0   1   0   161    0    0   1.967     65  0.26
  343  159 B   0   6   0   1  15   0  76   0   0   0   2   0   0   0   0   0   0   0   0   1   162    0    0   0.807     26  0.77
  344  160 B   1   0   0   0   0   0   0   3   0   0  12  83   0   0   0   0   0   0   0   0   162    0    0   0.549     18  0.74
  345  161 B   0   0   0   0   0   0   0   0   8   0   6   0   0  79   1   3   0   0   3   0   162    0    0   0.807     26  0.57
  346  162 B   8   0   0   0   0   0   0   0   0   0   0   0   1   0   0   1   0  90   0   1   162    0    0   0.390     13  0.73
  347  163 B  82   0  18   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.470     15  0.92
  348  164 B  91   4   3   1   0   0   0   1   0   0   0   1   0   0   0   0   0   0   0   0   162    0    0   0.435     14  0.90
  349  165 B   0   1   0   0   0   0   0   0   0   0   0  99   0   0   0   1   0   0   0   0   161    0    0   0.075      2  0.98
  350  166 B   0  96   4   0   0   0   0   0   0   0   0   0   0   0   1   0   0   0   0   0   161    0    0   0.197      6  0.93
  351  167 B   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.000      0  1.00
  352  168 B   0   0   0   0   1   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.038      1  1.00
  353  169 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   0   0   0   0   0   161    0    0   0.000      0  1.00
  354  170 B   0   0   0   0   0   0   0   0  80  10  10   0   0   0   0   0   0   0   0   0   161    0    0   0.636     21  0.76
  355  171 B   0   1   0   0   0   0   0   0   0  99   0   0   0   0   0   0   0   0   0   0   161    0    0   0.038      1  0.98
  356  172 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0  82   0  18   161    0    0   0.472     15  0.89
  357  173 B  50   6  44   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.868     28  0.81
  358  174 B   0  99   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.067      2  0.98
  359  175 B   0  84   1   6   8   0   1   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.581     19  0.93
  360  176 B   0   0   0   0   0   0   0  94   0   0   1   0   0   0   0   0   4   0   1   0   161    0    0   0.254      8  0.89
  361  177 B   1   0   1   0   0   0   0  20  27   0  39   2   7   0   0   0   2   1   0   1   161    0    0   1.543     51  0.47
  362  178 B   1   1   0   0   0   0   0   0   4   6   7   9   1   2  35  30   2   1   1   0   161    0    0   1.790     59  0.37
  363  179 B   2   8   0   1   5   0   6   0   0   0   1   6   0  25  15   5  25   1   0   1   154    0    0   2.029     67  0.21
  364  180 B   0   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.000      0  1.00
  365  181 B   0   0   0   0   0   0   0   2   7   0  77  11   0   0   0   0   0   0   2   0   161    0    0   0.816     27  0.65
  366  182 B   1   1   1   2   1   0   0   0   0   7   1  82   5   0   0   1   0   0   0   0   161    0    0   0.769     25  0.67
  367  183 B   0   0   0   0   0   0   0  24  20  39  15   1   0   0   0   0   0   2   0   0   161    0    0   1.419     47  0.46
  368  184 B  80   1  18   1   0   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.609     20  0.87
  369  185 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0 100   161    0    0   0.000      0  1.00
  370  186 B  17   9  39  34   0   0   0   0   0   0   1   1   0   0   0   0   0   0   0   0   161    0    0   1.341     44  0.64
  371  187 B   0   0   0   0   0 100   0   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.000      0  1.00
  372  188 B   0   0   0   0   0   0   0   0   5   0  95   0   0   0   0   0   0   0   0   0   161    0    0   0.198      6  0.91
  373  189 B  45   9  28   0   0   0   0   0  12   0   0   1   4   0   0   0   0   0   0   0   161    0    0   1.363     45  0.57
  374  190 B   0   0   0   0   0   0   0  97   3   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.138      4  0.97
  375  191 B   1   0   0   0   0   0   0   1   7   0   0   8  84   0   0   0   0   0   0   0   161    0    0   0.597     19  0.77
  376  192 B   1   0  99   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.038      1  1.00
  377  193 B   2   4   0   4  89   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.465     15  0.88
  378  194 B   1   0   0   0   1   0   1   2  94   0   1   0   0   0   0   0   0   0   0   0   161    0    0   0.301     10  0.91
  379  195 B   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0  99   0   0   161    0    0   0.038      1  0.99
  380  196 B   0  24   2  73   0   0   0   0   0   0   0   1   0   0   0   0   0   0   0   0   161    0    0   0.677     22  0.91
  381  197 B  29   4   9   1   6   0   2   0  27   1   2   0  17   1   0   0   0   0   0   0   161    0    0   1.814     60  0.28
  382  198 B   1   2   1   3   0   0   0   0   8   0   6  46   0   0  11   1   2   0  19   2   160    0    0   1.733     57  0.29
  383  199 B   0   2   0   0   0   0   0  21   0   0   0   1   0   1  42  19  11   1   2   0   161    0    0   1.549     51  0.32
  384  200 B   2   1   0   0   0   3   1   1   2   0   1   3   0   1  30  47   9   0   1   0   161    0    0   1.504     50  0.48
  385  201 B   1   0   0   0   0   0   0   0  19  77   2   1   0   0   0   0   0   1   0   0   161    0    0   0.706     23  0.73
  386  202 B   1  93   5   1   0   0   0   1   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.338     11  0.90
  387  203 B   1   3   0   0  96   0   0   0   0   0   1   0   0   0   0   0   0   0   0   0   161    0    0   0.213      7  0.95
  388  204 B   0   0   0   0   0   0   0   0   5  65   5   2   2   7   6   1   7   0   1   0   161    0    0   1.334     44  0.51
  389  205 B   0   0   0   0   0   0   0  96   2   0   2   0   0   0   0   0   0   0   0   0   161    0    0   0.209      6  0.93
  390  206 B   2   0   0   3   0   0   0   0   1   1   9   4   0   0   0   1   1   1   5  72   161    0    0   1.123     37  0.53
  391  207 B   0   0   0   0   1   0   0   1   1   3  78   2   1   0   0   0   1   0   3   9   161    0    0   0.915     30  0.63
  392  208 B   8   0   1   0   0   1   0   0   1   0   0   0   0   0   0   0   1  80   3   7   161    0    0   0.803     26  0.67
  393  209 B   6   9  64   1   1   0   1   0   2   0   0   1   0   2   1   1   1   5   0   7   161    0    0   1.417     47  0.45
  394  210 B   0   0   0   0   0   0   0   1   1   1   1   0   0   1   0   0   9   1   0  86   161    0    0   0.603     20  0.81
  395  211 B   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   1  75  25   0   0   161    0    0   0.597     19  0.80
  396  212 B   0  76  23   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.575     19  0.83
  397  213 B   0  11   1   2  58   0   4   4   1   1   2   0   0   1   1   8   2   1   1   2   161    0    0   1.611     53  0.31
  398  214 B   0   1   1   0   0   0   0   0   1   0   3   1   0   9  40  43   1   1   0   0   161    0    0   1.261     42  0.53
  399  215 B   2   2  92   3   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.383     12  0.91
  400  216 B   1   4   1   0  92   0   0   0   1   0   2   0   0   0   0   0   0   0   0   0   162    0    0   0.381     12  0.88
  401  217 B   0   1   0   0   1   0   1   1   1   1   3   0   0   0  70  15   2   1   0   4   162    0    0   1.113     37  0.57
  402  218 B  20  29  20   2   1   0   1   2   4   0   1  21   0   0   0   0   0   0   0   0   162    0    0   1.713     57  0.41
  403  219 B   2  75   5  11   1   0   0   1   0   1   0   1   1   0   2   0   0   1   2   0   162    0    0   1.021     34  0.71
  404  220 B   0   0   0   0   0   0   0  90   1   0   2   1   0   0   1   4   0   0   1   0   162    0    0   0.478     15  0.83
  405  221 B   0   5   0   1   0   0   0   0   1   0   3  91   0   0   0   0   0   0   0   0   162    0    0   0.407     13  0.79
  406  222 B   0   1   0   0   0   0   0   0   1  96   1   0   0   0   2   0   0   0   0   0   162    0    0   0.228      7  0.90
  407  223 B   0   0   0   0   0   0   1   5   1   0   8  33   1   0   0   1   1   1  29  19   157    0    0   1.653     55  0.38
  408  224 B   1   1   1   0   0   0   0   0   1   2   1   0   0   0   0   1   0  82   6   5   157    0    0   0.793     26  0.76
  409  225 B   4   0   0   0   1   0   0   2   7   1   9   4   0   1   4   3   8  32   4  20   158    0    0   2.114     70  0.36
  410  226 B  24   1  13   3   0   0   0   0   3   1   8  28   0   0   0   1   6   3   3   7   159    0    0   2.073     69  0.24
  411  227 B   0   0   0   0   1  96   1   0   0   0   0   0   0   1   1   0   0   0   0   0   161    0    0   0.238      7  0.96
  412  228 B   1   0   0   0   0   0   0   0   1  93   0   0   0   1   2   1   1   1   0   0   161    0    0   0.404     13  0.87
  413  229 B   0   0   0   0   0   0   0  67   4   1   2   2   0   1   5   0   2   4   4   8   162    0    0   1.317     43  0.56
  414  230 B  70   3  10   6   1   0   0   0   1   1   1   0   1   0   0   0   0   0   1   4   162    0    0   1.156     38  0.63
  415  231 B  10   0   1   0   1   0   0   2   4   0  22  47   0   1   2   1   2   6   2   0   162    0    0   1.693     56  0.34
  416  232 B   0   1   1   0   0   0   5   3   4   3  37   6   1   3   3  13  13   3   2   4   159    0    0   2.162     72  0.22
  417  233 B   1  71   0   6  11   0   6   0   0   0   0   0   0   0   3   1   1   1   0   0   159    0    0   1.066     35  0.71
  418  234 B   1   0   0   1   0   0   0   0   1  78   3   0   0   0   6   3   5   2   1   1   159    0    0   0.961     32  0.63
  419  235 B   0   1   0   0   0   1   0   2   5   0   1   0   0   1   2   2   1   4   4  78   162    0    0   1.007     33  0.66
  420  236 B   0   1   0   1  31  14  54   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   1.053     35  0.89
  421  237 B   2   1   1   0   0   0   2   1   2   2   1   0   0  12   4  66   1   0   5   1   162    0    0   1.361     45  0.43
  422  238 B   2   0   1   1   0   0   0   2   9  33  20   6   0   2   4   1   2   9   7   2   162    0    0   2.092     69  0.28
  423  239 B   1   2   1   1   7   0   8   2   7   1  28  23   1   0   1   4   2   1   7   2   162    0    0   2.254     75  0.14
  424  240 B   0   1   0   1  97   0   0   0   1   0   0   0   0   0   1   0   0   0   0   0   121    0    0   0.191      6  0.93
  425  241 B   0   0   0   1   0   0   0   0   1  92   1   1   0   0   1   1   1   0   0   1   151    0    0   0.438     14  0.84
  426  242 B   5   2   1   5   0   0   0   0   1   0   5   2   3   1   6  49  17   0   5   0   154    0    0   1.753     58  0.32
  427  243 B   1   2   0   0   5  76  13   0   0   0   0   0   0   1   2   1   0   1   0   0   155    0    0   0.895     29  0.80
  428  244 B   1   1   1   1   0   0   0   1   8  19   8   5   1   6   6  23   9   6   3   1   161    0    0   2.336     77  0.23
  429  245 B   0   0   0   0   0   0   1   1  15  28   5   8   0   0  32   7   0   1   2   0   151    0    0   1.769     59  0.29
  430  246 B   3   2   3   1   0   0   0   6   2   2   3   9   0   0   5  11  31   7   8   8   156    0    0   2.297     76  0.27
  431  247 B   0   0   2   1   3   0   1   6   2  14  15   2   0   1   3   1   5   8   9  28   155    0    0   2.268     75  0.25
  432  248 B   2  57   9   3   8   6   2   0   1   1   4   4   0   0   0   0   0   1   1   1   161    0    0   1.651     55  0.53
  433  249 B   5   2   0   0   1   0   0   6  21   1  20   8   0   2   9   5   4  12   2   1   161    0    0   2.308     77  0.22
  434  250 B   2   2   1   0   0   0   1   0   6   5  13  13   0   2   5  18  14   6   9   5   162    0    0   2.398     80  0.21
  435  251 B  26  24  11   2   9   0   0   2   7   1   2   2   2   3   1   0   6   1   0   2   161    0    0   2.215     73  0.27
  436  252 B  61   9   6   0   3   0   1   1   2   2   0   2   7   0   0   1   0   1   2   1   162    0    0   1.532     51  0.49
  437  253 B   1   1   0   0   0   1   0   1   3  64   3   6   0   1   1  13   2   2   1   1   162    0    0   1.430     47  0.47
  438  254 B   1   1   2   0   1   0   1  13   1   6   7  12   0   0   4   7   5   1  28   9   162    0    0   2.267     75  0.25
  439  255 B   1  78   6   4   1   0   1   0   1   4   1   0   1   0   1   0   0   1   0   0   162    0    0   0.963     32  0.67
  440  256 B   0   0   0   0   0   0   0  10   0   1   6   1   3   1   0   0   0  17   8  54   162    0    0   1.453     48  0.56
  441  257 B   0   0   0   0   0   0   0   1  12  27   9   2   1   1   2   5   2  29   4   7   162    0    0   1.963     65  0.33
  442  258 B   2  10   1   1   0   0   0   0  13   0   4   9   0   6   3   5   4  15  11  17   162    0    0   2.373     79  0.21
  443  259 B   1   1   0   1   0   0   0  88   9   0   0   0   0   0   0   0   0   1   0   0   162    0    0   0.456     15  0.85
  444  260 B  12  38  23   1   1   0   1   0   1   0   0   1   0   1  14   7   0   1   0   0   162    0    0   1.696     56  0.35
  445  261 B   0   0   1   0   0   0   0   0   4   0   6   0   0   1   1   1   1   8   4  75   162    0    0   1.007     33  0.70
  446  262 B   0  98   1   1   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.141      4  0.99
  447  263 B   1  91   7   1   1   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   162    0    0   0.388     12  0.92
  448  264 B   1   7   0   2   1   0   0   3   5   0  27   3   0   1   2   6  16  14   2  11   161    0    0   2.237     74  0.21
  449  265 B   0   2   0   4   1   0   2   2   9   0   6   0   1   1  10  41  15   1   6   1   161    0    0   1.971     65  0.30
  450  266 B   0  33   0  58   1   0   0   0   0   0   0   4   5   0   0   0   0   0   0   0   161    0    0   0.986     32  0.71
  451  267 B   3  93   2   0   1   0   0   0   0   0   1   0   1   0   0   0   0   0   0   0   161    0    0   0.343     11  0.91
  452  268 B  15   2  16   1   0   0   0   0   4   0   1   8   4   6   9   8  15  12   1   0   161    0    0   2.325     77  0.15
  453  269 B   0  14   1   2   9   0  61   0   1   1   0   1  10   0   0   0   0   0   0   0   161    0    0   1.251     41  0.62
  454  270 B   0   1   0   0   0   0   0   0   1   0   1   1   0   0   4   1   0   7  18  67   161    0    0   1.064     35  0.65
  455  271 B   0   0   0   0   0   0   0   0   1  98   1   1   0   0   0   0   0   1   0   0   161    0    0   0.151      5  0.96
  456  272 B   9   1   4   0   1   0   2   1  34   2  17   4   1   1   1   2   4   6  12   1   161    0    0   2.160     72  0.24
  457  273 B   0   2   0   4   0   0   0   6   5   0   3   4   0   7  11  37  11   3   7   1   161    0    0   2.127     70  0.30
  458  274 B   0   0   0   0   0   0   0   0   0   1   0   0   0   0  99   0   0   0   0   0   161    0    0   0.038      1  0.99
  459  275 B   0  11  86   1   0   0   0   0   1   1   0   0   1   0   0   0   0   0   0   0   161    0    0   0.542     18  0.83
  460  276 B   0   0   0   0   1   0   0   0   1   1  71  22   0   1   0   0   0   0   4   1   161    0    0   0.880     29  0.61
  461  277 B   0   0   1   0   0   0   0   2  96   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.183      6  0.94
  462  278 B   0   0   1   1   0   0   4   0   3   1   1   1   0   1  19  54   1  12   0   1   161    0    0   1.490     49  0.42
  463  279 B   1   0   1   2   0   0   1   2  23   0   5   3   0   0   7   7  22  13   2  11   161    0    0   2.162     72  0.29
  464  280 B   0   1   5   0   0   0   0   0  91   0   2   1   0   0   0   0   0   0   0   0   161    0    0   0.393     13  0.83
  465  281 B   5  65   1  16   1   0   1   0   1   0   0   1   9   0   2   0   0   0   0   0   161    0    0   1.197     39  0.61
  466  282 B   4   4   5   4   0   0   1   0   8   0   5   7   1   2   5   6  12  23  11   2   161    0    0   2.472     82  0.19
  467  283 B   0   0   0   0   0   0   0   1   0   0   0   0   0  98   0   0   0   0   1   1   161    0    0   0.142      4  0.95
  468  284 B   0   0   1   0   0   0   0   0   3  73   1   1   0   1   4   3   2   9   0   2   161    0    0   1.144     38  0.60
  469  285 B   0   0   0   0   9   6  85   0   0   0   0   0   0   0   0   0   0   0   0   0   161    0    0   0.522     17  0.96
  470  286 B   0   2   0   1  98   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   160    0    0   0.131      4  0.98
  471  287 B   0   0   0   0   0   0   0   1   8   0  10   4   0   5   6  13  16   5   7  24   154    0    0   2.184     72  0.30
  472  288 B   1   0   0   1   0   0   0   8   3   1   5   3   0   1   0   0   1   9   4  62   149    0    0   1.461     48  0.59
  473  289 B  20  45  12   2  11   0   6   1   1   0   1   0   0   1   0   0   0   1   0   1   123    0    0   1.648     54  0.55
  474  290 B   1   0   0   0   0   0   0   7   1  10   6  10   0   1   2   1   5  17  10  30   103    0    0   2.097     70  0.37
  475  291 B   1   4   1   3   0   0   0   2   3   8   3   1   0   6  11  35   3   8   6   3    89    0    0   2.284     76  0.25
  476  292 B   3   0   0   0   1   0   1   4  13  21  19   3   4   1   4   1  11   5   4   4    75    0    0   2.374     79  0.21
  477  293 B  19  23  19   4   0   0   0   0   0   2   6   2   0   4   2  17   0   0   2   0    48    0    0   2.025     67  0.21
  478  294 B   5   2   0   0   2   0   0   2   0  33   2   7   0   0  12  14   2  14   0   2    42    0    0   2.043     68  0.16
  479  295 B   0   0   0   0   0   0   0   0   0   6   6   3   3  25  11   8   8   8  22   0    36    0    0   2.066     68  0.23
  480  296 B   0  88   0  12   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0   0    25    0    0   0.367     12  0.97
## INSERTION LIST
 AliNo  IPOS  JPOS   Len Sequence
    33   130   150     3 lVIIv
    49   382   198    48 hLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVSTPYPVt
    54   156   176     1 nFs
    63   325   141     1 nSl
    64   281   103     2 gKAl
    65   282    98     1 gQy
    65   431   248     2 nPNq
    67   270    86     1 gQf
    68   325   141     1 nSl
    69   282   101     1 kNg
    71   315   131     1 nSl
    72   325   141     1 nSl
    74   282    98     1 gQf
    75   213    29     1 nRi
    75   259    76     1 gHk
    76   325   141     1 nAl
    77   325   141     1 nAl
    79   282    98     1 gLf
    80   325   141     1 nAl
    81   325   141     1 nSl
    82   282    98     1 gQy
    83   282    98     1 gQy
    84   325   141     1 nAv
    86   325   141     1 nTl
    87   323   172     1 nSl
    88   212    32     1 gQd
    89   282    98     1 gQy
    90   282    98     1 gQy
    91   282    98     1 gQf
    92   324   140     1 nSl
    93   325   141     1 nVl
    96   324   140     1 nLl
    97   270    86     1 gQf
    99   282    98     2 vGSp
    99   382   200     1 vMr
   100   282    98     1 eKh
   101   324   140     1 nIl
   102   325   141     1 nTm
   103   324   140     1 nSl
   107   244    62     1 sKd
   107   282   101     1 kDg
   108   212    31     1 nNr
   108   259    79     1 sNk
   108   282   103     1 gEg
   109   212    31     1 nNr
   109   259    79     1 sHk
   109   282   103     1 eEg
   110   213    29     1 nRi
   110   259    76     1 gHk
   110   282   100    19 sEGGRGKALPDGSTLDMNRLg
   111   282    98     1 gKf
   111   429   246     2 nTFn
   112   212    28     1 pNr
   112   259    76     1 gHk
   112   282   100    19 sEGGRGKALPDGSTLDMNRLg
   113   212    28     1 hGr
   113   259    76     1 gHk
   113   282   100    18 sEGGRGKALPDGSHEMSRLg
   114   212    28     1 hGr
   114   259    76     1 gHk
   114   282   100    18 sEGGRGKALPDGSHEMSRLg
   115   282    98     1 gKl
   116   259    80     1 sDk
   116   282   104     1 nEr
   116   430   253     1 eNi
   117   213    29     1 nRi
   117   259    76     1 gHk
   117   282   100    18 sEGGRGKALPDGSGLSKSMg
   118   325   141     1 nVl
   120   212    28     1 pNr
   120   259    76     1 gHk
   120   282   100    18 sEGGRGKALPEGSALSKNMg
   121   282    98     1 eKl
   121   430   247     1 qNn
   122   282    98     1 dKh
   123   282    98     1 eKl
   124   282    98     1 dKh
   125   212    28     1 qGr
   125   259    76     1 gHk
   125   282   100    19 sEGGRGKALPDGSNLDMGRLg
   126   324   140     1 nQl
   127   213    33     1 qRv
   127   259    80     1 aHk
   127   282   104     1 dQs
   128   213    33     1 qRi
   128   259    80     1 aHk
   128   282   104     1 dQs
   129   213    29     1 nRi
   129   282    99    16 nDGGRGRSLPNGLSMDMg
   130   212    28     1 nGr
   130   259    76     1 gHk
   130   282   100    19 sEGGRGKALPEGSSAHLSRLg
   131   213    32     1 qRi
   131   259    79     1 aHk
   131   282   103     1 dQp
   132   212    28     1 gGr
   132   259    76     1 gHk
   132   282   100    19 aDGGRGKALPEGSSPELARLg
   133   213    32     1 qRi
   133   259    79     1 aHk
   133   282   103     1 dQp
   135   430   246     1 pEn
   136   430   246     1 pEn
   137   212    28     1 gGr
   137   259    76     1 gHk
   137   282   100    19 sDGGRGKALPEGSSPHLQHLg
   139   247   104     1 gHk
   139   270   128    19 sEGGRGKALPNGSHINMNQLg
   139   422   299     1 tPl
   140   212    28     1 kDq
   140   213    30     1 qRi
   140   259    77     1 gHk
   140   282   101    19 sQGGRGKALPEGSGLAGQNLv
   142   282   106     1 gVm
   142   430   255     1 gNs
   142   434   260     1 eKl
   143   213    29     1 gRi
   143   259    76     1 gHk
   143   282   100    19 tDGGRGKPLPTGTATTVRNLg
   145   259    75     2 sDSk
   145   428   246     1 pAr
   145   430   249     2 pARt
   146   212    32     2 gQGq
   146   213    35     1 qRv
   146   259    82     1 aHk
   146   282   106     1 dQs
   147   212    28     1 gGr
   147   259    76     1 gAk
   147   282   100    19 sDGGRGKALPEGSSSQLSRLg
   147   416   253     3 tDENi
   148   212    28     1 pGr
   148   259    76     1 gHk
   148   282   100    19 aDGGRGRALPEGSGPDLGRMg
   148   416   253     3 sDKTc
   148   434   274     1 qPl
   149   213    29     1 gRi
   149   259    76     1 gHk
   149   282   100    19 tDGGRGKPLPTGTATTVRNLg
   150   213    29     1 gRi
   150   259    76     1 gHk
   150   282   100    19 tDGGRGKPLPTGTATTVRNLg
   151   422   239     1 rTf
   152   212    28     1 gGr
   152   259    76     1 gHk
   152   282   100    19 sDGGRGKALPEGSSESLARLg
   153   213    33     1 qRi
   153   259    80     1 aHk
   153   282   104     1 dQp
   160   212    28     1 pEn
   160   213    30     1 nRi
   160   259    77     1 gHk
   160   282   101    19 sQGGRGKPLPEGVLEATGHLg
   160   429   267     1 eRk
   160   431   270     2 qDEe
   160   435   276     2 nAEg
   161   381   197     1 aNa
   161   429   246     1 tTs
   162   381   197     1 aNa
   162   429   246     1 tTs
   164   282   106     1 sEl
   164   435   260     1 kIl
   165   381   197     1 aNa
   165   429   246     1 tTs
   166   381   197     1 aNa
   166   429   246     1 tTs
   167   212    28     1 gGr
   167   259    76     1 sHk
   167   282   100    19 aDGGRGKALPAGTGPELSRLg
   168   322   145     1 qNt
   168   426   250     1 pTp
   168   428   253     2 tNSa
   168   432   259     2 lGKd
   169   281   107     1 dQs
   169   434   261     1 qLl
   170   381   197     1 aDa
   170   429   246     1 iTs
   171   381   197     1 aDa
   171   429   246     1 iTs
   172   381   197     1 aDa
   172   429   246     1 iTs
   174    45    64     1 sTe
   175   381   197     1 aNa
   175   429   246     1 tTs
   176   282   102     2 aKKr
   176   325   147     1 gIl
   176   429   252     1 eGs
   176   431   255     1 gIp
   177   381   197     1 aNa
   177   429   246     1 tTs
   180   381   197     1 aNa
   180   429   246     1 tTs
   181   322   145     1 qNt
   181   426   250     1 pTp
   181   428   253     2 tNPa
   181   432   259     2 lGKd
   182   244    60     1 sQs
   182   259    76     4 kNGKPf
   182   282   103     4 pPNPRp
   182   325   150     1 gIl
   183   406   241     2 pTDt
   183   428   265     1 tAk
   184   381   197     1 aNa
   184   429   246     1 sVt
   185   381   197     1 aNa
   185   429   246     1 aQg
   186   244    60     1 sQs
   186   259    76     4 kNGKPv
   186   282   103     4 gPNPRp
   186   325   150     1 gIl
   187   213    29     1 eRi
   187   259    76     1 yHn
   187   282   100    19 sDGGRSKVLPEGSSAYLMQLg
   187   434   271     1 qAl
   188   281   103     1 rGa
   189   126   143     2 pYQk
   189   129   148     3 lVHLv
   190   244    60     1 sQs
   190   259    76     4 kNGKPv
   190   282   103     4 gPNPRp
   190   325   150     1 gIl
   191   244    64     1 sRd
   191   259    80     5 nKEGKTv
   191   282   108     2 tGEn
   191   325   153     1 mMl
   192   243    65     1 sEs
   192   258    81     4 eDGKAm
   192   281   108     3 gPANp
   192   322   152     1 aKn
   193   244    72     1 aRd
   193   259    88     5 nKEGKTv
   193   282   116     2 aGQn
   193   325   161     1 mTl
   194   244    60     1 sSs
   194   259    76    10 kGGGAGGGGKPv
   194   282   109     4 gPAPKp
   194   325   156     1 mIl
   196   381   197     1 aNa
   196   429   246     1 nMt
   197   244    60     1 sSs
   197   259    76    10 kGGGAGGGGKPv
   197   282   109     4 gPAPKp
   197   325   156     1 mIl
   199   244    60     1 sEs
   199   259    76     4 eNGKPc
   199   282   103     3 gPAHp
   199   323   147     2 sTAh
   199   325   151     1 pLl
   200   243    74     1 sRd
   200   258    90     5 nKEGKTv
   200   281   118     2 tGQn
   200   324   163     1 mMl
   202   244    60     1 sEs
   202   259    76     4 eNGKPc
   202   282   103     3 gPAHp
   202   323   147     2 sIMc
   203   279   100     1 kGa
   204   279   100     4 gNSPRg
   204   426   251     1 lPk
   204   428   254     2 dLRm
   204   432   260     2 qPYc
   205   279   100     4 gNAPVg
   205   426   251     1 lPk
   205   428   254     2 nLKs
   205   432   260     2 qAHc
   206   279   102     6 pAGGARGa
   206   423   252     1 pVy
   206   425   255     2 aTQe
   207   244    70     1 aRd
   207   259    86     5 sKEGKTv
   207   282   114     2 tGKn
   207   325   159     1 mRl
   208   244    84     1 sQd
   208   259   100     5 nKEGQTi
   208   282   128     2 nHEk
   208   325   173     1 mAl
   208   428   277     1 nVs
   209   244    84     1 sQd
   209   259   100     5 nKEGQTi
   209   282   128     2 nLQk
   209   325   173     1 mAl
   211   244    60     3 gQSTh
   211   247    66     3 gAKCi
   211   282   104    39 aAQQASSAQTGTVDEEGNWSMPMPQQVLPHNVKGKGRSKRg
   211   429   290     2 rATd
   212   210    29     1 gAt
   212   412   232     9 nQYPNSTNMLs
   212   426   255     1 eTq
   212   430   260     2 tVPa
   214   195    11     3 gGTIg
   214   273    92    12 tLASSSSVRASCTs
   215    19    41     1 gYp
   217   281   105    13 sRTLLSFLNQTTAGk
   217   380   217     1 aNs
   217   428   266     1 eTn
   220   211    37     1 gGr
   220   243    70     3 eTFEh
   220   258    88     5 rTDRETk
   220   418   253     1 nAf
   221    31    60     3 gKFCc
   222   211    37     1 gGr
   222   243    70     3 eTFEh
   222   258    88     5 rTDRETk
   222   418   253     1 nAf
   224   211    37     1 gGr
   224   243    70     3 eTFEh
   224   258    88     5 rTDRETk
   224   413   248     2 vALp
   225   211    37     1 gGr
   225   243    70     3 eTFEh
   225   258    88     5 rTDRETk
   225   413   248     2 vALp
   226   211    37     1 gGr
   226   243    70     3 eTFEh
   226   258    88     5 rTDRETk
   226   413   248     2 vALp
   227   211    37     1 gGr
   227   243    70     3 eTFEh
   227   258    88     5 rTDRETk
   227   413   248     2 vALp
   228   211    37     1 gGr
   228   243    70     3 eTFEh
   228   258    88     5 rTDRETk
   228   413   248     2 vALp
   230   209    48     1 gAk
   230   240    80     1 nDn
   230   278   119     9 vSGQKPTNGTa
   230   318   168     6 nYRNTNGe
   230   319   175     1 eTk
   230   321   178     1 fYv
   230   425   283     2 hVAp
   231   259    87    10 qDALDFKKDKGa
   231   337   175     2 sAEd
   231   428   268     1 qHr
   232    29    49     1 lPv
   233    29    49     1 lPv
   236   210    47     1 gAa
   236   241    79     1 kKh
   236   279   118     9 lPSEKPANGSv
   236   319   167     6 eRKNPTTe
   236   320   174     2 eKPe
   236   322   178     1 yFv
   236   421   278     1 kYf
   236   426   284     2 rVAp
   237    29    48     1 lPv
   238    56    82     1 sKy
   239   207    68     2 gKNg
   239   224    87     4 gELQYs
   239   280   147     3 pQRQa
   239   320   190     1 sAg
   239   335   206     2 yKPl
   239   342   215     1 gDk
   239   379   253    38 lSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVEIMGMPSKd
   239   409   321     3 qGGDg
   239   420   335     1 tNn
   239   422   338     1 qYp
   240   211    66     2 qKGe
   240   224    81     5 gETIQYt
   240   280   142     3 pQRHa
   240   320   185     1 sCg
   240   335   201     2 yKPl
   240   342   210     1 gDk
   240   379   248    38 lSLRPIFKGEEAKMDSKKNVPFQRNQMLKIMEILGMPLKq
   240   407   314     4 hKPSSl
   240   415   326     1 cLk
   240   417   329     1 nGs
   240   421   334     2 pSSt
   241   212    44     1 nLt
   241   236    69     1 qGs
   241   251    85     1 dEd
   241   274   109     2 aNQp
   241   314   151     1 eLg
   241   329   167    47 tEPGIDASNNHEEYSRVLDDADNKDTITSTHDGKATCTTSGVDREEEEk
   241   415   300     1 iSf
   241   420   306     1 eNp
   242   211    39     2 rTGe
   242   224    54     4 gELQYs
   242   280   114     3 pQRQa
   242   336   173     2 yKPl
   242   343   182     1 gDk
   242   380   220    38 lSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVEIMGMPTKd
   242   410   288     3 qSGDg
   242   421   302     1 nNn
   242   423   305     1 qYp
   243   211    39     2 rTGe
   243   224    54     4 gELQYs
   243   280   114     3 pQRQa
   243   336   173     2 yKPl
   243   343   182     1 gDk
   243   380   220    38 lSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVEIMGMPTKd
   243   412   290     1 gDg
   243   423   302     1 nNn
   243   425   305     1 qYp
   244   117   733     1 rSg
   245   207    36    15 sHSAALLPRPTSGGSNa
   245   211    55     2 dEEp
   245   212    58     1 pMt
   245   225    72     3 gKNDv
   245   258   108     2 rDKs
   245   321   173     3 gHGRk
   245   322   177     1 kRg
   245   337   193     2 kEPi
   245   344   202     1 vEr
   245   381   240     8 iNTRELFCGk
   245   415   282     6 eNLPEYNh
   245   429   302     1 qSe
   245   433   307     1 nAv
   246   208    36     2 gKNg
   246   225    55     4 gEPQYt
   246   281   115     3 pQRHc
   246   321   158     1 sAg
   246   336   174     2 fKPl
   246   343   183     1 gDk
   246   380   221    38 lSLRPIFKGEEAKMDAKKQVPFQRNQMLKIAEVLGVPNVk
   246   411   290     9 gLENWYNGVLk
   246   422   310     2 sPTg
   247   135   403     1 gYp
   248    26    28     7 gKKGESLLq
   248    90    99     1 pSd
   249   103   732     1 rSg
//